current user: public

If you have questions about the server, please let us know.

Query: gi|12044853|ref|NP_072663.1| DNA gyrase subunit B (MG_003) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650
# Score Template Links and tools%idFirst MEENNKANIYDSSSIKVLEGLEAVRKRPGMYIGSTGEEGLHHMIWEIVDNSIDEAMGGFASFVKLTLEDNFVTRVEDDGRGIPVDIHPKTNRSTVETVFTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVFRQNKKYFLSFSDGGKVIGDLVQEGNSEKEHGTIVEFVPDFSVMEKSDYKQTVIVSRLQQLAFLNKGIRIDFVDNRKQNPQSFSWKYDGGLVEYIHHLNNEKEPLFNEVIADEKTETVKAVNRDENYTVKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVEGFRNALVKIINRFAVENKFLKDSDEKINRDDVCEGLTAIISIKHPNPQYEGQTKKKLGNTEVRPLVNSVVSEIFERFMLENPQEANAIIRKTLLAQEARRRSQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAILPLRGKILNVEKSNFEQIFNNAEISALVMAIGCGIKPDFELEKLRYSKIVIMTDADVDGAHIRTLLLTFFFRFMYPLVEQGNIFIAQPPLYKVSYSHKDLYMHTDVQLEQWKSQNPNVKFGLQRYKGLGEMDALQLWETTMDPKVRTLLKVTVEDASIADKAFSLLMGDEVPPRREFIEKNARSVKNIDILast
1 -200.000IDP04572 DNA gyrase subunit B [Bacillus anthracis str. Sterne] BAS0005 [Bacillus anthracis str. Sterne]  ali follow..  53  3.QKQMQENSYDESQIQVLEGLEAVRKRPGMYIGSTSGKGLHHLVWEIVDNSIDEALAGYCDEINVSIEEDNSIRVTDNGRGIPVGIQEKMGRPAVEVIMTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTELEVFVHREGKIHYQKYERGIPVADLKVIG--DTDQTGTITRFKPDPEIFQETTYEFDTLATRMRELAFLNRNIKLTIEDKRE-HKQKKEFHYEGGIKSYVEHLNRSKQPIHEEPVYVE----------GSKDGIQVEVSLQYNEGYTNNIYSFTNNIHTYEGGTHEVGFKTALTRVINDYGRKNSILKDADSNLTGEDVREGLTAIVSIKHPNPQFEGQTKTKLGNSEARTITESVFSEAFEKFLLENPNVARKIVEKGTMAARARVAAKKARELTRRKSALEVSSLPGKLADCSSKDPAISEIYIVEGDSAGGSAKQGRDRHFQAILPLKGKIINVEKARLDKILSNDEVRTIITAIGTNIGGDFDIEKARYHKVIIMTDADVDGAHIRTLLLTFFYRYMRQIIEHGYIYIAQPPLFKVQQGKKIQYAYNEKELEKILAELAQPKPGIQRYKGLGEMNPTQLWETTMDPEVRSLLQVSLQDAIEADETFEILMGDKVEPRRNFIQENAKYVKNLDI 640
2 -190.000IDP90817 DNA topoisomerase IV subunit B [Vibrio cholerae O1 biovar eltor str. N16961] VC2431 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  37  2......TEQYNAGAIEVLNGLEPVRRRPGMYTDTT---RPNHLGQEVIDNSVDEALAGYASKIQVILHADQSLEVIDDGRGMPVDIHPEEKVSGVELILCKLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVAVRRDGQVYEIAFEHGDKVTELTVTGTCGRRNTGTSVHFWPDTKYFDSPNFSVSRLINNLRAKAVLCPGLEIIFTDKVNNNEH--RWLYEDGLKDYLAEGVKGYTLLPEEPFTGEFTA--------QTEAATWAVIWL-PEGGELITESYVNLIPTAQGGTHVNGLRQGLLDAMREFCEFRNL-LPRGVKLTGEDVFDRCAYVLSIKMQDPQFAGQTKERLSSRQSAAFVSGVVKDAFSLWLNEKPQLAEQLAEVCIANAHSRMRASKKVV---RKKIASGPALPGKLTDCTVQDLNRTELFLVEGDSAGGSAKQARDREFQAVMPLRGKILNTWEVSADQVLASQEVHDISVALGIDP-DSDNLEALRYGKVCILADADSDGLHIATLLCALFTRHFRALVKAGHVYVAMPPLYRIDCGKEVFYALDDQEKEGVLERLKKAKVNVQRFKGLGEMNPLQLRETTMDPNTRRLVQLTIDDAEATDEMMDMLLGKKADDRRAWLQRNGDMAE.... 625
3 -189.000IDP02606 gene: gyrB; DNA gyrase subunit B [Listeria monocytogenes EGD-e] lmo0006 [Listeria monocytogenes EGD-e]  ali follow..  52  7TNVQENASDYNEDQIQVLEGLEAVRKRPGMYIGSTSQRGLHHLVWEIVDNAIDEALAGFCTEIEITIEADNSITVRDNGRGIPTGINEKIGRPTVEVIFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTSLEVYVHREGQKYYQRFERGDVVMDMEEQ--GETDYRGTIVHFTPDPQIFTETTFDFDTLRTRTRELAFLNRGLTISIEDKREEHKVRKDFHYEGGIRSYVEHLNKAKDVIHEPPIYLE----------GERDDIMVEISMQYNTGFSSNIISFANNIHTYEGGTHESGFKTALTRVINDYARRNKLFKDSDDNLSGEDVREGLTAIISIKHPDPQFEGQTKTKLGNSEARSITDKLFSEALNKFMMENPDVAKKIVEKGVVASRARLAAKRAREVARKSSGLEISSLPGKLADCSSRNPEISELYIVEGDSAGGSAKQGRDRLFQAILPIRGKILNVEKARLDRILANEEIRTIFTAMGTGFGGDFDVSKSRYHKLIIMTDADVDGAHIRTLLLTLFYRYMRPLLDAGYIYIAQPPLYQIKHGKQIEYVYSDGQLEDYLASLDDTKYSIQRYKGLGEMNPEQLWDTTMNPEHRTLLQVNIKDAIDADETFEMLMGDRVEPRRKFIEDNAQYVKNLDV 646
4 -188.000IDP05229 gene: parE; DNA topoisomerase IV subunit B [Listeria monocytogenes EGD-e] lmo1286 [Listeria monocytogenes EGD-e]  ali follow..  43  2.....NRNEYNDDSIQVLEGLEAVRKRPAMYIGSTDVRGLHHLVYEIVDNSVDETLAGFGKKIVVTLHEDGSVSVSDEGRGMPVGMHKTGKSTVEVILTVLHAGGKFGQEGGYKTSGGLHGVGSSVVNALSEWLVVTINRDGATYQQKFKDGGKPDGTLKKI-GKSKATGTTIRFKPDPAIFPTTSFNYETLSERLRESAFLLKGMLIELIDERVGMAE--AFHFEEGVKNFVEYINEGKDVLHPVASF-----------EGENATIEVEMAFQFNDGYSENILSFVNNVRTRGAGSHESGMKAAMTRIFNDYARRVNLLKEKDKNLEGSDIREGLSAVLSIRVKILQFEGQTKEKLGTQEARQAVDAVVAEHLAYFLAENPETSSLLVKKAVKAREAREAARKAREETRKKKKRSETLLSGKLTPAQSRNPNKNELYLVEGDSAGGSAKQGRDRRFQAILPLRGKVINTEKAKLQDILKNEEISTIIHTVGAGVGTEFDVEDCNYDKVVIMTDADTDGAHIQVLLLTFFYRYMRPLVEAGKVFIALPPLYKVSRGSGKKEVIEYAWTDEELDSAIGKGYMIQRYKGLGEMNADQLWETTMNPDTRTLIRVRVDDSARAERRVATLMGDKVEPRRQWIEKHVEFS-MED. 637
5 -159.000IDP02529 gene: gyrB; DNA gyrase subunit B [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0003 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  50  2......QENYGASNIKVLKGLEAVRKRPGMYIGDTNIGGLHHMIYEVVDNSIDEAMAGHCDTIDVEITTEGSCIVSDNGRGIPVDMHPTENMPTLTVVLTVLHAGGKFDKDTYKVSGGLHGVGVSVVNALSKKLVATVERNGEIYRQEFSEGKVISEFGVIG--KSKKTGTTIEFWPDDQIFEVTEFDYEILAKRFRELAYLNPKITINFKDNRVGKHE--SFHFEGGISQFVTDLNKKEALTKAIFF------------SVDEEDVNVEVALLYNDTYSENLLSFVNNIKTPDGGTHEAGFRMGLTRVISNYIEANASAREKDNKITGDDVREGLIAIVSVKVPEPQFEGQTKGKLGSTYVRPIVSKASFEYLTKYFEENPIEAKAIMNKALMAARGREAAKKARELTRKKESLSVGTLPGKLADCQSKDPSESEIYLVEGDSAGGSAKQGRERSFQAILPLRGKILNVEKARLDKILKSEQIQNMITAFGCGIGEDFDLSKLRYHKIIIMTDADVDGSHIQTLLLTFFFRFMNELVANGHIYLAQPPLYLYKKAKKQIYLKDEKALSEYLIETGKKGATIQRYKGLGEMNPEQLWETTMDPSVRRLLKITIEDAQSANDTFNLFMGDEVEPRRDYIQAHAKDVKHLDV 769
6 -157.000IDP90603 gene: gyrB; DNA gyrase subunit B [Vibrio cholerae O1 biovar eltor str. N16961] VC0015 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  47  2......SNNYDSSSIKVLKGLDAVRKRPGMYIGDTDGTGLHHMVFEVVDNSIDEALAGYCKDIVVTIHEDNSVSVSDDGRGIPTEMHPEEKVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEKVLLTIYRGGKIHSQTYHHGVPQAPLAVV--GETERTGTTVRFWPSAQTFTNIEFHYDILAKRLRELSFLNSGVSIKLTDERE-EDKKDHFMYEGGIQAFVTHLNRNKTPIHEKVFHFNQE---------REDGISVEVAMQWNDGFQENIYCFTNNIPQRDGGTHLAGFRGALTRTLNNYMDKEGFSKKAQAATSGDDAREGLTAVVSVKVPDPKFSSQTKDKLVSSEVKSAVESAMNEKLADFLAENPSEAKNVCSKIIDAARAREAARKAREMTRRKGALDLAGLPGKLADCQEKDPALSELYIVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYRQMPELIERGYIYIAQPPLYKVKKGKQEQYIKDEEAMNQYQVALAMDGAELQRYKGLGEMNPDQLWETTMDPETRRMMQVTIEDAVGADELFTTLMGDQVEPRRAFIETNALKVANLDV 805
7 -150.000IDP90819 gene: gyrB; DNA gyrase subunit B [Yersinia pestis CO92] YPO4094 [Yersinia pestis CO92]  ali follow..  46  2......SNTYDSSSIKVLKGLDAVRKRPGMYIGDTDGTGLHHMVFEVVDNAIDEALAGHCKEILVTIHADNSVSVQDDGRGIPTGMHDEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEKLELVIRREGKVHEQTYKMGVPQAPLKVV--GETEQTGTTVRFWPSFQTFTNNTFQYEILAKRLRELSFLNSGVSIKLKDKRNDKED--HFHYEGGIKAFVEYLNKNKNPIHPKVFYFST----------MKDDIGVEVALQWNDGFQENIYCFTNNIPQRDGGTHLVGFRTAMTRTLNSYMDKEGYSKKAKISATGDDAREGLIAVVSVKVPDPKFSSQTKDKLVSSEVKTAVETLMNEKLVEYLLENPTDAKIVVGKIIDAARAREAARKAREMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDYNPDKLRYHNIIIMTDADVDGSHIRTLLLTFFYRQMPEIIERGHVFIAQPPLYKVKKGKQEQYIKDDDAMEQYQMTLALDGAALQRYKGLGEMNPDQLWETTMDPESRRMLRVMVKDAIAADQLFTTLMGDAVEPRRAFIEENALRAANIDI 804
8 -112.000IDP92142 DNA topoisomerase II, putative [Toxoplasma gondii ME49] TGME49_112230 [Toxoplasma gondii ME49]  ali follow..  22  28.KSGGGKPKTIEQRYQKKSQLEHILLRPDTYIGSTEVPGLYKIVDEILVNAADKPGARRMSAIKIDINASGRITIWNDGEGIPVAIHQEHKVYVPEMIFGQLLTSDNYDDSECRVTGGRNGYGAKLTNIFSREFTVECGERKKKFKMTWTKNMEQKSESEISSY-NGTDYVKISFIPDFAKFGMTGFDDDSLSLLRKRAYDLTSGVKVFLNGTREEFDESDDDWDEGPKRKKAAKKNGKKGELEDEEDVANGVEKKVI--KIHDKQWRWEVVISSTDGGQFQQVSFVNSICTTKGGTHVSHVIEPLLAAIVKKANTK---NKGGMEIKAAHVKQHLWIFVSCLIVNPAFDSQTKETLTTKPAKFGSKCTLADKTIGWAQTKQQSVRAFSLSLLDCWRLGALELRKQMKVGKTKGRERLAGIPKLEDAGGRHSQDCTLILTEGDSAKTSCLAGLGRDRYGVFPLRGKLLNVRDASFKQLTENKEIQNILKIVGLQVNDRTDTRGLRYGSVMIMTDQDHDGSHIKGLLINMMHHYWPQLLKRGFLKAFSTPIVKVSKNNVEKAFYTIPEYEQWKRSCNTTGWKIKYYKGLGTSTDREFKEYFNDLDKHQIDFVWSGQHDGELIDMA-FNKKRAEDRKRWLQSYQEG...... 765
9 -78.800IDP92137 DNA gyrase subunit B, putative [Toxoplasma gondii ME49] TGME49_097780 [Toxoplasma gondii ME49]  ali follow..  40  249.SFASPSSAYTSDSIRVLEGLEPVRMRPGMYIGSTDSEGLHHLVWEAIDNAVDEVENGDCRRIVVVLHADRRVTVADDGRGIPCDVHPQTGLSALETVFTKLHAGGKFSPASYAFAGGLHGVGSSVVNALSSQLRVSVLRDGKLHAISFSRGQVVSPLTVQTSPSLSRSGTCLTFEVDREIFELFSDAPVISINGSHPSSGLLLSVRLFFSSPSSSPSSSSSASSSASSSSSASSLSSSDSSASASLCSSS--------------SAAASPLSPSSVSSSDFFLSFVNSIPTPEGGVHVEGIRAALSRAVQRLLRLSDNSHEKSLNIPGEFLREGLVGVVSLKMREAEFEGQTKKKLGNKKVRGIVEELVTDALLNYFERHPQNLQKLLQKATAARAAAAAAKAARDAKQQSSSLHLTLLPGKLSDCSPTNARSKELFIVEGESAAGSAKQARDRRTQAILPLRGKILNVEKLNFARIFENEELKALVAALGISVTKAADLEGLRYSRVIILTDADVDGAHVRSLLLTFFFRLQPELFRQGRIFVACPPLFKIAHFPVPHKLLQDATAAFRKEQLSLPGVTLQRFKGLGEMQPEQLRRTTMSPVTRILKKISVADAEAAEAAVASLMGDDVDARKKIIFEANRFVEELDV 1257
10 -8.520IDP93952 beta-fimbriae usher protein [Yersinia enterocolitica subsp. palearctica Y11] YP_006004993 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  11  165YTYNQGVGHYDNQETYALRAVESLKSV--VQLGEFGLVG--DTYSGLPIVGTDNAQTQLVVPIEGIANTNATIEIRQRGR----------------VIYRTVVPPGPFSLSNISNFSSGVVTDVDVIEE-QQHFTVNFEQQATTYQLGLGRYRDSLNESETKSPLLASGEASFSPVNALRVTSAGLVSPDYQNLSVQNLYSGLESAWFSAYSNTKDAGQGYQLTLQNQVAINGNLSASLSTLYDSSSYWSPDNALSSGNNLNELKYGKLKNSTSAAVSWAHPAFSYVLSNNMYYQAADSVSHTFSASEQFGRVTTTLSFQSTSQGQ-------NSVYIGINMPLGNGSLSGRMQRNNGNMTLGSTYQGRWGDNKGYQVGITGSDSQRRINGALNMNTAYSQLAGGVSQATNNSRSAYVSANGSMAYANSSSAIGDTFAVINVPSQSDLRVSSTDYAGTTLLPVMPYTTSKAQISTKTLPLNIRLNSTSTDLGTVATRNFEATE---TRQLLLSIRDSNGEMLPANVLDEKGNFLGTIIGDGNFML......................................................................................................... 719

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Q, Zmasek CM, Dishaw LJ, Mueller MG, Ye Y, Litman GW, Godzik A. Novel genes dramatically alter regulatory network topology in amphioxus. Genome Biol.2008 Aug 4;9(8):R123.