current user: public

If you have questions about the server, please let us know.

Query: gi|12044865|ref|NP_072675.1|(removed signalp:1-25) ABC transporter, ATP-binding/permease protein (MG_015) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560
# Score Template Links and tools%idFirst NPILLAQGLGFIFPITSSNGRAVDSIYSLIYPTNLNVFIRLTIVSVTVFVAYALIFVFNVAQNYVGIKLYQQTCATLRWKAYLKMQSMSTSFFDTQNNGDLMSRLTNDMYNIDNLFTQAGGQAIQSLFNILTTSVLIFLLSPVIALISLSILATLITFSFAFLKKSKTSYSQVQNNLGDMSGYIEEVLTNHKVVHVLKLQEIMIKDFDQYNKSMIKPTVRGNTYSIFLFSWFGFISNITYLVSISIATAFSVNSIPSFGISVINYSFMLSYIASLRQITLALDQIFTLWNLVQLGVVSAERVFKVLDLNVEKDTATIDKLPDIKGNIRFENVAFGYNKDKPTLTGINFSVKHGDVVAIVGPTGAGKSTIINLLMKFYKPFEGKIYMDNFEISDVTKKAWREKISIVLQDSFLFSGTIKENIRLGRQDATDDEIIAACKTANAHDFIMRLPKGYDTYISNKADYLSVGERQLLTIARAVIRNAPVLLLDEATSSVDVHSEKLIQESIGRLMKNKTSFIISHRLSIIRDATLIMVINDGKVLEMGNHDQLMKQNGFYARLKQSSVRLast
1 -124.000[V] COG1132 ABC-type multidrug transport system, ATPase and permease components  ali follow..  29  28..IVAAIALILNAASDTFMLSLLKPLLDDGFGNS--NSSILKWMPLAVIGLMVVRGVTGFVSSYCISWVSGKVVMHIRRRLFSHMMGMPVSFFDQQSTGTLLSRITYDSEQVAASSSSALVTVVREGASIIGLFIMMFYYSWQLSLILIVIAPIVSISIRLVSKRFRNISKNMQNTMGEVTTSAEQMLKGHKEVLIFGGQKVETERFDAVSNRMRQQGMKLVSASSISDPIIQLIASFALALVLYAASFPSVMETLTAG-------TITVVFSAMIALMRPLKSLTNVNTQFQRGMAACQTLFSILDMEQEKDE-GKLEVERAKGDIEFRHVTFYYPKDTPALNDINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYRLGALRNQVALVSQNVHLFNDTVANNIAYARNEQSRAEIEEAARMAYAMDFINKMEHGLDTVIGENGIMLSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEKADEIVVIEDGRIVERGVHAELLVQQGVYAQLNRMQFG 581
2 -114.000[U] KOG0058 Peptide exporter, ABC superfamily  ali follow..  27  189..VAASFFLIVAALGETFLPYYTGRAIDGIVI--QKSMDQFSTAVVIVCLLAIGSSFAAGIRGGIFTLIFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNINVFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQNALARASNTAEETISAMKTVRSFANEEEEAEVYLRKLQQVYKLNRKEAAAYMYYVWGSGLTLLVVQVSILYYGGHLVISGQMTSG-------NLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFIDRQPTMVHDGSLAPDHLEGRVDFENVTFTYRPHTQVLQNVSFSLSPGKVTALVGPSGSGKSSCVNILENFYPLEGGRVLLDGKPISAYDHKYLHRVISLVSQEPVLFARSITDNISYGLPTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVLILDEATSALDAESEYLIQQAIHGNLQKHTVLIIAHRLSTVEHAHLIVVLDKGRVVQQGTHQQLLAQGGLYAKLVQRQML 743
3 -113.000[V] COG2274 ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain  ali follow..  22  162..VAGFFLTIIGLVIPVFSQIFVDDILV------QGRMLWLHPLLLAMAIAAILQGSLTLLRLRYLRRLKIRLAVGMSSRFLWHILRLPVSFYAQRFAGEISNRT-TLNDQVADVLAGQLATTIIDTLMVLFYALVMVQYDWVLTLMVVSFAAVNVLTLQWISRQRIDANQRLIQEYGKAAGISIATLQSIETLKASGLESDFFSRWSGYYTKALNSQQELGITNQTFSVLPTLLSALSAMLLLIVGGFRVMDGHLSIG-------MLIAFQGLMSGFQQPVNNLVNFGTTLQELEGNLIRLDDVLDNPVGTSSSSLQALPKLQGYVELKNITFGYSREAPLIENFNLSIKPGQRVALVGGSGSGKSTIAKLVSGLYQPWTGEIYFDSQPREEISLQLLTNSVAMVEQEILLFGGTVRDNLTLWDTTVPDKNLMRACQDAAIADVIFSMSGGYDAELIEGAANLSGGQRQRLEIARALVNNPSILVMDEATSALDAETEKIIDQNLRRR--GCTCIIVAHRLSTIRDCDQIIVLERGKVVQQGTHQELWQVEGAYSRLIRTE.. 711
4 -112.000[O] COG5265 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components  ali follow..  24  38..VWATFYLVLSKIVLILVPYFFKWVTNALNGQLHAPLVGAVMLVLAYNAAKIVQAGLNQLRDALFASVGQYAVRQLAYKTFVHMHELSLRFHLERRTGGLSRVIERGTKGIETIVRFTILNTLPTILEFALTAVIFAFYGLSYLVVVAATVWLYTWFTIRASDWRINIRREMNDSDTDANTKAIDSLLNFETVKYFGNEAMEAKRFDGAMARYEKAATQTWTSLGWLNFGQAVIFGAGMAIVMVMSAMEVQKGTQSLG-------DFVFINALLMQLSIPLNFIGFIYREIRQGLTDIEQMFDLLDVKQEVDKPGAPALKVDSGAISFKDVHFAYDPQRPILRGISFDVPAGKTVAIVGPSGAGKSTISRLLFRFYDIQSGSITIDGQDVRDVTQESLRKFIGMVPQDTVLFNDTIAYNIRYGRTDASEEDVEKAAELAQIAGFIKHLPDGYKSMVGERGLKLSGGEKQRVAIARTILKAPPILILDEATSALDTATEQEIQSALDIVSRGRTTLVIAHRLSTVIGADEIIVLKDGLIAERGTHRHLLDQKGLYASMWDRQRE 600
5 -109.000[CO] COG4988 ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components  ali follow..  18  25..AIAVGLGVLSSLFLVAQAALLASILHQLIIEQ-VDKHLLIPHFFGLAALIAVRALCSWGREIAGFRCGEEIRRYIRQLILDKLRDLGPAYIKGKPAGSWAALMLEQVENMHDFFARYLPQMSLSVLVPFVILAVVFPVNWAAGLIFLLTAPLVPLFMALVGIKAADASRKNFKALQRLSGHFYDRLQALTTIRLFDRTTAETEHMRGASEVFRHRTMDVLRIAFLSSAVLEFFTSISIALTAVYFGFSYIGENFGYYGASVTLFAGLFVLILAPEFYQPLRDLGTYYHAKQLAVGAAESIVDFLQTEVDTHSGERHLSDNDDIEIIANDLVVLSPQGKRLAGPLSFTLQSGKTTALVGPSGAGKTSLINTILGFMP-YQGSLTINGIELRELDHAQWRQTISWVGQNPLLLYGTIRDNVTLGKHNIADEQVTQTLQAAYAQEFV--EQQGLDYPISDRSAGLSVGQAQRLALARAILQNGRFWLLDEPTASLDARSEQYVMRGLTESIQQRTALFVTHQLQPLQSVEQILVMENGLLVQAGHFEDLSQQSGLFATMLAANQA 584
6 -108.000[CO] COG4987 ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components  ali follow..  19  19..SLGIVLAIVTLLASIGLLTLSGWFLSASAVAGGLYSFNYMLPAAGVRGAAITRTAGRYFERLVSHDATFRVLQHLRIYTFSKLLPLSPAGLARYRQGELLNRVVADVDTLDHLYLRVISPLVGAFVVIMVVTIGLSFLDFTLAFTLGGIMLLTLFLMPLFYRAGKSTGQNLTHLRGQYRQQLTAWLQGQAELTIFGASDRYRTQLENTEIQWLEAQRRQSELTALSQAIMLLIGALAVILMLWMASGGVGGNAQPGAL-------IALFVFCALAAFEALAPVTGAFQHLGQVIASAVRISDLTDQKPEVTFPDTQTRVADRVSLTLRDVQFTYEQSQQALKGISLQVNAGEHIAILGRTGCGKSTLLQQLTRAWDPQQGEILLNDSPIASLNEAALRQTISVVPQRVHLFSATLRDNLLLASPGSSDEALSEILRRVGLEKLL--EDAGLNSWLGEGGRQLSGGELRRLAIARALLHDAPLVLLDEPTEGLDATTESQILELLAEMMREKTVLMVTHRLRGLSRFQQIIVMDNGQIIEQGTHAELLARQGRYYQFKQ.... 571
7 -107.000[U] KOG0057 Mitochondrial Fe/S cluster exporter, ABC superfamily  ali follow..  25  109..ISAFACLVGAKFLNVQVPFLFKVAIDWLSSSSFVDFATPSSVLIGYGIARSGSSAFNELRTSVFSKVALRTIRTISRKVLSRLHDLDLRYHLNRDTGALNRIIDRGSRAINTILSAMVFNIMPTILEISMVSCILAYFGAVYALITCLSVGSYIAFTLAMTQWRIKIRKAMNEAENDASTRAIDSLINYETVKYFNNEDYEARKYDQLHENYEDAALQSRKSFALLNFGQSFIFSTALSTAMVLCSQGIMNGQMTVG-------DLVMVNGLLFQLSLPLYFLGVVYSDTVQGLVDMKSMFKFLEERSDIDKDIDRKLPPLGGSISFENVHFSYLPERKILDGISFEVPAGKSVAIVGSSGSGKSTILRMIFRFFDVDSGNVKIDGQDIKEVRLESLRSSIGVVPQDTVLFNDTIFHNIHYGNLSATEEEVYNAARRAAIHDTIMKFPDKYSTAVGERGLMLSGGEKQRVALARAFLKSPAILLCDEATSALDSKTEAEIMKTLRSLASNRTCIFIAHRLTTAMQCDEILVMEKGKVVEKGTHEVLLGKSGRYAKLWTQQNS 676
8 -103.000[P] KOG0056 Heavy metal exporter HMT1, ABC superfamily  ali follow..  24  256..ILLLAGRVIKLFLPIYRKKLVDSLTIAPIVFRWDFVLIYVALSFLQGGGTGSMGLFNNLRTFLWIRVQQYTTREIEIELFRHLHQLSLRWHLQRKTGEVLRVMDRGTDSINNLLNYIVFSIAPTILDLLVAVAYFVYFNWWFGLIVFLTMFLYIASTIAITEWRTKYQRRMNLADNEQRARSVDSLLNFETVKYYGAEHYEVDCYREAILKYQKEEFLSMLTLNMLNTAQNIILCLGLLAGSLLCVYLVVHH------QTLTVGDFVLFSTYLMELYMPLNWFGTYYRAIQKNFVDMENMFDLLKEEEEIDAPGCSPLLTAGGGIEFSNVTFGYSPEKIVLRNVSFTVPAGKTVAIVGPSGAGKSTIMRLLFRFYDVQTGAILIDGQNIKLVQQQSLRKAIGVVPQDTVLFNNTIFYNIEYAKLGASDEAVYEAARAADIHERILGFPEKYETKVGERGLRLSGGEKQRVAIARTLLKAPIIVLLDEATSALDTHTERNIQAALARVCANRTTIIVAHRLSTIIHADEILVLQQGSIAERGRHEELVLRDGIYADMWQQQLK 814
9 -101.000[R] COG4618 ABC-type protease/lipase transport system, ATPase and permease components  ali follow..  19  31..LVSGVVNILALTSPLFMLQVYDRVLA------SGSLPTLVGLALLALGLYGFQCLLDIIRARVLIRIGEDFDMRYSGRVHDAVVRLPLVN----RMPGDGLQPLRDLDNVRGFLSGTGPTAFFDLPWMPLYLGLCFLFHVWIGVTALAGAVLLVSLTILTNIFSQKPIRDTMVENMARNRQLEASRRNAEVVQAMGLGRRLGKRWQSSNEAYLAANRKAGDVAGGLGNLAKSLRVVLQSAILAVGAWLVIRQEASGGV-------MIASSIMMGRALAPVDLAISNWKSFVAARQSWARLRELFAQMPA--NAAAMALPKPEKELRVENVTIVPPGRKPTVTGLGFVVTAGNALGIIGPSGSGKSTLARILTGAWMPAAGKVRLDGASFDQWDRETLGRHIGYLPQGVELFDGTIGENISRFDDNPDPEAIIAAARAAGAHELILRFEKGYDSDIGEAGSTLSAGQRQRIGLARALYGDPFIVVLDEPNANLDAEGEAAVVKAITSVKRGGIAVVVAHRPSAIGAVDYILMMEDGRMKAFGPRDEVLSKVLRVPQAQAAKGF 575
10 -95.500[QP] COG4615 ABC-type siderophore export system, fused ATPase and permease components  ali follow..  16  16..ISVMALSLASAALGIGLIAFINQRLI-------ETADTSLLVLPEFLGLLLLLMAVTLGSQLALTTLGHHFVYRLRSEFIKRILDTHVERIEQLGSASLLAGLTSDVRNITIAFV-RLPELVQGIILTIGSAAYLWMLSGKMLLVTAIWMAITIWGGFVLVARVYKHMATLRETEDKLYTDFQTVLEGRKELTLNRAEYVFNNLYIPDAQEYRHHIIRADTFHLSAVNWSNIMMLGAIGLVFWMANSL----------GWADTNVAATYSLTLLFLRTPLLSAVGALPTLLTAQVAFNKLNKFALAPFKAEFPRPQAFPN-WQTLELRNVTFAYQDNAFSVGPINLTIKRGELLFLIGGNGSGKSTLAMLLTGLYQPQSGEILLDGKPVSGEQPEDYRKLFSAVFTDVWLFDQLLGPEGKPANPQLVEKWLAQLK-----MAHKLELSNGRIV-----NLKLSKGQKKRVALLLALAEERDIILLDEWAADQDPHFRREFYQVLLPLMQGKTIFAISHDDHYFIHADRLLEMRNGQLSELTGEERDAASRDAVART...... 546
11 -81.000[I] KOG0064 Peroxisomal long-chain acyl-CoA transporter, ABC superfamily  ali follow..  14  133..SVHTFCLISRTFLSIYVAALEGALVKFIV---RKDIKQFALVLLKWFGIAIPATFVNSMIRFLESKLSLAFRTRLVRHSYRLYFKNQNYYRVSNLDGRIENRLTEDISVFANSVAHLYSSLTKPCFDLMLIGLALMRSSKKMKALSIGVIALTAHILRIVSPKFGQLVSEEANRYGYLRHIHSRIITNAEEIAFYGGHKVEMQQLRQAYNRLVNQMTTIFNQKLWFIMLEQFFMKYVWSGTIMVSLPILTGSDVGLGTVPNRTQYLTTARNLLISAADAIERLMSSYKEIVSLAGYTFRVAGMMDVFEETALRIIYSDDPKNMSISLRAVPVVTPNCDIVVPKLTLCIEPGVHLLITGPNGCGKSSLFRILSGLWPIYAGELHIPRPV-------KDVPCMFYIPQRPYMSIGSLCDQIIYPDTREDMKRKHITENELRSILKMVSLEHDSFDVVRDWKDILSGGEKQRMAIARLFYHRPRYALLDECTSAVSIDVESSIYEIAKGM--GITLLTITHRPTLWKYHTHILEFDNWQFRKMNSDEEQKGQFL........... 729
12 -71.600[R] COG4178 ABC-type uncharacterized transport system, permease and ATPase components  ali follow..  12  71..AVLLFSVVISVRLNVLFSYQSKDLYNALQAAFEGAGAQNDLVKWMSLGIFSILAVIFIARVMADIYLTQRFIIAWRMWLTNHLTTDWLDYYREQFIDNTIQRIQQDIDIFTAGAGGTLFGAVESVISVISFTAILFEIPRAMFWIVIVYVLLATIITFWIGRPLIGLNFANEKLNAAFRYALVRLRDAAEAVAFYRGEEAERKQLEQRFTPIIDNYRRYVSRTIRFLGWNASVSQTIVPLPWILQAPRLFAGKINLG-------DVGQTATAFGNIHDSLSFFRNNYAAFAAFRAAIIRLHGLVVANARSELPHVTAKSTNDGTVHVVAVEVRTSAGEQLIDPLDLQLNCGSSLVITGRSGVGKTTMLRSLAELWPYASGTLSRP----------DGKNETMFLSQLPYVPLGNLRGVVCYPNAPAPEDTVRDTLTKVALNPLCDRLDE-----ERDWAKILSPGEQQRIAFARILLTKPKAIFLDESTSALDEGLEFALYQMLRSELPDCIIVSVSHRRAVELLHAQQLELLGGGQWRLGPVEKEPLH............. 637
13 -64.100[IR] KOG0060 Long-chain acyl-CoA transporter, ABC superfamily (involved in peroxisome organization and biogenesis)  ali follow..  14  90..ILIAVSLLCRTYADVYMIITSTKIEASIIDRNPLLFLEAFKYVLNLPAISVTNAILKFGIAELKLRFRERLSTHLYSQYLKGFTFYKMSNLDTR-IQNADQLLTQDVDRFCDGIVELYSNLSKPILDVFLYLFRLGTSGFSSPSILFSYLLFTGVGLTYLRRPIGRLTVEEQALEGEYRYVNSRLIMNSEEIAFYQGNQSEKETIMSTFASLVQHLRKIILVAKYLATVVGWYAVGSSFFDKQHKPFIGMSRNQLMQ-------EYYNSGRMMYKMAEALGRLALAGRDMTRLSGFTSRVDTLLNVLDDVNSAGSGNLRVQDNVIRFDNVPLVTPNGDVLIERLNFEVPSGTNVLVCGPNGCGKSSLFRVLGELWPLFGGTLTKPA-----------KGKLFYVPQRPYMTLGTLRDQIIYPRKGVSDSDLEQMLENVQLTHILE--REGGWSAVQDWMDVLSGGEKQRIAMARLFYHKPQFAILDECTSAVSVDVEGAMYRLCREK--NITLFTVSHRKSLWKYHEYSLYMDGRRFEQIDDQSDQFGS............. 661
14 -49.800[R] COG4619 ABC-type uncharacterized transport system, ATPase component  ali follow..  22  1...............................................................................................................................................................................................................................................................................................................................MQENSPLLQLQNVGYLA-GDAKILNNINFSLRAGEFKLITGPSGCGKSTLLKIVASLISPTSGTLLFEGEDVSTLKPEIYRQQVSYCAQTPTLFGDTVYDNLIFPNRQPDPAIFLDFLERFALP----------DSILTKNIAELSGGEKQRISLIRNLQFMPKVLLLDEITSALDESNKHNVNEMIHRYVRNIAVLWVTHDKDEINHADKVITLQPHAGEMQEARYEL................ 224
15 -46.300[P] COG1117 ABC-type phosphate transport system, ATPase component  ali follow..  26  25......................................................................................................................................................................................................................................................................................................................................MATEDLHVYY-GDNHAIKGVDLTFPENKVTALIGPSGCGKSTYLRALNRMNDEIEGQILYDGINIKEVDLYNVRKEIGMVFQKPNPFTKSIYENVAFGLKRHGMKNKKEIMERVEKSLRRAALWDEVKDDLGKSALSLSGGQQQRLCIARAVAMQPKVLLLDEPASALDPISTSKIEDLINELKNKYTIIIVTHNMQQAARSDYTSFFYLGEVVEFSGTSELFTN............. 256
16 -43.900[R] COG1101 ABC-type uncharacterized transport system, ATPase component  ali follow..  20  2......................................................................................................................................................................................................................................................................................................................................IRLQDIQVTFNPENRALRGVSLEVPEHQFLTVIGSNGAGKSTLLGAVTGETPIVGGQVLIDEIDVTKQSVDQRANLCARVFQDPLTCGATIEENMALAYMRGKKRGWSLALSRKLFQERISILGLGLEDRLGDNIGLLSGGQRQAVSLVMATLSESKLLLLDEHTAALDPRMAAFIIDLTKKIVKNLTVMMVTHSMKALACGDRTVMLHQGQIVLDVTGEQRANM............. 239
17 -43.300[E] COG1126 ABC-type polar amino acid transport system, ATPase component  ali follow..  25  2......................................................................................................................................................................................................................................................................................................................................INFKNVSKHF-GKIQVLHDINLNITQGEVVVIIGPSGSGKSTLLRCINKLEVITRGQLIVDGLDVNSPDERQIRLEAGMVFQQFYLFPHTALENVAFGSKEEAKKQALALLSKVGLEDRAHHYPA-----------ELSGGQQQRVAIARALAVKPKLMLFDEPTSALDPELRHEVLTVMKDLAEGMTMVIVTHEVGFAQKASRLIFIDKGRIAEDGDPDSLISN............. 226
18 -42.500[P] COG3638 ABC-type phosphate/phosphonate transport system, ATPase component  ali follow..  24  25......................................................................................................................................................................................................................................................................................................................................LAVKGLVKAYKSQHRVLDNINFELHAGEFVAIIGRSGAGKSTLLHILNGTIPTSAGEIINYHENLTTKQMRKWRAKCGMIFQDFCLVPRDVITNVLLGRLSYTSTKLFSEQDQARAIELLQWL--NMLPHALQRAENLSGGQMQRVAICRAMMQNPKILLADEPVASLDPKNTTRIMNTLQKISEDIAVIVNLHSVDLVKDCTRVIGIAHGRIIFDGPPSMLNDS............. 263
19 -42.500[E] COG4598 ABC-type histidine transport system, ATPase component  ali follow..  25  6......................................................................................................................................................................................................................................................................................................................................LNVIDLHKRY-GEHEVLKGVSLQANAGDVISIIGSSGSGKSTFLRCINFLEKPSEGSIVVNGQTINLVQLRLLRTRLTMVFQHFNLWSHTVLENVMEAPIQVLGLSKQEARERAVKYLAKVGIDERAQGKYPVH---LSGGQQQRVSIARALAMEPEVLLFDEPTSALDPELVGEVLRIMQQLAEGKTMVVVTHEMGFARHSTHVIFLHQGKIEEEGAPEQLFGN............. 242
20 -41.200[H] COG3840 ABC-type thiamine transport system, ATPase component  ali follow..  27  2......................................................................................................................................................................................................................................................................................................................................LKLTDITWLYHH---LPMRFSLTVERGEQVAILGPSGAGKSTLLNLIAGFLTPASGALTIDGVDHTTTPPS--RRPVSMLFQENNLFS-TVAQNIGLGLNAVQQEKMHAIARQMGIDNLMARLPG-----------ELSGGQRQRVALARCLVREQPILLLDEPFSALDPALRQEMLTLVSTSCQKMTLLMVSHVEDAARIATRSVVVADGRIAWQGMTNELLSGKASASAL...... 227
21 -41.000[D] COG2884 Predicted ATPase involved in cell division  ali follow..  24  2......................................................................................................................................................................................................................................................................................................................................ITLDHVSKKYKSLAPALDNVNVKIDKGEFVFLIGPSGSGKSTFMRLLLGAETPTSGDVRVSKFHVNKLPGRHIRQVIGCVFQDFRLLQQTVYENVAFALEVIGRRSDAINQVVPDVLETV-----GLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPDTSKDIMDLLERIRTGTTVLMATHDHHIVDSRQRVVELSLGRLVRDEWCGI................. 224
22 -40.900[E] COG4161 ABC-type arginine transport system, ATPase component  ali follow..  23  2.....................................................................................................................................................................................................................................................................................................................................SIQLNGINCFY-GAHQALFDITLDCPQGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLNIAGNHFSDKAIRDLRRNVGMVFQQYNLWPHTVQQNLIEASKDQALARAEKLLERLRLKPYSDRYPL-----------HLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIRELAENITQVIVTHEVEVARKASRVVYMENGHIVEQGDAS.................. 226
23 -40.800[P] COG1135 ABC-type metal ion transport system, ATPase component  ali follow..  25  2......................................................................................................................................................................................................................................................................................................................................IEIKSVNKVFYQGDHALKDINLFIPQGTIFGVIGSSGAGKSTLIRCVNMLEKPTSGQVIVDGVDLTTLSNPQLRRNIGMIFQHFNLLSSTVFENVALPLELAGQSQQHIETKVTELLALV-----GLSEKRESYPANLSGGQKQRVAIARALASDPKVLLCDEATSALDPATTQSILELLKEINRNLTILLITHEMDVVKSCHEVAIIGGGELVEKGTVGDIFAH............. 231
24 -40.700[Q] COG1127 ABC-type transport system involved in resistance to organic solvents, ATPase component  ali follow..  18  7......................................................................................................................................................................................................................................................................................................................................IEVKGLTKSF-GSSRIWEDVTLDIPAGEVSVLLGPSGTGKSVFLKSLIGLLRPERGSILIDGTDIIECSAKELRTLFGVLFQDGALFGSNLYDNTAFPKESEIRDIVMEKLQLVGLGGDEKKFPG-----------EISGGMRKRAGLARALVLDPQIILCDEPDSGLDPVRTAYLSQLIMDINADATILIVTHNVNIARTPDNMGMLFRKHLVMFGPREVLLTSDEPVVRQF..... 241
25 -40.400[O] COG0396 ABC-type transport system involved in Fe-S cluster assembly, ATPase component  ali follow..  20  2......................................................................................................................................................................................................................................................................................................................................LEIRNLHARIDDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILAGRYEVTEGDILYNGQSILEMDPAEATSGIFLAFQYPMEIPGATMEFLKVARKARGEEPLKIPEFLKRVKEAAASLNMDMAMLKRPLNVGFSGGEKKRAEILQMKLLEPKLCVLDETDSGLDIDALKIVSDGVNALRADRAFLVITHYQRLLEHPDSVHVLYRGQVIKSGDKSLALD.............. 237
26 -39.700[E] COG1125 ABC-type proline/glycine betaine transport systems, ATPase components  ali follow..  24  2......................................................................................................................................................................................................................................................................................................................................IELDKLSKTFTQKNRAVDSVSLTVEKGEICVFLGPSGCGKTTTLKMINRIIPPTSGRVLIDGQDTADLDEVTLRRHIGYVIQQIGLFP-TIEENIMVVPRLLGWDKARCKEKARELMSMVKLEPKQYLQRYPRE---LSGGQQQRVGVIRALAADAPLLLMDEPFGAVDPINRESIQNEFFEMQRGMTVIMVSHDIDAIKLGDKVAVFKSGRLLQYDHPDTLLAH............. 231
27 -39.600[P] COG4604 ABC-type enterochelin transport system, ATPase component  ali follow..  20  2......................................................................................................................................................................................................................................................................................................................................IEINDVNKKY-QQTTVLNEINERIPSGGITSIIGPNGAGKSTLLSIMSRLLAADSGNVLFNGLDVAKTSGDKLATILSVLRQENHFSRLTVSDLVGFGRNKNDRQHIDAAMEFLNLMPLKDRY------------DELSGGQRQRAYVAMVLCQDTSYILLDEPLNNLDMKHCVAMMKQLRRAADHKTIILVIHDINASAYSDHIIAMKNGEVIYRGAPAEIMQPS-ILEEIFDIKIS 238
28 -39.400[PH] COG1120 ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components  ali follow..  21  6......................................................................................................................................................................................................................................................................................................................................ISTETLSLGY-GDAVIIDELNLTIPKGEITVFIGSNGCGKSTLLRSLARLMKPRGGSVLLEGRAIAKLPTKEVAKELAILPQGPSAEGLTVHQLVKQGRSKEDEEAVERALKATKLEDMADRA------------DSLSGGQRQRAWIAMTLAQETDIILLDEPTTYLDMTHQIEILDLLFELNEDRTIVMVLHDLNACRYAHHLVAIKDKRIYAEGRPEEVITCD-LVQNVFSMNCQ 244
29 -39.100[O] COG4133 ABC-type transport system involved in cytochrome c biogenesis, ATPase component  ali follow..  17  2......................................................................................................................................................................................................................................................................................................................................LEARELLCER-DERTLFSGLSFTLNAGEWVQITGSNGAGKTTLLRLLTGLSRPDAGEVLWQGQPLHQVR-DSYHQNLLWIGHQPGIKTRTALENLHFYHRDGDTAQCLEALAQAGLAGFEDIPVN-----------QLSAGQQRRVALARLWLTRATLWILDEPFTAIDVNGVDRLTQRMAQHTQGGIVILTTHQPLNVAEKIRRISLTQTRAA........................ 205
30 -38.600[Q] COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component  ali follow..  21  7......................................................................................................................................................................................................................................................................................................................................VEVHRLRKSVGQGESILTGVELVVKRGETIALIGESGSGKSTLLAILAGLDDGSSGEVSLVGKPLHQMDEEARAQHVGFVFQSFMLIPTNALENVEL---PALLRGENSGQSKAGAKALLEQL--GLGKRLDHLPAQLSGGEQQRVALARAFNGRPDVLFADEPTGNLDRQTGDKIADLLFSLNRGTTLILVTHDPALAARCDRRLRLVNGQLQEE...................... 227
31 -38.300[V] COG1136 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  24  1..................................................................................................................................................................................................................................................................................................................................MANMLEVKHINKTYKGQVSYLKQISFSIEEGEFTAVMGPSGSGKTTLLNIISTIDRPDSGDILINGENPHRLKRTKLRKQLGFVFQDFNLLDTTIGENIML---PLTLEKEAPSVMEEKLHGIAAKL--GIENLLNKRTFEVSGGQRQRAAIARAVIHKPSLILADEPTGNLDSKATKDVMETLQSLNRHVTALMVTHDPVSASYCRRVIFIKDVVLFNE...................... 224
32 -38.300[E] COG4175 ABC-type proline/glycine betaine transport system, ATPase component  ali follow..  22  1....................................................................................................................................................................................................................................................................................................MAIKLEVKNLYKIFGEHPQ------RAFKYIEKGLSKEQILEKT-GLSLGVKDASLAIEEGEIFVIMGLSGSGKSTMVRLLNRLIEPTRGQVLIDGVDIAKISDAELRKKIAMVFQSFALMP-TVLDNTAFGAAQERREKALDALRQVGLENYAHAYPD-----------ELSGGMRQRVGLARALAINPDILLMDEAFSALDPLIRTEMQDELVKLQAQRTIVFISHDLDAMRIGDRIAIMQNGEVVQVGTPDEILNN............. 255
33 -37.600[R] COG1137 ABC-type (unclassified) transport system, ATPase component  ali follow..  24  4......................................................................................................................................................................................................................................................................................................................................LTAENLAKSY-KSRKVVSDVSLTVNSNEIVGLLGPNGAGKTTTFYMVVGLVRQDQGKIVIDGEDISLLPMHNRQRGIGYLPQEASIFRRTVYENLMAVLE--IRKDLTPQQRREKADELIEEF--NISHIRDNLGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVSDIKKIITDLRRGLGVLITDHNVRETLDCERAYIVGAGKIIATGTPEQVMNDEQVKRVYLGEQFK 240
34 -37.500[RK] KOG2355 Predicted ABC-type transport, ATPase component/CCR4 associated factor  ali follow..  18  14......................................................................................................................................................................................................................................................................................................................................IRVSGMQFAYEVEDPIFFDFNLDLPAGSRCLLVGANGSGKTTLLKILAKHMVGGKNVVQVLSRSAFHDTQLVCSGDLSYLG-------GSWSKTVGSAGEVPLQGDFSAEHMIFGVEG-REKLIDLLDINLQWRMHKVSDGQKRRVQICMGLLHPFKVLLLDEVTVDLDVVARMDLLEFFKEECDGATIVYATHIFDGLETATHLAYIQDGELNRLSKMTDIEELKT........... 241
35 -37.300[P] COG1121 ABC-type Mn/Zn transport systems, ATPase component  ali follow..  18  6......................................................................................................................................................................................................................................................................................................................................LKVENLTVYQ-GNYLAIRDVSFNLLPGTDTAIVGPNGAGKSTLVKAILDLIPRRVGQIEIFGRPITKL--GNLRHLLGYMPQNFIFFPISVEELVGLGWSREKSAAIATALKRTDTYHLRNQ-------------GTLSGGQLKRILLAYCLVIPRKILVLDEAFAGVDMQGAADFYAMLNELKQGWTVLQVSHDIDMVSRHCDRVLCLNQTVVCTGQPEIALSPQNL-LATYGPGFS 251
36 -36.900[CP] COG4555 ABC-type Na+ transport system, ATPase component  ali follow..  24  2......................................................................................................................................................................................................................................................................................................................................ITLTDCSRRFQDKKKAVRDVSLTIEKGEVVGILGENGAGKTTMLRMIASLLEPSQGVITVDGFDTVK-QPAEVKQRIGVLFGETGLYDRTAKENLQY----GRLYGLNRHEIKARIEDLSKRF--GMRDYMNRRVGGFSKGMRQKVAIARALIHDPDIILFDEPTTGLDITSSNIFREFIQQLKEQKTILFSSHIMEEVQACDSVIMIHSGEVIYRGALESLYESER........... 229
37 -36.700[V] COG4167 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  19  6......................................................................................................................................................................................................................................................................................................................................LEVRNLSKTFRYRTEAVKPLSFTLREGQTLAIIGENGSGKSTLAKMLAGMIEPTSGELLIDDHPLHFGDYSFRSQRIRMIFQDPS-ISQILDFPLRLNTDLEPEQRRKQIIETMRMVGLLPDHVSYYP--------MLAPGQKQRLGLARALILRPKVIIADEALASLDMSMRSQLINLMLELQEGISYIYVTQHIGMMKHSDQVLVMHQGEVVERGSTADVLAS............. 241
38 -36.500[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  21  2......................................................................................................................................................................................................................................................................................................................................LCVKNVSLRL-PESRLLTNVNFTVDKGDIVTLMGPSGCGKSTLFSWMIGALASCTGELWLNEQRIDILPTA--QRQIGILFQDALLFD-SVGQNLLLAKGNARRNAVNDALERSGLEGAFHQDPA-----------TLSGGQRARVALLRALLAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRAIPVVQVTHLQDVPADSSVLDMAQWSENYNK...................... 215
39 -36.500[P] COG1118 ABC-type sulfate/molybdate transport systems, ATPase component  ali follow..  22  2.....................................................................................................................................................................................................................................................................................................................................SIEIANIKKSF-GRTQVLNDISLDIPSGQMVALLGPSGSGKTTLLRIIAGLEHQTSGHIRFHGTDVSRLHAR--DRKVGFVFQHYALFR-TVFDNIAFGNAAAIKAKVTKLLEMVQLAHLADRYPA-----------QLSGGQKQRVALARALAVEPQILLLDEPFGALDAQVRKELRRWLRQLHEKFTSVFVTHQEEATEVADRVVVMSQGNIEQADAPDQVWRE............. 227
40 -36.300[P] COG4559 ABC-type hemin transport system, ATPase component  ali follow..  19  1...............................................................................................................................................................................................................................................................................................................................MTASSPSIRVTDLSYSV-AGRELLSKLKFHLQSGEMLAVLGRNGAGKSTLLKHLTG--ELGKSGVELFGQPLRDIKPAEAAKRRAVLPQQTPLFAYEVLDVVLLGRTVQDRAIAAACLERVGLSGYETRD------------LTLSGGEQQRVHFARTLAQGERVLLLDEPTASLDLAHQHATLRLARELCEGVGVLAVLHDLNAAQYADRVLMLAEGHVIACDHPAVALTPE............ 234
41 -36.200[E] COG3842 ABC-type spermidine/putrescine transport systems, ATPase components  ali follow..  28  1..................................................................................................................................................................................................................................................................................................................................MQPVVHFKNVNKYY-GGLPAVDDLDLAVESGQFVTLLGPSGCGKSTTLRMLGGFEQPSSGEIYLEGKPITHLPPN--RRNVNIVFQDYALFP-NVGRNIAFGSSDAIHKRTMELLALVKLQDFADRMPD-----------QLSGGQRQRVALMRALAPDPNVLLLDEPLSALDAKLRQQMQIELKTIQRGKTFIFVTHQEEALTMSDVIVVMNKGRIEQMGGPNELYSR............. 225
42 -36.000[H] COG4138 ABC-type cobalamin transport system, ATPase component  ali follow..  22  5......................................................................................................................................................................................................................................................................................................................................MQLQDVA-----ESTRLGPLSGEVRAGEILHLVGPNGAGKSTLLARMAGM--SGKGSIQFAGQPLEAWSATKLALHRAYLSQQQTPFATPVWHYLTLHQHDKTRTELLNDVAGA-----------ALDDKLGRSTNQLSGGEWQRVRLAAVVLQAGQLLLLDEPMNSLDVAQQSALDKILSALCQGLAIVMSSHDLNTLRHAHRAWLLKGGKMLASGRREEVLTPPNL-AQAYGMNFR 235
43 -35.800[P] COG4107 ABC-type phosphonate transport system, ATPase component  ali follow..  20  6......................................................................................................................................................................................................................................................................................................................................LQVHELSKSY-GGIKACDRISFDLYPGQVLGIVGESGSGKSTLLGAIADHIAVDHGNVTYISRSGEDLEIFQLRTEWGFVQQNPR-AGANIGERLLDIGVRHYGNIRDEAAHWLREVEIDPTRIDDLPA-------QFSGGMQQRLQLARVLVTRPRLILMDEPTGGLDVSVQARLLDLLRSLVRHLSVIIVTHDIGVVRLAHRLLVMQQGQVVESGLTDQVLDD............. 241
44 -35.800[V] COG1131 ABC-type multidrug transport system, ATPase component  ali follow..  23  1..................................................................................................................................................................................................................................................................................................................................MPSILSISGVSKTYATGFTALKEVNLDIQRGEIFALLGPNGAGKTTLISIVCGIVNRSTGTVTVDGHDIGK-DYRAARSLIGLVPQELTIDAFSVWATVNY------------PPNHGFVEKVLRDL--SLWDKKDAKAITLSGGMKRRLMIAKALSHEPRILFLDEPTAGVDVELRQDMWEMVRRLRDGVTIILTTHYIEEAEAADRVGVINRGEIILVENKAELMHKLG........... 226
45 -35.600[P] COG4148 ABC-type molybdate transport system, ATPase component  ali follow..  26  16........................................................................................................................................................................................................................................................................................................................................................TINETLPANGITAIFGVSGAGKTSLINAISGLTRPQKGRIVLNGRVLNDICLTPEKRRVGYVFQDARLFP-KVRGNLRYGMAKSMVDQFDKLVALLGIEPLLDRLPG-----------SLSGGEKQRVAIGRALLTAPELLLLDEPLASLDIPRKRELLPYLQRLTRNIPMLYVSHSLDEILHADRVMVLENGQVKAFGALEEVWGS............. 219
46 -35.500[P] COG4525 ABC-type taurine transport system, ATPase component  ali follow..  25  2......................................................................................................................................................................................................................................................................................................................................LNVSGLWAEY-QGKPALQDVSLQIASGQLVVVLGPSGCGKTTLLNLIAGFMTPSAGVITLDNIPVSG------SAERGVVFQNEGLLP-DVVSNVEFG---LQLAGMSKEQRRVTALKMLNRV--GLAGFEHHFIWQLSGGMRQRVGIARALAVDPRLLLLDEPFGALDAFTREQMQELLLTIWRGKQILLITHDIEAVFLASELLLLSPGQVVER...................... 212
47 -35.400[P] COG1116 ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component  ali follow..  22  18......................................................................................................................................................................................................................................................................................................................................IELKDVQISFRLADDAVAESNLAVAENEFVAIVGPTGCGKSTLLNAVAGLLTPASGTVEISGQRLQG------NRKAGYLFQQDALMP-TVLENVAIG---LEIAGTPKAKAREQAREWLNKV--GLGTFGDRYPHMLSGGQRKRVGLAQVLIRNPKYLLMDEPFGPLDAQTRVIMGDLLLDLWSKKAVMFVTHDLEAIALADRVVIMSRARIMA....................... 233
48 -35.400[E] COG0410 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  23  2......................................................................................................................................................................................................................................................................................................................................LSFDKVSTYY-GKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTIRKSIAVVPEGRRVFSRTVEENLAMGGFFTDKDDYQVQMDK------VLELFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRREGVTVFLVEQ-QALKLADRAYVLENGRIVMHDTGAALLTNPKV.......... 226
49 -35.000[G] COG3839 ABC-type sugar transport systems, ATPase components  ali follow..  24  4....................................................................................................................................................................................................................................................................................................................................SFLKITDLYKSY-GSVSVLKDINIEIDEGGFLVLVGPSGCGKSTLLNTIAGLEPITSGDIAINGKSVSNLHPSQ--RDIAMVFQSYALYP-TVAGNIAFGPKPERDKAIQQVADMLQIGHLLDRKPS-----------QLSGGQRRRVAMGRALVRNPQVFLFDEPLSNLDAKLRVDMRTEIKRLHSKTTIVYVTHQIEAMTLATKIAVLKDGVLQQFGTPAEIYNN............. 226
50 -34.900[R] COG4152 ABC-type uncharacterized transport system, ATPase component  ali follow..  18  2......................................................................................................................................................................................................................................................................................................................................LTIDHVTKTF-GDYKAVDGLDLDIPEQQMFGLLGANGAGKTTTFRMILGLLSITEGSISWKGRPVN----YHISNKIGYLPEERGLYPKKVRDQLVY----ARLKGMEKREAVKELGTWLERF--NITDYENKKVEELAKGNQQKIQFISAVLHKPELLILDEPFSGLDPVNVELLKEAVISLKSGVSILFSSHRMEHVEECENLCILQKGKPVVQGKLKEIKRSFG........... 221
51 -34.700[EP] COG1124 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  24  2.........................................................................................................................................................................................................................................................................................................................TGPMLEIRNLSRCFPIHNALGRQTGEVRAVDDVSFYIERGAVYGLAGESGSGKSTIARLIMGLEKPSCGEIRIDGEMIAAGASRAHGKKVQMVFQNPG---SSLNPRRTVGQSVAVPLDAHGFPSLQRAKRISELLEM--ANFAERFPHELSGGQKQRVAIARALAVAPKLLVLDEPTSALDVSVQAKVIDLLVDLGRDLTYLFISHDLSLMRNASRVGILYRGKLVETGKTDEVFYR............. 242
52 -34.500[P] COG4778 ABC-type phosphonate transport system, ATPase component  ali follow..  24  2......................................................................................................................................................................................................................................................................................................................................INVQNVSKTFILHQPVLNRASLTVNAGECVVLHGHSGSGKSTLLRSLYANYLPDEGQIQIEWVDLVTAPARKVKTTVGWVSQFLRVIPRSALEVVMQ---PLLDTGVPREACAAKAARLLTRL----ERLWHLAPSTFSGGEQQRVNIARGFIVDYPILLLDEPTASLDAKNSAAVVELIREATRGAAIVGIFHDEAVRNDADRLHPMGASS.......................... 226
53 -34.300[E] COG0411 ABC-type branched-chain amino acid transport systems, ATPase component  ali follow..  21  2......................................................................................................................................................................................................................................................................................................................................LKLASISKRF-GGLSVLQDVNIEVPQGTIFGLIGPNGAGKTTVFNLITGLLEPTGGTLTFGGTSLVGKKPHQIQMGIARTFQNIRIFKETLLENVVVGMHRHLDYGAPGLLARDRALELLSWV--KLDHKAGDIADNLSYGDQRKLELARALATEPKLLLLDEPVAGMNTGEKVDLMAEIENIRRGYTIFMIEHDMRFVMGCERIAVLNFGRIIAEGPPEAIRN.............. 238
54 -34.000[E] COG4608 ABC-type oligopeptide transport system, ATPase component  ali follow..  23  6......................................................................................................................................................................................................................................................................................................................................LEVKNLTKSFDINGRAVDNLSFSVYEGEVLGIVGESGCGKSTTGKAILRLIEPSSGEVYFAGTEITALSMRKRRRDMQIIFQDPYTIEKIIREPLIVHQIGTKKEQLERVEELLETVGLSSDHATRYPH-------QFSGGQRQRIGIARALAVHPKLVICDEPVSALDVSVQSQILNLMADLKEALTYIFIAHDLSVVKHSDRVAVMYLGRMVEMATKDQLFEN............. 246
55 -32.500[R] COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain  ali follow..  17  408.................................................................................................................................................................................................................................................................................................................................EVRTVLESFGVRQRV-VERYVLRDVNLEIKPGEIVAVVGASGSGKTTFLRLIVGEALKLDDDVYKPSSGMVEVVVDSIAAMIPSELEPQITEKSILEQIFDITGDIHLAVEVLNRAGISD------------AVLYRARFNELSTGQKERFKLAACLAKKPSLMLVDEFAAHLDEMTAVRVARKISELARKITLIAVTHRKEVINAPDRILYVGYGGVTES...................... 619
56 -31.900[R] COG4586 ABC-type uncharacterized transport system, ATPase component  ali follow..  21  31.................................................................................................................................................................................................................................................................................................................................................RQILAVQDISFTIPPGAMVGFLGANGAGKTTTLKMLTGLIKPSGGKVRVAGFDPFR-RQTAFLRRTSLVMQKQQLIWDPTLDSLRI----GAIYEIPDQVFEQRLGELSEML--DLTTELKQPVRKLSLGQRMKAELLAALLHHPTVLFLDEPTLGLDVNAQVAVRRFLQEYNRQATVLLTSHYMADITTCERVLLIHQGQLMYDGDLEALVERFSPYRQV...... 250
57 -31.600[P] COG1119 ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA  ali follow..  19  8......................................................................................................................................................................................................................................................................................................................................LQILQGTFRL-SDTKTLQLPQLTLNAGDSWAFVGSNGSGKSALARALAGELPLLKGERQSQFSHITRLSFEQLQKLVSDEWQRN--NTDMLGPGEDDTGRTTAEIIQDEVKDAPRCMQLAQQF--GITPLLDRRFKYLSTGETRKTLLCQALMSEPDLLILDEPFDGLDVASRQQLAERLASLHQGITLVLVLNRFDEIPEVQFAGVLADCTLAETGAKEELLQQ............. 229
58 -31.100[V] COG4170 ABC-type antimicrobial peptide transport system, ATPase component  ali follow..  20  4......................................................................................................................................................................................................................................................................................................................................LDIRNLTIEFMTSEKAVDRISMTLTEGEVRGLVGESGSGKSLICGVSKDNWRITADRFRFNDIDLLQLTPRQRRHNISMIFQEPESIGLQLIQAIPGWTYKGRWWQRFHWRKRRAIELLHRVGIKDHKDIMHSYPYELTEGECQKVMIAIALANQPRLLIADEPTNAMEPTTQAQIFRLLARLNQNTTILLISHDLQMMSKATRVNVLYCGQTVESAVCEDLLST............. 249
59 -30.800[EP] COG0444 ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component  ali follow..  22  5......................................................................................................................................................................................................................................................................................................................................LDVKDLRVEFSTQDTAVNDLNFSLKQGETLGIVGESGSGKSQTVFAIMGLLAKNTGSAKFEGKEILNLPERELNEQIAMIFQDPMKVSDQLMEVLMLHKGMGKAEAFEESVRMLEA----VKIPEA-RKRITMYPHEFSGGMRQRVMIAMALLCRPKLLIADEPTTALDVTVQAQIMELLNELKRNTAIIMITHDLGVVAGCDKVLVMYAGRTMEYGSVNDIFYN............. 244
60 -30.600[R] COG4674 Uncharacterized ABC-type transport system, ATPase component  ali follow..  21  6......................................................................................................................................................................................................................................................................................................................................LEIQDLTVSF-DGFRALNHLTFSMNPGELRVIIGPNGAGKTTFLDVITGKVQPTEGRVLFQGKDIRKIPEYRIRLGVGRKFQTPRVYLNTVAENLDLAVNRKKS---ATGAEQRSVGGLLETI--GLTPKAHLAAALLSHGEKQRLEIGMLVAQSPTLLLVDEPVAGLTDEETENVGDLLLALAESHSIIVIEHDMEFVRQARKVTVLHQGSVLCEGNMDQIQN.............. 234
61 -30.400[R] COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase  ali follow..  19  196.............................................................................................................................................................................................................................................AMIAMALACKPQLLIADEPTTALDVTTQAEILDLILFITHDMGVVAQIADDVLVMHHGYGTVEQIFMLIGSVLKLEQKAEIRLARPPLDLEVKDLSMHF-GEMKALDGVSIKLLPGETLGIVGESGSGKTTMGRSIMRLYDPTAGEMLYRRADIEGKELKAARRELRMVFQDPFGVAQVIGEPLLVNGIAKGKELEERVCSLMEQVGLDPSGRERYP--------AFSGGQRQRIGIARAITLRPRIIVADEATSALDVSVRFQVLDLLMKLQDGLAYIFISHDIGVIRYCDRVGVMYRGKLVEVGEAEKVCNA............. 549
62 -29.400[R] COG3910 Predicted ATPase  ali follow..  15  2......................................................................................................................................................................................................................................................................................................................................LFLDSVAMEYPFSVPAMRHLERLEFKTPITFFAGNNGSGKSTLLEGLAAGMTAYAIGNHGDVKGDLYLQHAETVAKAFYFARKFLRAEDVLGYIRRQNENALDDFRWEREKALKKGEDFPEETPEIFRGIVRNNSLRRSHGEGF-LDIMHRRLHGAGLYFLDEPESPLSPQKQLELAAIIRQAADGGQLIIATHSPVLLA-EATIYYFDEDGITERLYDE.................. 238
63 -29.200[R] COG4172 ABC-type uncharacterized transport system, duplicated ATPase component  ali follow..  22  8......................................................................................................................................................................................................................................................................................................................................LSVKDLRVRFRTLDEAVKGINIHVNAGETVAVVGESGSGKSQTMMAAMSLLASNTGSVDYRGRNLLTLSKSDLNAKISMIFQEPM-IGNQLIEPIRRHRGLNAAEKLLRLVHIPDPERRMKSYPH-----------EMSGGQRQRVMIAMALANDPDILIADEPTTALDVTIQAQILMLLAELQRGMAIVFITHDLGIVRRADRVYVMRQGEVVEEGEAGAIFAN............. 247
64 -28.000[Q] KOG0061 Transporter, ABC superfamily (Breast cancer resistance protein)  ali follow..  21  66.....................................................................................................................................................................................................................................................................................................................................VLSFDNLTYNVSKTKTLLNNISGETRDGEIMAVLGASGSGKSTLIDALANRIAKGKGTVKLNGETLQS---RMLKVISAYVMQDDLLFPMTVEETLMFAAEFRLPRSLPKSKKKLRVQALIDQIRNAAKTIIGDEGHRISGGERRRVSIGIDIIHDPILLFLDEPTSGLDSTSAFMVVKVLKRIAQGSIVIMSIHQPSHLGLLDRLIFLSRGHTVYSGSPASLPR.............. 323
65 -27.700[A] KOG0063 RNAse L inhibitor, ABC superfamily  ali follow..  15  192..................................................................................................................................................................................DERGLMEEICADMELNQVLEREARQVSGGELQRFAIAAVFVKKADIYMFDEPSSYLDVRQRLKAA------QVIRSLLRHDSYVIVVEHDLSVLDYLSVVTLPFSVREGINVFLAGFIPTENLRFRDESLTFRVSETTQENDGEVKSYARYKYPNMTKQLGDFKLEVMEGEFTDSQIIVMLGENGTGKTTFIRMLAGAFPREEGVQSEIP----EFNVSYKPQGNDSKRECTVLLHDKIRDAC------AHPQFMSDVIRPLQIEQLMDQVVK-----------TLSGGEKQRVAITLCLGKPADIYLIDEPSAHLDSEQRITASKVIKRFILKKTAFIVEHDFIMATYADRVIVYEGQPAVKAHSPQSLLSGMNHFLSHLNITFR 571
66 -27.600[R] COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog  ali follow..  15  183..................................................................................................................................................................................DERGFLDELIDRLDLRGVVERKISELSGGELQRVAIAACAARDAQFYFFDEISPYLDIYQRINVARLV---QEISKDRAVLVVEHDLAILDMLTDVIHIAYGEPAGFGVITLPKSVRVGINQYLKGYLPEENIRIRPEAIRFEVHPPRVSFNSFSKQY-GDGFSLKATGGSLREGEVLGIVGPNGIGKSTFVKVLAGEIKPDEGDPGIEVKISYKPQYIKADTPV------------SVQDFLRGITKRFGSYYEVEIANPLQLERIYESLLT-----------ELSGGELQRVAIAACLSQEADLYILDEPSAHLDVEQRSMVTKVINRFAEQKTAMVVDHDIYMIDMSQRLLVFE-GKPSVYGEAHGPFSMESGMNRFLE.... 548
67 -26.900[EJ] KOG0062 ATPase component of ABC transporters with duplicated ATPase domains/Translation elongation factor EF-3b  ali follow..  21  7......................................................................................................................................................................................................................................................................................................................................IVNTDFSLAY-GSRMLLNKTNLRLLKGHRYGLCGRNGAGKSTLMRAIA-------NGQLDGFPDKDTLRTCFVEHKLQGEEGDLDLVS-------------IALDEELQSTSREEIAAALESV----EERRAQTVGSLSGGWKMKLELARAMLQKADILLLDEPTNHLDVSNVKWLEEYLLEH-TDITSLIVSHDSGFLDTCTDIIHYENKKLAYKGNLAAFVEQKPEAKSYYTLTDS 224
68 -26.700[R] COG3845 ABC-type uncharacterized transport systems, ATPase components  ali follow..  23  6......................................................................................................................................................................................................................................................................................................................................IELIGINKSF-GAVRANRDINLEIARGTIHGIVGENGAGKSTLMSILYGFYQADSGEIRVGGKPASKTPNDAIALGIGMVHQHFMLVDNSVLENIILGAESDALLKSSIAKARSELERLEREY--GLEVDPDAIIEELPVGLQQRVEILKALYRGAEILILDEPTGVLTPAEADHLFRILKQLKQGKTVVLITHKLREIMATDNVSVMRQGTMVATRETSKT................ 228
69 -25.500[P] COG1122 ABC-type cobalt transport system, ATPase component  ali follow..  17  1...............................................................................................................................................................................................................................................................................................................................MRGVWRLIELRVDKYTYPNGRVGLSDFYATFEGCD--FIIGPTGSGKSTVLKMVNGLIPNFEGKVRVFGEKPN-------PRIAFFVKQNP-ITSTQVIDELVFPLIQQGFGWGEAKREAEEVCEEL-----GIGGLLERKTYELSTGELQLVQIAAALASKARILVFDEPFANLSRKN----VLKVIKILRDYPHLVSEHRLEFSSFEKTINLGLECEDFEIPEVEPGEAVYDGLIELREGEL. 234
70 -25.500[G] COG1129 ABC-type sugar transport system, ATPase component  ali follow..  16  138...................................................................................................................................................................................................................................................................TATLTPSETEHLFNVMRELRRQGVAIIFISHHLDEIFEICDRITELIGSCLTSEVDNDRLVEMMVGRIEVEELQ-----LKKGGPVSRFSLRKGEILGFAGLVGSGRTETVLAMLGAHSASRRKIKLDGVDTRSGPDDALMRGIGLLPESGLITSFSILQNISLNNYRKYRKALDLKKELEHTTKAMAQVQVKAQGP-YARVDTLSGGNQQKIVIARWLNHDMRVLIFDEPTRGIDVGAKAEIYSLMREFAARGHSIIISSELPEVIGSDRVCVFRSGGIVATVEGEDI................ 454
71 -23.600[J] KOG0066 eIF2-interacting protein ABC50 (ABC superfamily)  ali follow..  26  674......................................................................................................................................................................................................................................................................................................................................LGVHNVTFAFPSQKPLFIKVDFGIDLTSRVAIVGPNGVGKSTFLKLLLGELEPQEGEQRKNH-----------RLHVGRFDQH-------SGEHLTAEESAAEYLQRLFNLPHEKARKALGSF--GLVSHAHTIKMKLSGGQKARVALAELCLSAPDVLILDEPTNNLDIESIDALAEAINEY--EGGVIIVSHDERLIREGCTLYVIEDQTINEVGEFDDYRKE............. 879
72 -23.500[R] COG0488 ATPase components of ABC transporters with duplicated ATPase domains  ali follow..  22  7......................................................................................................................................................................................................................................................................................................................................YTMHRVGKVVPPKRHILKDISLSFFPGAKIGVLGLNGAGKSTLLRIMAGVDKEFEGEARP-QPGIK----------IGYLPQEPKL-QQTVREAVEEAVSEVKNEAIIQAHDGHNLDNQLERAADAL-PDWDAKIEHLSGGERRRVALCRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDY--EGTVVAITHRYFLDNVAGWILELDRGEGIPEGNYSSWLEQKEKRLEQEQATEN 264
73 -23.400[R] KOG0927 Predicted transporter (ABC superfamily)  ali follow..  22  386......................................................................................................................................................................................................................................................................................................................................IMVQNVNFRYNDETPIYKNLEFGIDLDTRLALVGPNGAGKSTLLKLLYGDLVPTSGMIRKNS-----------HLRIARYHQHLH----------LLDLDASPLEYMMRAFPDVKEKEEMRKIIGRYGRQQVCPIRQLSDGQRCRVVFAWLAWQVPHLLLLDEPTNHLDMETIDALADAINDF--DGGMVLVSHDFRLINQAEEIWVCEKETVTKKGGILDYKDHLKNKITSENEKKA 607
74 -20.800[R] COG3044 Predicted ATPase of the ABC class  ali follow..  14  174.....................................................................................................................................................................................................................................................................................................RAQLDDLGLVAFIANGSVLPRLAGNCDLPMKEAVPFIAPSLEVTLSTPNQGELVGMGIPQGITLIVGGGFHGKSTLLTALERSVY---NHIPGDGRERMVTDVKAMK----------------------------IRAEEGRCVHNLNLSNYINHLPMGKDT-TDFSTQDASGSTSQSAWLQESIEAGVTTLLIDEDTSATNERMQALVSKGEEPITPGISTLVVMGGSGDYLDADTVIQMHDYQPVDVTEKAREVIAQ............ 419
75 -20.400[GM] COG1134 ABC-type polysaccharide/polyol phosphate transport system, ATPase component  ali follow..  25  308.....................................................................................................................................................................................................................................................................................................................................................ALKNVSFDIKEGEVVGIIGHNGAGKSTLCKLLTKILTPDEGELELSG-------------ETTSLLSYGTGFNAQLKDNVYLNPKERVAQEYPNIVAFSELEKHMDKPVKSY-----------SSGMKSRLGFSIAATLQPDIFIIDEALSTGDVAFQQKASEKIQEMMEAKAVIIVSHSMKFVESCTRAIWLEKGQVRFDGDPEEAVKL............. 503

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.