current user: public

If you have questions about the server, please let us know.

Query: gi|108885075|ref|NP_072661.2| DNA polymerase III, beta subunit (MG_001) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380
# Score Template Links and tools%idFirst MKILINKSELNKILKKMNNVIISNNKIKPHHSYFLIEAKEKEINFYANNEYFSVKCNLNKNIDILEQGSLIVKGKIFNDLINGIKEEIITIQEKDQTLLVKTKKTSINLNTINVNEFPRIRFNEKNDLSEFNQFKINYSLLVKGIKKIFHSVSNNREISSKFNGVNFNGSNGKEIFLEASDTYKLSVFEIKQETEPFDFILESNLLSFINSFNPEEDKSIVFYYRKDNKDSFSTEMLISMDNFMISYTSVNEKFPEVNYFFEFEPETKIVVQKNELKDALQRIQTLAQNERTFLCDMQINSSELKIRAIVNNIGNSLEEISCLKFEGYKLNISFNPSSLLDHIESFESNEINFDFQGNSKYFLITSKSEPELKQILVPSRLast
1 -94.700IDP04571 DNA polymerase III subunit beta [Bacillus anthracis str. Sterne] BAS0002 [Bacillus anthracis str. Sterne]  ali follow..  20  1MRFSIQKDYLVRSVQDVMKAVSFRTTI-PILTGIKVVATEEGVTLTGSDADISIESFIPVEVEVKQSGSIVLQAKYFSEIVKKLPKETVEISVENHLTKITSGKSEFNLNGLDSAEYPLLPQIEEHH-----VFKIPTDLLKHMIRQTVFAVSTS-ETRPILTGVNWKVYNSE-LTCIATDSHRLALRKAKIEGIQANVVIPGKSLNELSKILDESEEMVDIVITE-------YQVLFRTKHLLFFSRLLEGNYPDTTRLIPAESKTDIFVNTKEFLQAIDRASLLARDGRNNVVKLSLEQAMLEISSNSPEIGKVVEEVQCEKVDGEELKISFSAKYMMDALKALDSTEIKISFTGAMRPFLIRTVNDESIIQLILPVR 377
2 -94.600IDP90614 DNA polymerase III subunit beta [Vibrio cholerae O1 biovar eltor str. N16961] VC0013 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  1MKFTIERSHLIKPLQQVSGTLGGRASL-PILGNLLLKVEENQLSMTATDLEVELISRVTLEGE-FEAGSITVPARKFLDICRGLPDSAVITVLEGDRIQVRSGRSRFSLATLPASDFPNIEDWQSEV-----QVSLTQAELRGLIEKTQFSMANQ-DVRYYLNGMLFEI-DGTTLRSVATDGHRMAVAQAQLGAAQKQIIVPRKGVLELVKLLDAPEQPVVLQIGH-------SNLRAEVNHFVFTSKLVDGRFPDYRRVLPQHTSKTLQTGCEELRQAFSRAAILS-NEKFRGVRVNLADNGMRITANNPEQEEAEELLD-VSFEGEPIEIGFNVSYILDVLNTLRCDNVRVSMSDANASALVENVDDDSAMYVVMPIR 365
3 -89.700IDP06076 gene: dnaN; DNA polymerase III subunit beta [Helicobacter pylori J99] NP_223170 [Helicobacter pylori J99]  ali follow..  16  1MKISVSKNDLENTLRYLQAFLDKKDAS-SIASHIHLEVIKEKLFLKASDSDIGLKSYISTQ-STDKEGVGTINGKKFLDIISCLKDSNIVLETKDDSLVIKQNKSSFKLPMFDADEFPEFPVIDPKV-----SLEINAPFLVDAFKKIAPVIEQT-SHKRELAGVLMQFNKHQTLSVVGTDTKRLSYTQLEKISEDISCILPKRALLEILKLFYE----------NFSFKSDGMLAVVENETHAFFTKLIDGNYPDYQKILPKEYTSSFTLGKEEFKEGIKLCSSLSST-----IKLTLEKNNALFESLDSEHSETAKTSVEIE-IEKAFHLGVNAKFFLEALNALGTTQFVLKCNEPSSPFLIQEPLDEKISTLMMPIT 373
4 -6.630IDP04566 putative lipoprotein [Clostridium perfringens ATCC 13124] CPF_1876 [Clostridium perfringens ATCC 13124]  ali follow..  12  74STTEFSDSELTDLFI---LALREEPDAIKDLTGLKVDIENDDINIYVDNIPFQGKLTFTAQSK-GKVGFIDISKDTIFKNLQDNSILSFDKTNGDIILSFKDIIKYLQIKSIKVEN----------------VFNGTIPLLSSIFPNL........................................................................................................................................................................................................................................ 220
5 -4.750IDP91207 3-dehydroquinate dehydratase [Bacteroides thetaiotaomicron VPI-5482] BT_2842 [Bacteroides thetaiotaomicron VPI-5482]  ali follow..  13  1MRIQIINGPNINLLGKREPSIYGSVTFEDYLAELRKRYADLEIDYFQSNIEGEMIDCIQQVGFILNAGAYTHTSIALQDAIRSVTSPVIEVHISNRHVSMIACACKGVICGFGLNSY....................................................................................................................................................................................................................................................................... 129
6 -4.570IDP95292 general secretion pathway protein L [Acinetobacter baumannii ATCC 17978] YP_001085280 [Acinetobacter baumannii ATCC 17978]  ali follow..  10  217.....................................................................................................................................................................................................................................................AIEQYKYWFGPSSRVTEQNIKGQFESHLRMALSLLSRVGPILMQRQILAQQLNYDASILTMALKAKSADDLQALTQQLNQQGFKAELG............................................... 311
7 -4.290IDP00022 UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2 (Enoylpyruvate transferase 2) (UDP-N-acetylglucosamine enolpyruvyl transferase 2) (EPT 2) BA_5578 [Bacillus anthracis str. Ames]  ali follow..  51.......KMLGDLLEEIGGRVTYGQEEEMVVDPSNMVAMPLPNGKRASYYLMGAMLGRFKKAVIGLPGGCHLGPRPIDQHIKGFEALGAHVTNEQGAIYLRADELRGARIYLDVVSVGATINIMLAAVRAKGRTVIENAAKEPEIIDVATLLTS---------GARIKGAGTDVIRIDGVDSLHGCHHTIIPDRIEAGTYMILGAASTVDNVIPQHLESVTAKLREVQVETNDDQITVNGDRRLKVVDIKTLVYPGFPTDLQQPFTTLLTKAHGT-DTIYGARFKHIDELRRMNAQIKVEGRSAIVTGPVLLQGAKVKAIAGLMADGITEHIDRGYENIVDKLKGLGAN............................... 412
8 -3.980IDP04182 sensor histidine kinase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0238 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  187QRTSRYEEAALDALSNVRSVITSLAVFGMVSGALLGVWLLRTLSKPLAELVKSTTARLDHRISISGPDELKTLARHFNYMAQSLEQAQQKERMSRQLIEREVADRTQELA------------------------QALQTLEKAKHQQKEFFANVSHELRSPATAILGEAQITLRSRHNSDDEYRQTLLRISESAEQLAFRI-----EDLLMLIRHDERLFHPALTELLLGEIWQAVVRQASLLTHAQQVLTVNTPAQGEWQTQLCYTDCDKLLMVIRILVDNALRYDPTQQPIGLNLELDEEAWRVQLVDQGIGIAEADLSVIRPDGLGIGLT-----LAQSIVKQLDGEIRIE----------SVLEQGTTVTLTFPRG 540
9 -3.890IDP90779 gene: nusA; transcription elongation factor NusA [Yersinia pestis CO92] YPO3497 [Yersinia pestis CO92]  ali follow..  2......NKEILAVVEAVSN----------LPREKIFEALETAL-ATATKKKYEQEIEVRVSID-RKTGDFDT---RRWVAVDEVTMPTREITLDAQFEDPSLQLGDYVEDQIESVTFDRITTQTAKQV---------VQKVREAERAMVVEQFRQYLGQ-IVTGIVKKVSRDSIALDLG---------------HNAEAVIGRE--DMLPRENFRPGDRIRGVLYDVRPEARGAQLFVSRSRSEMLVELFRIEVP-------------------EIGEELIEIKAAARDPGSRA-KIAVKTNDKRIDPVGACVGMRGARVQAVELGGERIDI---AQFVINAMAPADVASIVVDEDKHTMDVAVEASN............ 313
10 -3.720IDP00359 gene: murZ; UDP-N-acetylglucosamine 1-carboxyvinyltransferase lmo2552 [Listeria monocytogenes EGD-e]  ali follow..  29...LIPAAILAESEVVLEGLPDISDTLYDILEGGSVRYDNKTAIIRASYYLMGAMLGRFKKAVIGLPGGCYLGPRPIDQHIKGFEALGAKVTNEQGAIYLRADELKGARIYLDVVSVGATINIMLAAVRAKGKTVIENAAKEPEIIDVATLLTN---------GAIIKGAGTDTIRITGVDHLHGCHHTIIPDRIEAGTFMVLAAASRIENVIPTHLEGIIAKLTEVPMDIEEDSIFIGEVENIKKVDIKTYAYPGFPTDLQQPLTALLTRAEGSSVTIYPSRFKHIAELERMGGKFKLEGRSAVISGPAKLQGSKVTAIAGLLAEGRTEHIERGYSKIIEKLSAIGAD............................... 412

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35