current user: public

If you have questions about the server, please let us know.

Query: gi|12044864|ref|NP_072674.1|(removed signalp:1-25) ABC transporter, ATP-binding/permease protein (MG_014) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .
# Score Template Links and tools%idFirst QIVIDLIIPSFLASAISVVFSIDKLKQDESGGKTISVDFIGGANINFANVREAQIVLATTVILLALCGLFFGLISIYCASYVSANTSFLLRKKIFAKLMRITTPSHDHYGSSTLLVRLTNDVYLMEVIAFDFLRLIIRAPLLFIGGLVFAVTTNQDMSISLLITFPLILLVIGILNRKSIPLFKENQKSVDKINERVEEDVSGYKVIQSFNLHSFTNNKFKIANEGWKKNSTSSLFINSLNIPFTFFLSSLTIIIALLLVFQLDSSVSVDPLPQDAAIRPNIFAFFQYNFYIVLGFILTSLTMVNFNRSRVALGRIKDILSQPEIKTITNKDQKELLPTLEFRNISFGLGNKNNNNFLQNLSFKFEAYKTYGIVGPTGSGKSLIANIIGGLYEPNEGEILIGGEKIQSIDSLYLSEMIGIVFQQNILFKGTISSNIKIGIETRSDWKNQSDLQKNEAMKNAAKIACADTFIEKFSDSYDHNVEQLGKNLSGGQKQRVAIARTLITKPRILVFDDSMSALDALTEKKVRENIENDLKLTTKIIISQNINSIKHADKILVIDNGRIVGFDSDQKLMKNCSLYQKMKESQKDLGGDFDAVNLast
1 -121.000[V] COG1132 ABC-type multidrug transport system, ATPase and permease components  ali follow..  23  14RRLWPTISPYLIVAAIALILNAASDTFMLSLLKPLLDDGF------GNSNSSILKWMPLAVIGLMVVRGVTGFVSSYCISWVSGKVVMHIRRRLFSHMMGMPVSFFDQQSTGTLLSRITYDSEQVAASSSSALVTVVREGASIIGLFIMMFYYSWQLSLILIVIAPIVSISIRLVSKRFRNISKNMQNTMGEVTTSAEQMLKGHKEVLIFGGQKVETERFDAVSNRMRQQGMKLVSASSISDPIIQLIASFALALVLYAASF--------PSVMETLTAGTITVVFSAMIALMRPLKSLTNVNTQFQRGMAACQTLFSILDMEQEKDEGKLEVERAKGDIEFRHVTFYYPG-KDTPALNDINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYRLGALRNQVALVSQNVHLFNDTVANNIAYARNEQY---------SRAEIEEAARMAYAMDFINKMEHGLDTVIGENGIMLSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEKADEIVVIEDGRIVERGVHAELLVQQGVYAQLNRMQFGQ........ 582
2 -116.000[U] KOG0058 Peptide exporter, ABC superfamily  ali follow..  24  175QKLLSYTKPDVAFLVFFLIVAALGETFLPYYTGRAIDGIVI------QKSMDQFSTAVVIVCLLAIGSSFAAGIRGGIFTLIFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINVFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQNALARASNTAEETISAMKTVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTLLVVQVSILYYGGHL--------VISGQMTSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHRVISLVSQEPVLFARSITDNISYGLPTVPF----------EMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQKHTVLIIAHRLSTVEHAHLIVVLDKGRVVQQGTHQQLLAQGGLYAKLVQRQMLGLQPAAD.. 750
3 -110.000[O] COG5265 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components  ali follow..  19  19RNLWPYMWPSVVWATFYLVLSKIVLILVPYFFKWVTNALNGQLHYYIPVVLVGAVMLVLAYNAAKIVQAGLNQLRDALFASVGQYAVRQLAYKTFVHMHELSLRFHLERRTGGLSRVIERGTKGIETIVRFTILNTLPTILEFALTAVIFAFYGLSYLVVVAATVWLYTWFTIRASDWRINIRREMNDSDTDANTKAIDSLLNFETVKYFGNEAMEAKRFDGAMARYEKAATQTWTSLGWLNFGQAVIFGAGMAIVMVMSAM--------EVQKGTQSLGDFVFINALLMQLSIPLNFIGFIYREIRQGLTDIEQMFDLLDVKQEVKDGAPALKVDSGAISFKDVHFAYD--PQRPILRGISFDVPAGKTVAIVGPSGAGKSTISRLLFRFYDIQSGSITIDGQDVRDVTQESLRKFIGMVPQDTVLFNDTIAYNIRYGRTDASE----------EDVEKAAELAQIAGFIKHLPDGYKSMVGERGLKLSGGEKQRVAIARTILKAPPILILDEATSALDTATEQEIQSALDIVSRGRTTLVIAHRLSTVIGADEIIVLKDGLIAERGTHRHLLDQKGLYASMWDRQREASEAEERLR 609
4 -107.000[CO] COG4987 ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components  ali follow..  16  5LPYLALYKRHLSLGIVLAIVTLLASIGLLTLSGWFLSASAVAG--VAGLYSFNYMLPAAGVRGAAITRTAGRYFERLVSHDATFRVLQHLRIYTFSKLLPLSPAGLARYRQGELLNRVVADVDTLDHLYLRVISPLVGAFVVIMVVTIGLSFLDFTLAFTLGGIMLLTLFLMPLFYRAGKSTGQNLTHLRGQYRQQLTAWLQGQAELTIFGASDRYRTQLENTEIQWLEAQRRQSELTALSQAIMLLIGALAVILMLWMASGG--------VGGNAQPGALIALFVFCALAAFEALAPVTGAFQHLGQVIASAVRISDLTDQPEVTFPDTQTRVADRVSLTLRDVQFTYPE-QSQQALKGISLQVNAGEHIAILGRTGCGKSTLLQQLTRAWDPQQGEILLNDSPIASLNEAALRQTISVVPQRVHLFSATLRDNLLLASPGSSD----------EALSEILRRVGLEKLL--EDAGLNSWLGEGGRQLSGGELRRLAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMREKTVLMVTHRLRGLSRFQQIIVMDNGQIIEQGTHAELLARQGRYYQFKQG............ 572
5 -107.000[CO] COG4988 ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components  ali follow..  17  11LWLKQQSKLALAIAVGLGVLSSLFLVAQAALLASILHQLIIE-----QVDKHLLIPHFFGLAALIAVRALCSWGREIAGFRCGEEIRRYIRQLILDKLRDLGPAYIKGKPAGSWAALMLEQVENMHDFFARYLPQMSLSVLVPFVILAVVFPVNWAAGLIFLLTAPLVPLFMALVGIKAADASRKNFKALQRLSGHFYDRLQALTTIRLFDRTTAETEHMRGASEVFRHRTMDVLRIAFLSSAVLEFFTSISIALTAVYFGFSYIGELNFGYYGASVTLFAGLFVLILAPEFYQPLRDLGTYYHAKQLAVGAAESIVDFLQTEVDTLHSGERSDNDDIEIIANDLVVLSP--QGKRLAGPLSFTLQSGKTTALVGPSGAGKTSLINTILGFMP-YQGSLTINGIELRELDHAQWRQTISWVGQNPLLLYGTIRDNVTLGKHNIAD----------EQVTQTLQAAYAQEFV--EQQGLDYPISDRSAGLSVGQAQRLALARAILQNGRFWLLDEPTASLDARSEQYVMRGLTESIQQRTALFVTHQLQPLQSVEQILVMENGLLVQAGHFEDLSQQSGLFATMLAANQALQAANKG.. 591
6 -105.000[U] KOG0057 Mitochondrial Fe/S cluster exporter, ABC superfamily  ali follow..  19  90RMISSYLWMKVISAFACLVGAKFLNVQVPFLFKVAIDWLSSSSFVDLVAAFATPSSVLIGYGIARSGSSAFNELRTSVFSKVALRTIRTISRKVLSRLHDLDLRYHLNRDTGALNRIIDRGSRAINTILSAMVFNIMPTILEISMVSCILAYFGAVYALITCLSVGSYIAFTLAMTQWRIKIRKAMNEAENDASTRAIDSLINYETVKYFNNEDYEARKYDQLHENYEDAALQSRKSFALLNFGQSFIFSTALSTAMVLCSQ--------GIMNGQMTVGDLVMVNGLLFQLSLPLYFLGVVYSDTVQGLVDMKSMFKFLEERSDIGDKDPPLVLKGGSISFENVHFSYL--PERKILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDVDSGNVKIDGQDIKEVRLESLRSSIGVVPQDTVLFNDTIFHNIHYGNLSATE----------EEVYNAARRAAIHDTIMKFPDKYSTAVGERGLMLSGGEKQRVALARAFLKSPAILLCDEATSALDSKTEAEIMKTLRSLASNRTCIFIAHRLTTAMQCDEILVMEKGKVVEKGTHEVLLGKSGRYAKLWTQQNSKLE...... 679
7 -102.000[P] KOG0056 Heavy metal exporter HMT1, ABC superfamily  ali follow..  20  233RTVFPYLWPKVIVCIILLLAGRVIKLFLPIYRKKLVDSLTIAPIVFRWDFVLIYVALSFLQGGGTGSMGLFNNLRTFLWIRVQQYTTREIEIELFRHLHQLSLRWHLQRKTGEVLRVMDRGTDSINNLLNYIVFSIAPTILDLLVAVAYFVYFNWWFGLIVFLTMFLYIASTIAITEWRTKYQRRMNLADNEQRARSVDSLLNFETVKYYGAEHYEVDCYREAILKYQKEEFLSMLTLNMLNTAQNIILCLGLLAGSLLCVYLV-------VHHQTLTVGDFVLFSTYLMELYMPLNWFGTYYRAIQKNFVDMENMFDLLKEEEEIVDGCSPLLTAGGGIEFSNVTFGYS--PEKIVLRNVSFTVPAGKTVAIVGPSGAGKSTIMRLLFRFYDVQTGAILIDGQNIKLVQQQSLRKAIGVVPQDTVLFNNTIFYNIEYAKLGASD----------EAVYEAARAADIHERILGFPEKYETKVGERGLRLSGGEKQRVAIARTLLKAPIIVLLDEATSALDTHTERNIQAALARVCANRTTIIVAHRLSTIIHADEILVLQQGSIAERGRHEELVREDGIYADMWQQQLKNLDAEQSGG 823
8 -102.000[V] COG2274 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain  ali follow..  18  144ASLWSRLQGALVYCIVAGFFLTIIGLVIPVFSQIFVDDIL------VQGRMLWLHPLLLAMAIAAILQGSLTLLRLRYLRRLKIRLAVGMSSRFLWHILRLPVSFYAQRFAGEISNRT-TLNDQVADVLAGQLATTIIDTLMVLFYALVMVQYDWVLTLMVVSFAAVNVLTLQWISRQRIDANQRLIQEYGKAAGISIATLQSIETLKASGLESDFFSRWSGYYTKALNSQQELGITNQTFSVLPTLLSALSAMLLLIVGGFR--------VMDGHLSIGMLIAFQGLMSGFQQPVNNLVNFGTTLQELEGNLIRLDDVLDNPVGEVSSLQALPKLQGYVELKNITFGY-SRLEAPLIENFNLSIKPGQRVALVGGSGSGKSTIAKLVSGLYQPWTGEIYFDSQPREEISLQLLTNSVAMVEQEILLFGGTVRDNLTLWDTTVPD----------KNLMRACQDAAIADVIFSMSGGYDAELIEGAANLSGGQRQRLEIARALVNNPSILVMDEATSALDAETEKIIDQNLRRR--GCTCIIVAHRLSTIRDCDQIIVLERGKVVQQGTHQELWQVEGAYSRLIRTE........... 711
9 -101.000[R] COG4618 ABC-type protease/lipase transport system, ATPase and permease components  ali follow..  17  13SLTAAVVSPLFLGVALVSGVVNILALTSPLFMLQVYDRVLA------SGSLPTLVGLALLALGLYGFQCLLDIIRARVLIRIGEDFDMRYSGRVHDAVVRLPLVN----RMPGDGLQPLRDLDNVRGFLSGTGPTAFFDLPWMPLYLGLCFLFHVWIGVTALAGAVLLVSLTILTNIFSQKPIRDTMVENMARNRQLEASRRNAEVVQAMGLGRRLGKRWQSSNEAYLAANRKAGDVAGGLGNLAKSLRVVLQSAILAVGAWL--------VIRQEASGGVMIASSIMMGRALAPVDLAISNWKSFVAARQSWARLRELFAQMPANA-AAMALPKPEKELRVENVTIVPPG-ERKPTVTGLGFVVTAGNALGIIGPSGSGKSTLARILTGAWMPAAGKVRLDGASFDQWDRETLGRHIGYLPQGVELFDGTIGENISRFDDNPDP----------EAIIAAARAAGAHELILRFEKGYDSDIGEAGSTLSAGQRQRIGLARALYGDPFIVVLDEPNANLDAEGEAAVVKAITSVKRGGIAVVVAHRPSAIGAVDYILMMEDGRMKAFGPRDEVLSKVLRVPQAQAAKGFAASAQTV.. 582
10 -88.300[QP] COG4615 ABC-type siderophore export system, fused ATPase and permease components  ali follow..  15  2ELLVLVWRQYRWPFISVMALSLASAALGIGLIAFI--------NQRLIETADTSLLVLPEFLGLLLLLMAVTLGSQLALTTLGHHFVYRLRSEFIKRILDTHVERIEQLGSASLLAGLTSDVRNITIAFV-RLPELVQGIILTIGSAAYLWMLSGKMLLVTAIWMAITIWGGFVLVARVYKHMATLRETEDKLYTDFQTVLEGRKELTLNRAEYVFNNLYIPDAQEYRHHIIRADTFHLSAVNWSNIMMLGAIGLVFWMANSL-----------GWADTNVAATYSLTLLFLRTPLLSAVGALPTLLTAQVAFNKLNKFALAPFKAEFPRPQAFPNWQTLELRNVTFAYQD--NAFSVGPINLTIKRGELLFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDYRKLFSAVFTDVWLFDQLLGPEGKPANPQLVEKWLA---------------QLKMAHKLELSNGRIV-----NLKLSKGQKKRVALLLALAEERDIILLDEWAADQDPHFRREFYQVLLPLMQGKTIFAISHDDHYFIHADRLLEMRNGQLSELTGEERDAASRDAVART............... 546
11 -75.500[I] KOG0064 Peroxisomal long-chain acyl-CoA transporter, ABC superfamily  ali follow..  13  115.MLAKIMIPQLSVHTFCLISRTFLSIYVAALEGALVKFIV-------RKDIKQFALVLLKWFGIAIPATFVNSMIRFLESKLSLAFRTRLVRHSYRLYFKNQNYYRVSNLDGRIENRLTEDISVFANSVAHLYSSLTKPCFDLMLIGLALMRSSKKMKALSIGVIALTAHILRIVSPKFGQLVSEEANRYGYLRHIHSRIITNAEEIAFYGGHKVEMQQLRQAYNRLVNQMTTIFNQKLWFIMLEQFFMKYVWSGTGMI-------VSLPILTGSDVGLGTLTTARNLLISAADAIERLMSSYKEIVSLAGYTFRVAGMMDVFEETALGVYCDDPKNMSISLRAVPVVTPN--CDIVVPKLTLCIEPGVHLLITGPNGCGKSSLFRILSGLWPIYAGELHIPRPV-------KDVPCMFYIPQRPYMSIGSLCDQIIYPDTREDMKRKHITENELRSILKMVSLEHI------AQRDSFDVVRDWKDILSGGEKQRMAIARLFYHRPRYALLDECTSAVSIDVESSIYEIAKGM--GITLLTITHRPTLWKYHTHILEFDNWQFRKMNSDEEQKGQFL.................... 729
12 -71.500[R] COG4178 ABC-type uncharacterized transport system, permease and ATPase components  ali follow..  11  48RQYWRITRGYFAVLLFSVVISVRLNVLFSYQSKDLYNALQAAFEGAGAQNDLVKMHGFWMSLGIFSILAVIFIARVMADIYLTQRFIIAWRMWLTNHLTTDWLDYYREQFIDNTIQRIQQDIDIFTAGAGGTPNGPSNGTGSTLLFGAVEFEIPRAMFWIVIVYVLLATIITFWIGRPLIGLNFANEKLNAAFRYALVRLRDAAEAVAFYRGEEAERKQLEQRFTPIIDNYRRYVSRTIRFLGWNASVSQTIVPLPWILQA---------RLFAGKINLGDVGQTATAFGNIHDSLSFFRNNYAAFAAFRAAIIRLHGLVVANARSRELPTAKSTNDGTVHVVAVEVRTSA--GEQLIDPLDLQLNCGSSLVITGRSGVGKTTMLRSLAELWPYASGTLSRP----------DGKNETMFLSQLPYVPLGNLRGVVCYPNAPAD--------IPEDTVRDTLTKVALNPLCDRLDE-----ERDWAKILSPGEQQRIAFARILLTKPKAIFLDESTSALDEGLEFALYQMLRSELPDCIIVSVSHRRAVELLHAQQLELLGGGQWRLGPVEKEPLH...................... 637
13 -65.200[IR] KOG0060 Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis)  ali follow..  12  71ARILKILIPGLILIAVSLLCRTYADVYMIITSTKIEASIIDRN---PLLFALEAFKYVLNLPAISVTNAILKFGIAELKLRFRERLSTHLYSQYLKGFTFYKMSNLDT-RIQNADQLLTQDVDRFCDGIVELYSNLSKPILDVFLYLFRLGTSGFSSPSILFSYLLFTGVGLTYLRRPIGRLTVEEQALEGEYRYVNSRLIMNSEEIAFYQGNQSEKETIMSTFASLVQHLRKIILFRFSIGFVDNIVAKYVVGWYAVGSSFFDKQHKPFIGMSRNQLMQEYYNSGRMMYKMAEALGRLALAGRDMTRLSGFTSRVDTLLNVLDDVNSGSGNLRVQDNVIRFDNVPLVTPN--GDVLIERLNFEVPSGTNVLVCGPNGCGKSSLFRVLGELWPLFGGTLTKPA-----------KGKLFYVPQRPYMTLGTLRDQIIYPD---RPLDMIRKGVSDSDLEQMLENVQLTHILE--REGGWSAVQDWMDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGAMYRLCREK--NITLFTVSHRKSLWKYHEYSLYMDGRRFEQIDDQSDQFGS...................... 661
14 -49.400[R] COG4619 ABC-type uncharacterized transport system, ATPase component  ali follow..  24  1............................................................................................................................................................................................................................................................................................................................................MQENSPLLQLQNVGYLAG---DAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFP-------QIRNRQPDPAIFLDFLERFALP----------DSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVRNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARYEL......................... 224
15 -45.400[P] COG1117 ABC-type phosphate transport system, ATPase component  ali follow..  23  1...........................................................................................................................................................................................................................................................................................................................MLTKKPEINTILQTTPDPHSLPAAMATEDLHVYYGDNH---AIKGVDLTFPENKVTALIGPSGCGKSTYLRALNRMNDEIEGQILYDGINIKEVDLYNVRKEIGMVFQKPNPFTKSIYENVAFGLKRHGMKNKKEIMERVEKSLRRA----------ALWDEVKDDLGKSALSLSGGQQQRLCIARAVAMQPKVLLLDEPASALDPISTSKIEDLINELKNKYTIIIVTHNMQQAARSDYTSFFYLGEVVEFSGTSELFTN...................... 256
16 -43.500[R] COG1101 ABC-type uncharacterized transport system, ATPase component  ali follow..  16  2...................................................................................................................................................................................................................................................................................................................................................IRLQDIQVTFNPGTENRALRGVSLEVPEHQFLTVIGSNGAGKSTLLGAVTGETPIVGGQVLIDEIDVTKQSVDQRANLCARVFQDPLTCGATIEENMALA--------MRGKKRGWSLALSNQRRKLFQERISILGLGLEDRLGDNIGLLSGGQRQAVSLVMATLSESKLLLLDEHTAALDPRMAAFIIDLTKKIVKNLTVMMVTHSMKDALAGDRTVMLHQGQIVLDVTGEQRANM...................... 239
17 -43.200[E] COG1126 ABC-type polar amino acid transport system, ATPase component  ali follow..  27  2...................................................................................................................................................................................................................................................................................................................................................INFKNVSKHFGKIQ---VLHDINLNITQGEVVVIIGPSGSGKSTLLRCINKLEVITRGQLIVDGLDVNSPDERQIRLEAGMVFQQFYLFPHTALENVAFG---PTKVRGTSKEEAKKQALALLSKVGLEDRAHHYPA-----------ELSGGQQQRVAIARALAVKPKLMLFDEPTSALDPELRHEVLTVMKDLAEGMTMVIVTHEVGFAQKASRLIFIDKGRIAEDGDPDSLISN...................... 226
18 -42.400[E] COG4598 ABC-type histidine transport system, ATPase component  ali follow..  23  6...................................................................................................................................................................................................................................................................................................................................................LNVIDLHKRYGEHE---VLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINLVQLRLLRTRLTMVFQHFNLWSHTVLENVMEAPIQVLGLSKQEARERAVKYLAKVGIDERAQ-------------GKYPVHLSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELVGEVLRIMQQLAEGKTMVVVTHEMGFARHSTHVIFLHQGKIEEEGAPEQLFGN...................... 242
19 -41.400[H] COG3840 ABC-type thiamine transport system, ATPase component  ali follow..  26  2...................................................................................................................................................................................................................................................................................................................................................LKLTDITWLYHH-----LPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGALTIDGVDHTTTPPS--RRPVSMLFQENNLFS-TVAQNIGLG-----NPGLKLNAVQQEKMHAIARQMGIDNLMARLPG-----------ELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQKMTLLMVSHVEDAARIATRSVVVADGRIAWQGMTNELLSG...................... 220
20 -41.400[P] COG3638 ABC-type phosphate/phosphonate transport system, ATPase component  ali follow..  21  1...........................................................................................................................................................................................................................................................................................................................MGQALRKLTAADYPVVVQEPRKKVLAVKGLVKAYKS--QHRVLDNINFELHAGEFVAIIGRSGAGKSTLLHILNGTIPTSAGEIINYHENGTTKQMRKWRAKCGMIFQDFCLVPRDVITNVLLGRLSYT-----STLKSFFKLFSEQDQARAIELLQWL--NMLPHALQRAENLSGGQMQRVAICRAMMQNPKILLADEPVASLDPKNTTRIMNTLQKISEDIAVIVNLHSVDLVKDCTRVIGIAHGRIIFDGPPSMLNDS...................... 263
21 -40.900[E] COG4161 ABC-type arginine transport system, ATPase component  ali follow..  24  2..................................................................................................................................................................................................................................................................................................................................................SIQLNGINCFYGAHQ---ALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFSDKAIRDLRRNVGMVFQQYNLWPHTVQQNLIEA---PCRVLGLSKDQALARAEKLLERLRLKPYSDRYPL-----------HLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAENITQVIVTHEVEVARKASRVVYMENGHIVEQGDAS........................... 226
22 -40.200[D] COG2884 Predicted ATPase involved in cell division  ali follow..  21  2...................................................................................................................................................................................................................................................................................................................................................ITLDHVSKKYKS-LARPALDNVNVKIDKGEFVFLIGPSGSGKSTFMRLLLGAETPTSGDVRVSKFHVNKLPIPRLRQVIGCVFQDFRLLQQTVYENVAFALEVIGRRSDAINQVVPDVLETV---------------GLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERINRGTTVLMATHDHHIVDSRQRVVELSLGRLVRDEWCGI.......................... 224
23 -40.100[O] COG0396 ABC-type transport system involved in Fe-S cluster assembly, ATPase component  ali follow..  23  2...................................................................................................................................................................................................................................................................................................................................................LEIRNLHARI-VDDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAGRYEVTEGDILYNGQSILEMDPAEATSGIFLAFQYPMEIPGATMEFLKVAMNEQRKARGEEPLKIPERVKEAAASLNMDMAMLKRP----------NVGFSGGEKKRAEILQMKLLEPKLCVLDETDSGLDIDALKIVSDGVNALRADRAFLVITHYQRLLEHPDSVHVLYRGQVIKSGDKSLALD....................... 237
24 -40.100[P] COG1135 ABC-type metal ion transport system, ATPase component  ali follow..  23  2...................................................................................................................................................................................................................................................................................................................................................IEIKSVNKVFYQGDKQHALKDINLFIPQGTIFGVIGSSGAGKSTLIRCVNMLEKPTSGQVIVDGVDLTTLSNPQLRRNIGMIFQHFNLLSSTVFENVALP-----ELAGQSQQHIETKVTELLALVGLSEKRESYPA-----------NLSGGQKQRVAIARALASDPKVLLCDEATSALDPATTQSILELLKEINRNLTILLITHEMDVVKSCHEVAIIGGGELVEKGTVGDIFAH...................... 231
25 -39.900[Q] COG1127 ABC-type transport system involved in resistance to organic solvents, ATPase component  ali follow..  20  7...................................................................................................................................................................................................................................................................................................................................................IEVKGLTKSFG---SSRIWEDVTLDIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSILIDGTDIIECELYEIRTLFGVLFQDGALFGSNLYDNTAFP---LREHTKKKESEIRDIVMEKLQLVGLGGDEKKFPG-----------EISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINADATILIVTHNVNIARTPDNMGMLFRKHLVMFGPREVLLTSDEPV.................. 237
26 -39.900[PH] COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components  ali follow..  20  6...................................................................................................................................................................................................................................................................................................................................................ISTETLSLGYGDAV---IIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRGGSVLLEGRAIAKLPTKEVAKELAILPQGPSAEGLTVHQLVKQGRYPYQNWLKQWSKEDEEAVERALKATKLEDMADRA------------DSLSGGQRQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEILDLLFELNEDRTIVMVLHDLNACRYAHHLVAIKDKRIYAEGRPEEVITCDLV-QNVFSMN........... 242
27 -39.400[P] COG4604 ABC-type enterochelin transport system, ATPase component  ali follow..  18  2...................................................................................................................................................................................................................................................................................................................................................IEINDVNKKYQQTT---VLNEINERIPSGGITSIIGPNGAGKSTLLSIMSRLLAADSGNVLFNGLDVAKTSGDKLATILSVLRQENHFSRLTVSDLVGFGR--YPYSRGRLNKNDRQHIDAAMEFLNLMPLKDRYLD-----------ELSGGQRQRAYVAMVLCQDTSYILLDEPLNNLDMKHCVAMMKQLRRAADHKTIILVIHDINASAYSDHIIAMKNGEVIYRGAPAEIMQPSIL-EEIFDIK........... 236
28 -38.800[V] COG1136 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  24  1...............................................................................................................................................................................................................................................................................................................................................MANMLEVKHINKTYKGQVSYQALKQISFSIEEGEFTAVMGPSGSGKTTLLNIISTIDRPDSGDILINGENPHRLKRTKLRKQLGFVFQDFNLLDTTIGENIMLPLTLEKEAPSVMEEKLHGIAAKL---------------GIENLLNKRTFEVSGGQRQRAAIARAVIHKPSLILADEPTGNLDSKATKDVMETLQSLNRHVTALMVTHDPVSASYCRRVIFIKDVVLFN................................ 223
29 -38.200[E] COG1125 ABC-type proline/glycine betaine transport systems, ATPase components  ali follow..  25  2...................................................................................................................................................................................................................................................................................................................................................IELDKLSKTFTQKNGKEAVDSVSLTVEKGEICVFLGPSGCGKTTTLKMINRIIPPTSGRVLIDGQDTADLDEVTLRRHIGYVIQQIGLFP-TIEENIMVV-----RLLGWDKARCKEKARELMSMVKLEQYLQRYPR-----------ELSGGQQQRVGVIRALAADAPLLLMDEPFGAVDPINRESIQNEFFEMQRGMTVIMVSHDIDAIKLGDKVAVFKSGRLLQYDHPDTLLAH...................... 231
30 -38.100[Q] COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component  ali follow..  23  7...................................................................................................................................................................................................................................................................................................................................................VEVHRLRKSVGGEHELSILTGVELVVKRGETIALIGESGSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQHVGFVFQSFMLIPTNALENVELPALLRGENSGQSKAGAKALLEQL---------------GLGKRLDHLPAQLSGGEQQRVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNRGTTLILVTHDPALAARCDRRLRLVNGQLQE................................ 226
31 -38.000[O] COG4133 ABC-type transport system involved in cytochrome c biogenesis, ATPase component  ali follow..  19  2...................................................................................................................................................................................................................................................................................................................................................LEARELLCERD---ERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEVLWQGQPLHQVR-DSYHQNLLWIGHQPGIKTRTALENLHFY----------HRDGDTAQCLEALAQAGLAGFEDIPVN-----------QLSAGQQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTQGGIVILTTHQPLNVAEKIRRISLTQTRAA................................. 205
32 -37.800[P] COG1121 ABC-type Mn/Zn transport systems, ATPase component  ali follow..  21  6...................................................................................................................................................................................................................................................................................................................................................LKVENLTVYQ---GNYLAIRDVSFNLLPGTDTAIVGPNGAGKSTLVKAILDLIPRRVGQIEIFGRPITKL--GNLRHLLGYMPQNFIFFPISVEELVGLGWVAEARHQKSSSREKSAAIATALKRTDTYHLRNQ-------------GTLSGGQLKRILLAYCLVIPRKILVLDEAFAGVDMQGAADFYAMLNELKQGWTVLQVSHDIDMVSRCDRVLCLN-QTVVCTGQPEIALSPQNL................... 242
33 -37.800[R] COG1137 ABC-type (unclassified) transport system, ATPase component  ali follow..  21  4...................................................................................................................................................................................................................................................................................................................................................LTAENLAKSYKSRK---VVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIVIDGEDISLLPMHNRQRGIGYLPQEASIFRRTVYENLMAVLEIRKDLTPQQRREKADELIEEFNISHIRD--------------NLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKIITDLRRGLGVLITDHNVRETLDCERAYIVGAGKIIATGTPEQVMNDEQVKRVYLGEQFK......... 240
34 -37.100[V] COG4167 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  25  6...................................................................................................................................................................................................................................................................................................................................................LEVRNLSKTFRRRQTVEAVKPLSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGELLIDDHPLHFGDYSFRSQRIRMIFQDPS---TSLNPRQRISQILDFPLRLNTDLEPEQRRKQIIETMRMVGLLPDHVSYYPH-------MLAPGQKQRLGLARALILRPKVIIADEALASLDMSMRSQLINLMLELQEGISYIYVTQHIGMMKHSDQVLVMHQGEVVERGSTADVLAS...................... 241
35 -37.000[E] COG4175 ABC-type proline/glycine betaine transport system, ATPase component  ali follow..  24  1..................................................................................................................................................................................................................................................................................................................MAIKLEVKNLYKIFG-----EHPQRAFKYIEKGLSKEQILEKTG---LSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELRKKIAMVFQSFALMP-TVLDNTAFG-----ELAGIAAQERREKALDALRQVGLENYAHAYPD-----------ELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAQRTIVFISHDLDAMRIGDRIAIMQNGEVVQVGTPDEILNN...................... 255
36 -36.900[P] COG1118 ABC-type sulfate/molybdate transport systems, ATPase component  ali follow..  26  2..................................................................................................................................................................................................................................................................................................................................................SIEIANIKKSFGRTQ---VLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVSRLHAR--DRKVGFVFQHYALFR-TVFDNIAFGLTVLPRRERPNAAAIKAKVTKLLEMVQLAHLADRYPA-----------QLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEKFTSVFVTHQEEATEVADRVVVMSQGNIEQADAPDQVWRE...................... 227
37 -36.700[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  21  2...................................................................................................................................................................................................................................................................................................................................................LCVKNVSLRLP---ESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALASCTGELWLNEQRIDILPTA--QRQIGILFQDALLFD-SVGQNLLLALP-----ATLKGNARRNAVNDALERSGLEGAFHQDPA-----------TLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRAIPVVQVTH--------DLQDVPADSSVLDMAQWSENYNK...................... 215
38 -36.500[CP] COG4555 ABC-type Na+ transport system, ATPase component  ali follow..  21  2...................................................................................................................................................................................................................................................................................................................................................ITLTDCSRRFQDKKKVKAVRDVSLTIEKGEVVGILGENGAGKTTMLRMIASLLEPSQGVITVDGFDTVK-QPAEVKQRIGVLGGETGLYDRTAKENLQY-------------FGRLYGLNRHEIKARIEDLSKRF--GMRDYMNRRVGGFSKGMRQKVAIARALIHDPDIILFDEPTTGLDITSSNIFREFIQQLKEQKTILFSSHIMEEVQACDSVIMIHSGEVIYRGALESLYESER.................... 229
39 -36.300[P] COG4559 ABC-type hemin transport system, ATPase component  ali follow..  19  1............................................................................................................................................................................................................................................................................................................................................MTASSPSIRVTDLSYSVAGRE---LLSKLKFHLQSGEMLAVLGRNGAGKSTLLKHLTG--ELGKSGVELFGQPLRDIKPAEAAKRRAVLPQQTPLFAYEVLDVVLLGRIPHGQRETVQDRAIAAACLERVGLSGYET--------------RDVLTLSGGEQQRVHFARTLAQGERVLLLDEPTASLDLAHQHATLRLARELCEGVGVLAVLHDLNAAQYADRVLMLAEGHVIACDHPAVALTPESI................... 236
40 -36.300[P] COG4107 ABC-type phosphonate transport system, ATPase component  ali follow..  19  6...................................................................................................................................................................................................................................................................................................................................................LQVHELSKSYGGIK---ACDRISFDLYPGQVLGIVGESGSGKSTLLGAIADHIAVDHGNVTYISRSGEDLEIFQLRTEWGFVQQNPR---DGLRMRVSAGANIGERLLDIGVRHYGNIRDEAAHWLREVEIDPTRIDDLPA-------QFSGGMQQRLQLARVLVTRPRLILMDEPTGGLDVSVQARLLDLLRSLVRHLSVIIVTHDIGVVRLAHRLLVMQQGQVVESGLTDQVLDD...................... 241
41 -36.100[H] COG4138 ABC-type cobalamin transport system, ATPase component  ali follow..  17  2.......................................................................................................................................................................................................................................................................................................................................................SIVMQLQDVAESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGM--SGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPFATPVWHYLTLHQHDKTRTELLNDVAGALALDDKLGRS---------------------NQLSGGEWQRVRLAAVVLQAGQLLLLDEPMNSLDVAQQSALDKILSALCQGLAIVMSSHDLNTLRHAHRAWLLKGGKMLASGRREEVLTPPNL-AQAYGMNFR......... 235
42 -36.000[P] COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component  ali follow..  22  2...................................................................................................................................................................................................................................................................................................................................SAYPKLVQSNEPHPTAIELKDVQISFRLADGGRAVAESNLAVAENEFVAIVGPTGCGKSTLLNAVAGLLTPASGTVEISGQRLQG------NRKAGYLFQQDALMP-TVLENVAIG----LEIAGTPKAKAREQAREWLNKVGLGTFGDRYPH-----------MLSGGQRKRVGLAQVLIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLWSKKAVMFVTHDLEAIALADRVVIMSRARIMA................................ 233
43 -35.600[P] COG4525 ABC-type taurine transport system, ATPase component  ali follow..  26  2...................................................................................................................................................................................................................................................................................................................................................LNVSGLWAEYQGKP---ALQDVSLQIASGQLVVVLGPSGCGKTTLLNLIAGFMTPSAGVITLDNIPVSG------SAERGVVFQNEGLLP-DVVSNVEFG-----QLAGMSKEQRRVTALKMLNRVGLAGFEHHFIW-----------QLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFTREQMQELLLTIWRGKQILLITHDIEAVFLASELLLLSPGQVVER............................... 212
44 -35.400[E] COG3842 ABC-type spermidine/putrescine transport systems, ATPase components  ali follow..  27  1...............................................................................................................................................................................................................................................................................................................................................MQPVVHFKNVNKYYG---GLPAVDDLDLAVESGQFVTLLGPSGCGKSTTLRMLGGFEQPSSGEIYLEGKPITHLPPN--RRNVNIVFQDYALFP-NVGRNIAFG-----ELKGLSSDAIHKRTMELLALVKLQDFADRMPD-----------QLSGGQRQRVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTIQRGKTFIFVTHQEEALTMSDVIVVMNKGRIEQMGGPNELYSR...................... 225
45 -35.100[E] COG0410 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  24  2...................................................................................................................................................................................................................................................................................................................................................LSFDKVSTYYGKIQ---ALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTIRKSIAVVPEGRRVFSRTVEENLAMGGFFTDKDDYQVQM----------------DKVLELFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRREGVTVFLVEQ-QALKLADRAYVLENGRIVMHDTGAALLTNPKV................... 226
46 -34.900[RK] KOG2355 Predicted ABC-type transport, ATPase component/CCR4 associated factor  ali follow..  16  14...................................................................................................................................................................................................................................................................................................................................................IRVSGMQFAYEV--EDPIFFDFNLDLPAGSRCLLVGANGSGKTTLLKILAKHMVGGKNVVQVLSRSAFHDTQLVCSGDLSYL-------GGSWSKTVGS----AGEVPLQGDFSAEHMIFGVEGTDPVR--REKLIDLLDINLQWRMHKVSDGQKRRVQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECDGATIVYATHIFDGLETATHLAYIQDGELNRLSKMTDIEEL...................... 239
47 -34.800[P] COG4778 ABC-type phosphonate transport system, ATPase component  ali follow..  19  2...................................................................................................................................................................................................................................................................................................................................................INVQNVSKTFQNGVRLPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLPDEGQIQIEWVDLVTAPARKVKTTVGWVSQFLRVIPRSALEVVMQPLLDTGVPREACAAKAARLLTRLNVPERLWHL--------------APSTFSGGEQQRVNIARGFIVDYPILLLDEPTASLDAKNSAAVVELIREATRGAAIVGIFHDEAVRNDADRLHPMGASS................................... 226
48 -34.400[E] COG0411 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  23  2...................................................................................................................................................................................................................................................................................................................................................LKLASISKRFGG----SVLQDVNIEVPQGTIFGLIGPNGAGKTTVFNLITGLLEPTGGTLTFGGTSLVGKKPHQIQMGIARTFQNIRIFKETLLENVVVGMHRHLDYGAPGLLLSLPGYRAAERRARALELLSWV--KLDHKAGDIADNLSYGDQRKLELARALATEPKLLLLDEPVAGMNTGEKVDLMAEIENIRRGYTIFMIEHDMRFVMGCERIAVLNFGRIIAEGPPEAIRNNPQVIEAYLGRDDDDGEGGAAAQ 261
49 -34.300[EP] COG1124 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  28  6...................................................................................................................................................................................................................................................................................................................................................LEIRNLSRCFPIHNA-RAVDDVSFYIERGAVYGLAGESGSGKSTIARLIMGLEKPSCGEIRIDGEMIAAGASRAHGKKVQMVFQNPG---SSLNPRRTVGQS-VAVPLDAHGFPSLQRAKRISELLEMVQLPANFAERFPH-------ELSGGQKQRVAIARALAVAPKLLVLDEPTSALDVSVQAKVIDLLVDLGRDLTYLFISHDLSLMRNASRVGILYRGKLVETGKTDEVFYR...................... 242
50 -34.100[G] COG3839 ABC-type sugar transport systems, ATPase components  ali follow..  26  4.................................................................................................................................................................................................................................................................................................................................................SFLKITDLYKSYGSVS---VLKDINIEIDEGGFLVLVGPSGCGKSTLLNTIAGLEPITSGDIAINGKSVSNLHPS--QRDIAMVFQSYALYP-TVAGNIAFG-----EIRKVPKPERDKAIQQVADMLQIGHLLDRKPS-----------QLSGGQRRRVAMGRALVRNPQVFLFDEPLSNLDAKLRVDMRTEIKRLHSKTTIVYVTHQIEAMTLATKIAVLKDGVLQQFGTPAEIYNN...................... 226
51 -34.100[V] COG1131 ABC-type multidrug transport system, ATPase component  ali follow..  20  1...............................................................................................................................................................................................................................................................................................................................................MPSILSISGVSKTYATG---TALKEVNLDIQRGEIFALLGPNGAGKTTLISIVCGIVNRSTGTVTVDGHDIGK-DYRAARSLIGLVPQELTIDAFSVWATVNY----RGLFGKPPNHGFVEKVLRDLSLWDKKD--------------AKAITLSGGMKRRLMIAKALSHEPRILFLDEPTAGVDVELRQDMWEMVRRLRDGVTIILTTHYIEEAEAADRVGVINRGEIILVENKAELMHKLG.................... 226
52 -33.900[E] COG4608 ABC-type oligopeptide transport system, ATPase component  ali follow..  25  6...................................................................................................................................................................................................................................................................................................................................................LEVKNLTKSFDINGG-RAVDNLSFSVYEGEVLGIVGESGCGKSTTGKAILRLIEPSSGEVYFAGTEITALSMRKRRRDMQIIFQDPY---ASLNPRHTIEKIIREPLIVHQIGTKKEQLERVEELLETVGLSSDHATRYPH-------QFSGGQRQRIGIARALAVHPKLVICDEPVSALDVSVQSQILNLMADLKEALTYIFIAHDLSVVKHSDRVAVMYLGRMVEMATKDQLFEN...................... 246
53 -33.800[R] COG4152 ABC-type uncharacterized transport system, ATPase component  ali follow..  17  2...................................................................................................................................................................................................................................................................................................................................................LTIDHVTKTFG---DYKAVDGLDLDIPEQQMFGLLGANGAGKTTTFRMILGLLSITEGSISWKGRPVN----YHISNKIGYLPEERGLYPKKVRDQLVY-------------LARLKGMEKREAVKELGTWLERF--NITDYENKKVEELAKGNQQKIQFISAVLHKPELLILDEPFSGLDPVNVELLKEAVISLKSGVSILFSSHRMEHVEECENLCILQKGKPVVQGKLKEIKRSFG.................... 221
54 -33.700[P] COG4148 ABC-type molybdate transport system, ATPase component  ali follow..  24  16.......................................................................................................................................................................................................................................................................................................................................................................TINETLPANGITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLKGICLTPEKRRVGYVFQDARLFP-KVRGNLRYG-----------AKSMVDQFDKLVALLGIEPLLDRLPG-----------SLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPRKRELLPYLQRLTRNIPMLYVSHSLDEILHADRVMVLENGQVKAFGALEEVWGS...................... 219
55 -31.400[EP] COG0444 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  24  1...............................................................................................................................................................................................................................................................................................................................................MMSLLDVKDLRVEFSTQDGITAVNDLNFSLKQGETLGIVGESGSGKSQTVFAIMGLLAKNTGSAKFEGKEILNLPERELNEQIAMIFQDPMTSLNKVSDQLMEVLMLHKGMGKAEAFEESVRMLEAVKIPEARKRITMYPH-----------EFSGGMRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMELLNELKRNTAIIMITHDLGVVAGCDKVLVMYAGRTMEYGSVNDIFYN...................... 244
56 -31.200[V] COG4170 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  17  4...................................................................................................................................................................................................................................................................................................................................................LDIRNLTIEFMTSEGPKAVDRISMTLTEGEVRGLVGESGSGKSLICGVSKDNWRITADRFRFNDIDLLQLTPRQRRHNISMIFQEPQSCLDSIGLQLIWTYKGRWWQRFHWRKRRAIELLHRVGIKDHKDIMHSYPY-----------ELTEGECQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARLNQNTTILLISHDLQMMSKATRVNVLYCGQTVESAVCEDLLST...................... 249
57 -30.900[R] COG4586 ABC-type uncharacterized transport system, ATPase component  ali follow..  18  31................................................................................................................................................................................................................................................................................................................................................................RQILAVQDISFTIPPGAMVGFLGANGAGKTTTLKMLTGLIKPSGGKVRVAGFDPFR-RQTAFLRRTSLVMQKQQLIWDPTLDSLRI-------------NGAIYEIPDQVFEQRLGELSEML--DLTTELKQPVRKLSLGQRMKAELLAALLHHPTVLFLDEPTLGLDVNAQVAVRRFLQEYNRQATVLLTSHYMADITTCERVLLIHQGQLMYDGDLEALVERFSPYRQV............... 250
58 -30.600[R] COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain  ali follow..  17  373.................................................................................................................................................................................................................................................................................................................LCVSRYGSVKPLEKLKFRNVSKLFASTLDLEKVSDEVRTVLESFGRVVERYVLRDVNLEIKPGEIVAVVGASGSGKTTFLRLIVGEALKLDDDVYKPSSGMVEVVVDSIAAMIPSELEPQITEKSILEQIFDI-------------TGDIHLAVEVLNRAGISD---------AVLYRARFNELSTGQKERFKLAACLAKKPSLMLVDEFAAHLDEMTAVRVARKISELARKITLIAVTHRKEVINAPDRILYVGYGGVTES............................... 619
59 -30.300[P] COG1119 ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA  ali follow..  16  8...................................................................................................................................................................................................................................................................................................................................................LQILQGTFRL---SDTKTLQLPQLTLNAGDSWAFVGSNGSGKSALARALAGELPLLKGERQSQFSHITRLSFEQLQKLVSDEWQRN------------NTDMLGPGEDDTGRTTAEIIQDEVKDAPRCMQLAQQF--GITPLLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPFDGLDVASRQQLAERLASLHQGITLVLVLNRFDEIPEVQFAGVLADCTLAETGAKEELLQQ...................... 229
60 -29.900[R] COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase  ali follow..  21  1...........................................................................................................................................................................................................................................................................................................................MMVCAMQPTLYMSEVVSMKPAKPLLEVRNLVTEFPLRTGVRAVNDISFSIEPGKTLCVVGESGSGKSVTARSILQIIDSTSGSIILNKADGSSVDLAKLDADIAMIFQEPM----TVGDQITEVLRLHLKMSKAQARAEAIELLRQVEIPNPEKALDRYAF-----------QYSGGMRQRAMIAMALACKPQLLIADEPTTALDVTTQAEILDLISRLQKGMAVLFITHDMGVVAQADDVLVMHHGVVKEYGTVEQIFHK...................... 278
61 -29.500[Q] KOG0061 Transporter, ABC superfamily (Breast cancer resistance protein)  ali follow..  19  66..................................................................................................................................................................................................................................................................................................................................................VLSFDNLTYNVSRPKTKTLLNNISGETRDGEIMAVLGASGSGKSTLIDALANRIAKGKGTVKLNGETLQS---RMLKVISAYVMQDDLLFPMTVEETLMFA----------AEFRLPRSLPKSKKKLRVQALIDQIRNAAKTIIGDEGHRISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLKRIAQGSIVIMSIHQPSHLGLLDRLIFLSRGHTVYSGSPASLPR....................... 323
62 -29.300[R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component  ali follow..  18  8...................................................................................................................................................................................................................................................................................................................................................LSVKDLRVRFRTLDGAEAVKGINIHVNAGETVAVVGESGSGKSQTMMAAMSLLASNTGSVDYRGRNLLTLSKSDLNAKISMIFQEPM----SIGNQLIEPIRRHRGLNAAEAREEALKLLRLVHIPDPERRMKSYPH-----------EMSGGQRQRVMIAMALANDPDILIADEPTTALDVTIQAQILMLLAELQRGMAIVFITHDLGIVRRADRVYVMRQGEVVEEGEAGAIFAN...................... 247
63 -29.200[R] COG3910 Predicted ATPase  ali follow..  10  2...................................................................................................................................................................................................................................................................................................................................................LFLDSVAMKEKPEGSVPAMRHLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKKFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPE---------FRGIVRNNSLDRRSHGEGF-LDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADGGQLIIATHSPVLLA-EATIYYFDEDGITERLYDE--LENIAFLRRFLDRPSKYLDD..... 258
64 -29.200[R] COG4674 Uncharacterized ABC-type transport system, ATPase component  ali follow..  19  6...................................................................................................................................................................................................................................................................................................................................................LEIQDLTVSFDG----RALNHLTFSMNPGELRVIIGPNGAGKTTFLDVITGKVQPTEGRVLFQGKDIRKIPEYRIRLGVGRKFQTPRVYLNTVAENLDLAVNRKKSVWGTLMGQA-----TGAEQRSVGGLLETI--GLTPKAHLAAALLSHGEKQRLEIGMLVAQSPTLLLVDEPVAGLTDEETENVGDLLLALAESHSIIVIEHDMEFVRQARKVTVLHQGSVLCEGNMDQIQNDPKV................... 238
65 -28.000[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  14  182..............................................................................................................................................................................................TDERGFLDELIDRLDLRGVVERKISELSGGELQRVAIAACAARDAQFYFFDEIS----PYLDIYQRINVARLVQEISKDRAVLVVEHDLAILDMLTDVIHIAYGEPAGFGVITLPKSVRVGINQYLKGYLPEENIEVHPPREDAQFQSMVSFNSFSKQYG---DGFSLKATGGSLREGEVLGIVGPNGIGKSTFVKVLAGEIKPDEGDPGIEV-------------KISYKPQYIKATPVSVQDFLR---------GITKRFGTSYYEVEIANPLQLERIYESLLT-----------ELSGGELQRVAIAACLSQEADLYILDEPSAHLDVEQRSMVTKVINRFAEQKTAMVVDHDIYMIDMSQRLLVFE-GKPSVYGEAHGPFSMESGMNRFLEN............ 549
66 -27.800[A] KOG0063 RNAse L inhibitor, ABC superfamily  ali follow..  18  70...................................................................................................................................................................................................................................................................................................................................................IQIINLPKDLAKDGANGFKLHRLPIPRPGQVLGLVGTNGIGKSTALKILAGKLKPNLGRFNTPPDWEEILTSELQSYFIRVVEENL---------KTAIKPQHVDYIKEVVRGNLGKMLEKLDERGLMEEICADM--ELNQVLEREARQVSGGELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAAQVIRSLLRDSYVIVVEHDLSVLDYSDFVCCLY-GKPGAYGVVTLPFSVREGINVF............... 312
67 -25.900[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  15  7...................................................................................................................................................................................................................................................................................................................................................IVNTDFSLAYG---SRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIANGQLDGFPDK---------------TLRTCFVEHKL---------------QGEEGDLDLVSFIALDEELQSTSREEIAAALESV----EERRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLE-HTDITSLIVSHDSGFLDTCTDIIHYENKKLAYKGNLAAFVEQKPEAKSYYTLTDSNAQM..... 228
68 -24.700[R] COG3845 ABC-type uncharacterized transport systems, ATPase components  ali follow..  21  6...................................................................................................................................................................................................................................................................................................................................................IELIGINKSFGA----RANRDINLEIARGTIHGIVGENGAGKSTLMSILYGFYQADSGEIRVGGKPASKTPNDAIALGIGMVHQHFMLVDNSVLENIILGAESDALLKSSIAKARSELERLEREY------------GLEVDPDAIIEELPVGLQQRVEILKALYRGAEILILDEPTGVLTPAEADHLFRILKQLKQGKTVVLITHKLREIMATDNVSVMRQGTMVATRETSKT......................... 228
69 -24.500[J] KOG0066 eIF2-interacting protein ABC50 (ABC superfamily)  ali follow..  21  674...................................................................................................................................................................................................................................................................................................................................................LGVHNVTFAFPS--QKPLFIKVDFGIDLTSRVAIVGPNGVGKSTFLKLLLGELEPQEGEQRKNH-----------RLHVGRFDQHSG-------------------EHLTAEESAAEYLQRLFNLPKARKALGSF--GLVSHAHTIKMKLSGGQKARVALAELCLSAPDVLILDEPTNNLDIESIDALAEAINEY--EGGVIIVSHDERLIREGCTLYVIEDQTINEVGEFDDYRKEVLDSLGEVVNNPSVVANAAVLQ 901
70 -23.700[G] COG1129 ABC-type sugar transport system, ATPase component  ali follow..  13  163.............................................................................................................................................................................................................................................................................................IIFISHHLDEIFEICDRITVLRDGELIGSCLTSEVDNDRLVERIEASFPPKPQIDPSAAKVIEVEELQLKKGGPVSRFSLRKGEILGFAGLVGSGRTETVLAMLGAHSASRRKIKLDGVDTRSGPDDALMRGIGLLPESGLITSFSILQNISLNNYRKYRKAH---------LDLKKELEHTTKAMAQVQVKAQGP-YARVDTLSGGNQQKIVIARWLNHDMRVLIFDEPTRGIDVGAKAEIYSLMREFARGHSIIMISSELPEVIGSDRVCVFRSGGIVATVEGEDI......................... 454
71 -23.400[P] COG1122 ABC-type cobalt transport system, ATPase component  ali follow..  19  1............................................................................................................................................................................................................................................................................................................................................MRGVWRLIELRVDKYTYPN--GRVGLSDFYATFEGCD--FIIGPTGSGKSTVLKMVNGLIPNFEGKVRVFGEKPN-------PRIAFFVKQNP-ITSTQVIDELVFPLIQQG----FGWGEAKREAEEVCEELGIGGLLERKT-----------YELSTGELQLVQIAAALASKARILVFDEPFANLSRKNVLKVIKIL----RDYPHLVSEHRLEFSSFEKTINLGLECEDFEIPEVEPGEAVYDGLIELREGEL.......... 234
72 -23.400[R] KOG0927 Predicted transporter (ABC superfamily)  ali follow..  18  386...................................................................................................................................................................................................................................................................................................................................................IMVQNVNFRYNDE-TPWIYKNLEFGIDLDTRLALVGPNGAGKSTLLKLLYGDLVPTSGMIRKNS-----------HLRIARYHQHLH---------------ELLDLDASPLEYMMRAFPDVKEKEEMRKIIGRY--GLTGRQQVCPIRLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHLDMETIDALADAINDF--DGGMVLVSHDFRLINQAEEIWVCEKETVTKKGGILDYKDHLKNKITSENEKKAKAGK..... 611
73 -23.200[R] COG0488 ATPase components of ABC transporters with duplicated ATPase domains  ali follow..  17  7...................................................................................................................................................................................................................................................................................................................................................YTMHRVGKVVPP--KRHILKDISLSFFPGAKIGVLGLNGAGKSTLLRIMAGVDKEFEGEARP-QPGIK----------IGYLPQEPKL-QQTVREAVEEAVSEVKNALTRLDEVYALYADPDADFDKLAAEQANLEAIIQAHWDAKIEHLSGGERRRVALCRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDY--EGTVVAITHRYFLDNVAGWILELDRGEGIPEGNYSSWLEQKEKRLEQEQATENARQK..... 268
74 -20.500[GM] COG1134 ABC-type polysaccharide/polyol phosphate transport system, ATPase component  ali follow..  19  308....................................................................................................................................................................................................................................................................................................................................................................ALKNVSFDIKEGEVVGIIGHNGAGKSTLCKLLTKILTPDEGELELSG-------------ETTSLLSYGTGFNAQLKDNVYLNGM-------IPKERVAQEYPNIVAFSELEKHMDKPVKSY-----------SSGMKSRLGFSIAATLQPDIFIIDEALSTGDVAFQQKASEKIQEMMEAKAVIIVSHSMKFVESCTRAIWLEKGQVRFDGDPEEAVKL...................... 503
75 -20.200[R] COG3044 Predicted ATPase of the ABC class  ali follow..  11  173.................................................................................................................................................................................................................................................................................................................MRAQLDDLGLVAFIANGSVLPRLAGNCDLPMKEAVPFKSLEVTLSTPNQ----GELVGMGIPQGITLIVGGGFHGKSTLLTALERVYNHIPG----DGRERMVTDVKAMKIRA--------------------------------------EEGRCVHNLNLSNYINHLPMGKDT-TDFSTQDASGSTSQSAWLQESIEAGVTTLLIDEDTSATNFMIRDERMQALVSKGEGISTLVVMGGSGDYLDADTVIQMHDYQPVDVTEKAREVIAQ..................... 419

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 8 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53.