current user: public

If you have questions about the server, please let us know.

Query: gi|12044855|ref|NP_072665.1| seryl-tRNA synthetase (MG_005) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .
# Score Template Links and tools%idFirst MLDPNKLRNNYDFFKKKLLERNVNEQLLNQFIQTDKLMRKNLQQLELANQKQSLLAKQVAKQKDNKKLLAESKELKQKIENLNNAYKDSQNISQDLLLNFPNIAHESVPVGKNESANLELLKEGRKPVFDFKPLPHRELCEKLNLVAFDKATKISGTRFVAYTDKAAKLLRAITNLMIDLNKSKYQEWNLPVVINELSLRSTGQLPKFKDDVFKLENTRYYLSPTLEVQLINLHANEIFNEEDLPKYYTATGINFRQEAGSAGKQTKGTIRLHQFQKTELVKFCKPENAINELEAMVRDAEQILKALKLPFRRLLLCTGDMGFSAEKTYDLEVWMAASNEYREVSSCSSCGDFQARRAMIRYKDINNGKNSYVATLNGTALSIDRIFAAILENFQTKDGKILIPQALKKYLDFDTIKLast
1 -131.000IDP90689 gene: serS; seryl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0389 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  43  1MLDLKNLQNNFDEVAKKLKNKKVDENILKKLAELFASLKKEKIALEEFQAFQNKFSKELATAEDKESLKAKLSENKSKINEQSAKVNALENELEEIAHAIPNIPDECVPVGEDENENVELKKVLNPPSFDFTPKEHFELGESLNWLDFMRGVKISQSRFCVLKNEGALLSRALVNYMIDFNSRGFEFVNVPFLVNGATMFGTGQLPKFKEDMYKVDDEDLYLISTSEIPVTNLYSGEILASETLPIKMTCYSACFRKEAGSAGRDTRGIIRQHQFEKVELVSITKPEQSDSVFNEMLECASDLLSSLGLAHRHLMLCTGDLGFSAAKTVDLEVWLPGQNKYREISSVSNCRDFQARRAKIRYKN-EQGKNELVHTLNGSSLAVGRTLVAIMENYQDKEGKIHIPDVLKKYF...... 411
2 -129.000IDP04574 seryl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS0015 [Bacillus anthracis str. Sterne]  ali follow..  43  1MLDIKFLRTNFEEVKAKLQHRGEDLTDFGRFEELDTRRRELLVQTEELKSKRNEVSQQISEKKDAEALILEMREVGEKVKDLDNELRTVEEDLERLMLSIPNIPHESAPVGETEDDNVVARTWGEVKEFAFEPKPHWDLATDLGILDFERAGKVTGSRFVFYKGAGARLERALISFMLDLHEHGYEEVLPPYMVNRASMTGTGQLPKFEEDAFRIESEDYFLIPTAEVPVTNMHRDEILNKEQLPIRYAAFSSCFRSEAGSAGRDTRGLIRQHQFNKVELVKFVKPEDSYEELEKLTNDAERVLQLLELPYRVMSMCTGDLGFTAAKKYDIEVWIPSYGTYREISSCSNFEAFQARRANIRFRREPNGKPEHVHTLNGSGLAIGRTVAAILENYQQEDGTIIIPEVLRPYMGGKTV. 422
3 -128.000IDP05251 gene: serS; seryl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo2747 [Listeria monocytogenes EGD-e]  ali follow..  42  1MLDVKLLRNNFDEVKQKLQNRGEDLGEFEKFGELDKRRRTLIVETEALKSQRNEVSQEIAEKQDADAKIEEMRVVGDRIKTLDIELREIDEKLDMILMSIPNIPHESTPVGESEDDNVEIRKWGEVRAFDFEPKAHWDLGTDLDILDFENAAKVTGSRFVFYKKLGARLERALINFMMDLHEHGYEEMLPPYMVNRASMTGTGQLPKFEEDAFLIEAEDYFLIPTAEVPVTNYHREDILKAEDLPRKYTAFSACFRSEAGSAGRDTRGLIRQHQFNKVELVQFVKPEDSYVALEKLTGNAEEVLRRLELPYRVLSMCTADLGFTAAKKYDLEVWIPSYNSYREISSCSNFESFQARRANIRFRREPGSKPEYVHTLNGSGLALGRTVAAILENYQDADGSVRIPKVLQGYMGGIEK. 422
4 -128.000IDP06149 gene: serS; seryl-tRNA synthetase [Helicobacter pylori J99] NP_224091 [Helicobacter pylori J99]  ali follow..  40  1MIDRKLLLQDFDKVALSLKKRNHAMDELERLREAIAHYKKQLIELEGLQAFQNKVSKEFGQKMDTSDLKKELENNKIKLNELSKSVGEAEQEMDLKLSIIPNLVDEKTPLGASEEDNIEIKKILTPRNFTFKPKEHFELAQQNGWIDFESGVKLAKSRFSVIRGFGAKIYRALIHLMLDFNKNGFEIIYTPALVNEKMLFGTGQLPKFKEDVFKIENENLYLIPTAEVTLTNLYNDTIISVENLPIKMTAHTPCFRSEAGSAGKDTRGMIRQHQFDKVELVAITHPKESDAMQEHMLESASEILKALELPHRFVQLCSGDLGFSASNTIDIEVWLPGQNCYREISSVSNTRDFQARRAKIRFKENQKNQ--LVHTLNGSSLAVGRTMVALMENHQQADGSIHIPKALEKYL...... 415
5 -127.000IDP06304 seryl-tRNA synthetase [Streptococcus pneumoniae TIGR4] NP_344934 [Streptococcus pneumoniae TIGR4]  ali follow..  42  1MLDIKRIRTDFEAVAEKLATRGVDAAVLNEMKEIDAKRRNILVKVETLKAERNTVSAEIANKENTDDKIAAMQNLSAEVKALDAELAEIDAKLTEFTTTLPNIPADSVPVGADEDDNVEVRRWGTPREFDFEPKAHWDLGEDLGILDWERGGKVTGARFLFYKGLGARLERAIYNFMLDEHKEGYTEVITPYIVNHDSMFGTGQYPKFKEDTFELSDTNFVLIPTAEVPLTNYYRDEILDGKDLPIYFTAMSPSFRSEAGSAGRDTRGLIRLHQFHKVEMVKFAKPEESYEELEKMTANAENILQKLNLPYRVVALSTGDMGFSAAKTYDLEVWIPAQNNYREISSCSNTEDFQARRAQIRYRDEADGKVKLLHTLNGSGLAVGRTVAAILENYQNEDGSVTIPEALRPYMGGAEV. 421
6 -126.000IDP05331 gene: serS; seryl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL0009 [Staphylococcus aureus subsp. aureus COL]  ali follow..  41  1MLDIRLFRNEPDTVKSKIELRGDDPKVVDEILELDEQRRKLISATEEMKARRNKVSEEIANKENADDVIAEMRTLGDDIKEKDSQLNEIDNKMTGILCRIPNLISDDVPQGESDEDNVEVKKWGTPREFSFEPKAHWDIVEELKMADFDRAAKVSGARFVYLTNEGAQLERALMNYMITKHQHGYTEMMVPQLVNADTMYGTGQLPKFEEDLFKVEKEGLYTIPTAEVPLTNFYRNEIIQPGVLPEKFTGQSACFRSEAGSAGRDTRGLIRLHQFDKVEMVRFEQPEDSWNALEEMTTNAEAILEELGLPYRRVILCTGDIGFSASKTYDLEVWLPSYNDYKEISSCSNCTDFQARRANIRFKRDKAAKPELAHTLNGSGLAVGRTFAAIVENYQNEDGTVTIPEALVPFMGGKTQ. 422
7 -124.000IDP90871 seryl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VC1110 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  37  1MLDSKLLRTELDETAAKLARRGFKLD-VETIRTLEEQRKSIQVEVENLQSTRNSISKQIGDKAGAEAVKQQIGTLGDDLDAKKVELDAVMAQLDAITQTVPNIPDDAVPNGKDDSENVEVSRWGTPKTYDFEVKDHVDLGEMGDGLDFASATKITGARFVVMKGQFARLHRAIAQFMLDLHQHGYTELYVPYLVNAETLFGTGQLPKFGQDLFHTEPRRLSLIPTAEVPVTNLVRDTILDEAELPLKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVELVQITRPEDSMAALEELTGHAEKVLQLLELPYRKVILCTGDMGFGSCKTYDLEVWVPAQKTYREISSCSNMWDFQARRMQARFRRKGEKKPELVHTLNGSGLAVGRTMVAILENYQEADGRIAIPAVLQKYMGGLTH. 433
8 -123.000IDP90923 gene: serS; seryl-tRNA synthetase [Salmonella typhimurium LT2] STM0963 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  38  1MLDPNLLRNEPDAVAEKLARRGFKLD-VDKLRALEERRKVLQVNTENLQAERNSRSKSIGRGEDIEPLRLEVNKLGEELDAAKAELDTLLAEIRDIALTIPNLPADEVPVGKDENDNVEVSRWGTPREFDFEIRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQFMLDLHQHGYSENYVPYLVNHDTLYGTGQLPKFAGDLFHTDSSNYALIPTAEVPLTNLVRDEIIDEDQLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRPEDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWVPAQNTYREISSCSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEVLRPYMNGLEY. 428
9 -122.000IDP90714 gene: serS; seryl-tRNA synthetase [Yersinia pestis CO92] YPO1379 [Yersinia pestis CO92]  ali follow..  40  1MLDPNMLRNELDAVAEKLARRGFKLD-VEVLRQQEERRKVLQVETESLQAERNSRSKQIGRGEDIEPLRLEVNALGEKLDAAKAELDKLQNEIRDLALSIPNLPDDSVPVGKNENDNIEVSRWGEPRKYDFDVKDHVSLGEMAGGLDFAAAVKLTGARFVVMKGQIARMHRALSQFMLDLHKHGYLEAYVPYLVNHATLYGTGQLPKFGEDLFHTDNSNYALIPTAEVPLTNLVRDEILEEDSLPLKLTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQITRPEDSMAALEELTGHAEKVLQLLELPYRKVLLCTGDMGFGSSKTYDLEVWLPAQDTYREISSCSNMWDFQARRMQARYRNKTDRKTRLVHTLNGSGLAVGRTLVAVLENYQQADGRIQVPDVLRPYMGGLEY. 428
10 -122.000IDP90835 gene: serS; seryl-tRNA synthetase [Shigella flexneri 2a str. 2457T] S0893 [Shigella flexneri 2a str. 2457T]  ali follow..  38  1MLDPNLLRNEPDAVAEKLARRGFKLD-VDKLGALEERRKVLQVKTENLQAERNSRSKSIGRGEDIEPLRLEVNKLGEELDAAKAELDALQAEIRDIALTIPNLPADEVPVGKDENDNVEVSRWGTPREFDFEVRDHVTLGEMHSGLDFAAAVKLTGSRFVVMKGQIARMHRALSQFMLDLHQHGYSENYVPYLVNQDTLYGTGQLPKFAGDLFHTDTSNYALIPTAEVPLTNLVRGEIIDEDDLPIKMTAHTPCFRSEAGSYGRDTRGLIRMHQFDKVEMVQIVRPEDSMAALEEMTGHAEKVLQLLGLPYRKIILCTGDMGFGACKTYDLEVWIPAQNTYREISSCSNVWDFQARRMQARCRSKSDKKTRLVHTLNGSGLAVGRTLVAVMENYQQADGRIEVPEVLRPYMNGLEY. 428
11 -19.200IDP92033 prolyl-tRNA synthetase, putative [Toxoplasma gondii ME49] TGME49_019850 [Toxoplasma gondii ME49]  ali follow..  15  227.......................................................................................................................................YTQAIVRSEMIEY---YDISG--CYIMRPWAFHIWEKVQRFFDDEIKKGVENSYFPMFVSRHKLKEKDHVEGFSPEVAWVTHEKIAIRPTSETIMYPAYAKWIRSHRDLPLKLNQWCSVVRWEF----KQPTPFLRTREFLWQEGHTAATEEEAWELVLDILELYRRWYEECLAVPVIKGEKSEGEKFAGKKTTTVEAFIPENGRGIQAATSHLLGTNFAKMFEIEFEDEEGHKRLVHQTSWGCTT---RSLGVMIMTHGDDKG-LVIPPRVASV....... 499
12 -18.600IDP90551 prolyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VC0875 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  32.......................................................................................................................................................IRKLASGLYTWLPTGLRVLRKVENIVRQEIDNGAIETLMPVVQPFELWEETGRSEKMGPELLRFTDRPFVLSPTAEEVITALVRNEVSSYKQLPLNLYQIQTKFRDER----RPRFGVMRAREFCMMDAYSFIDKAGLEKSYEAMHVAYCKAFDRMGLDYRPVLADTGAIGGNGSH----EFHVLAESGEDLIAFSTES-DYAANIEKAEAVAPAIERPAPTQAMTLVDTPNAKTIAELVE......................... 268
13 -18.600IDP90581 gene: proS; prolyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0543 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  19  33.......................................................................................................................................................VEQIGSGLYNFLPLGKRVLDKIKNIVKEEMDKGAQEVNLSFITPASLWQESGRYNVFGKELLRFKDNEFVLGPTHEEAMLSLVKNKITSYKQLPLHLYQIGLKFRDEA----RPRFGLLRCREFLMKDGYSFANEEDLGREFELMYKTYSQILQRMGLDFRAVEADSGAIGGSGSKEFMVLA---GEDDILICENCDYAANVEAAKRAKKTCQDERPEANYASKFHTPNIKTIDSLAQFFK......................... 273
14 -18.600IDP05650 gene: proS; hypothetical protein Cj0539 [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0543 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  19  33.......................................................................................................................................................VEQIGSGLYNFLPLGKRVLDKIKNIVKEEMDKGAQEVNLSFITPASLWQESGRYNVFGKELLRFKDNEFVLGPTHEEAMLSLVKNKITSYKQLPLHLYQIGLKFRDEA----RPRFGLLRCREFLMKDGYSFANEEDLGREFELMYKTYSQILQRMGLDFRAVEADSGAIGGSGSKEFMVLA---GEDDILICENCDYAANVEAAKRAKKTCQDERPEANYASKFHTPNIKTIDSLAQFFK......................... 273
15 -18.500IDP90927 gene: proS; prolyl-tRNA synthetase [Yersinia pestis CO92] YPO1068 [Yersinia pestis CO92]  ali follow..  17  32.......................................................................................................................................................IRKLASGLYTWLPTGVRVLKKVENIVREEMNNGAIEVSMPVVQPADLWQESGRWEQYGPELLRFVDRPFVLGPTHEEVITDLIRGEINSYKQLPLNFFQIQTKFRDEV----RPRFGVMRAREFLMKDAYSFTTQESLQETYDAMYTAYSKIFSRMDLNFRAVLADTGSIGGSASHEF-----VLAESGEDDIVFSTGS-DYAANIEFAEALAPTEPRAPATEELRIVDTPNAKTIAELVE......................... 268
16 -18.400IDP05337 gene: proS; prolyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1282 [Staphylococcus aureus subsp. aureus COL]  ali follow..  13  32.......................................................................................................................................................IKQSTSGIYSYLPLATRVLNNITAIVRQEMERDSVEILMPALQQAELWEESGRWGAYGPELMRLQDRQFALGPTHEELVTSIVRNELKSYKQLPMTLFQIQSKFRDEK----RPRFGLLRGREFIMKDAYSFADEASLDQTYQDMYQAYSRIFERVGINARPVVADSGAIGGSHTHEFMALS---GEDTIVYSKESDYAANIEKAEVVYEPNHKHTTVQPLEKIETPNVKTAQEL............................... 266
17 -18.300IDP05230 gene: proS; prolyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1319 [Listeria monocytogenes EGD-e]  ali follow..  16  32.......................................................................................................................................................IRQTASGIYSYLPLATLMLRKIETIIREELEAGAAELLMPALQPAELWQESGRWNDYGPELMRLKDRDFALGPTHEEVITALLRDEVKSYKRLPLTLYQIQTKFRDEK----RPRFGLLRGREFIMKDAYSFATSESLDEVYNLMHQAYSNIFTRCGLEFRSVIADSGSIGGNESKEFMA----LSDIGEDTIAYSDAS-DYAANTEMAPVLYMEKKSHELEKDLEKVATPDQKSITDIVGFLEVPIEKT................ 277
18 -17.900IDP04603 prolyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS3670 [Bacillus anthracis str. Sterne]  ali follow..  13  32.......................................................................................................................................................MRQNASGIYSFLPFGLKVLHKVERIVREEMERGAVELLMPAMQAAELWQESGRWYSYGSELMRMKDREFALGATHEEVITDLVRDEVKSYKKLPLTLYQIQTKFRDEQ----RPRFGLLRGREFLMKDAYSFATQESLDEVYDRLYKAYSNIFARCGLNFRAVIADSGAMGGKDTHEFMVLS---GEDTIAYSDTSDYAANIEM.............................................................. 235
19 -17.400IDP05080 gene: thrS; threonyl-tRNA synthetase [Listeria monocytogenes EGD-e] lmo1559 [Listeria monocytogenes EGD-e]  ali follow..  17  236.................................................................................................................................EAKERDHRKLGKELELFTNS---IEVGQGLPLWLPKGATIRRVIERYIVDKERLGYNHVYTPIMANVELYKTSGHWDHYHEDMFPTMKMDNEELVLRPMNCPHIYKNDIHSYRELPIRIAELGMMHRYEMSG---ALSGLQRVRGMTLNDAHVFVRPDQIKDEFKRVVELILEVYKDFDITDYSFRLSYRDPKNTEKYFDDDAMWEKAQAMLKSAMDEMEMDDFLPERFDLTYIGEDGEKHRPVVIHRGVVSTMERFVAYLIEEYKGA-----FPTWLAP........ 543
20 -17.300IDP05140 prolyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS0382 [Bacillus anthracis str. Sterne]  ali follow..  16  18.....................................................................................................................................QWYTDIVKKAELVDYS-----SVKGCMILRPYGYALWENMQKVMDEKLKAGHENVYMPMFIPESLLQKEDHVEGFAPEVAWVLAERLCVRPTSETLFCEHFSKIVQSYNDLPKLYNQWCSVVRWE-----KTTRPFLRTTEFLWQEGHTIHETAEEQAETLNILNLYASFCEDYLAPVIKGQKTEKEKFAGAKATYTIESLMHDGKA--QTGTSHNFGTNFSEAFDIKFLDRNGKWQYVHQTSWGVS---TRMIGGLIMVHSDNNGLV-MPPKVAPV....... 290
21 -17.100IDP06315 gene: thrS; threonyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] NP_346071 [Streptococcus pneumoniae TIGR4]  ali follow..  17  237.................................................................................................................................EAKERDHRKLGKELDLFMIS---QEVGQGLPFWLPNGATIRRELERYIVNKEVSGYQHVYTPPLASVELYKTSGHWDHYQEDMFPTDGEEFVLRPMNCPHHIQVFKHHVHSYRELPIRIAEIGMMHRYEKSG---ALTGLQRVREMSLNDGHLFVTPEQIQEEFQRALQLIIDVYEDFNLTDYRFRLSLRDPQDTHKYFDNDEMWENAQTMLRAALDEMGVDDFLPERFDLKYIGADGEDHRPVMIHRGVISTMERFTAILIENYKGA-----FPTWLAP........ 545
22 -17.000IDP06242 prolyl-tRNA synthetase [Streptococcus pneumoniae TIGR4] NP_344802 [Streptococcus pneumoniae TIGR4]  ali follow..  17  33........................................................................................................................................................RQVSAGVYSYLPLANRVIEKAKNIMRQEFEKGAVEMLAPALLSAELWRESGRYETYGEDLYKLKNSDFILGPTHEETFTAIVRDSVKSYKQLPLNLYQIQPKYRDEK----RPRNGLLRTREFIMKDAYSFHANYDSDSVYDEYKAAYERIFTRSGLDFKAIIGDGGAMGGKDSQEFMAIT.................................................................................... 214
23 -16.500IDP05712 threonyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4472 [Bacillus anthracis str. Sterne]  ali follow..  19  242.................................................................................................................................EAKERDHRKLGKELKLFTNSQKV---GQGLPLWLPKGATIRRIIERYIVDKESLGYDHVYTPVLGSRELYETSGHWNHYRDGMFEMDNEELVLRPMNCPHHMMVYKNDIHSYRELPIRIAELGTMHRYEMSG---ALSGLQRVRGMTLNDAHIFVRPDQIKEELKRVVNLTLEVYKDFGLENYSFRLSYRDPEDTKKYYADDEMWEKAQGMLKEAMDEMGLDDFLPERFELSYVGEDGKQHRPVVIHRGVVSTMERFVAFLIEEYKGA-----FPTWLAP........ 549
24 -16.300IDP90668 gene: thrS; threonyl-tRNA synthetase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0206 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  84............................EDLVKIEKKMKELAEAKIEISKYEITKSEALAKFQNDDLKQEVLLRIPDRAVSIYKQGEFEDLCRGPHVPNTKFLRFFKL---GDEKREMLTRIYGTTIIEEAKKRDHRKLGTELKLFTFDDEI---GGGLPIWLSNGARLRSKLEHMLYKIHLRGYEPVRGPELLKADAWKISGHYANYKENMYQIDEQEYGIKPMNCVGHIKIYQSDVRSYRDLPLKFFEYGVVHRHEKSG---VLHGLFRVREFTQDDAHIFCMPSQIKEQVLEILAFVDNLMKLFDFSYEMEISTKPEKAIG-----DDEIWEIATKALKEALDEQGLKDFNPSRFKLEYTDSDNEKKQPVMLHRAILGSFERFIGILTEHCAGE-----FPFFIAP........ 504
25 -16.100IDP90770 gene: thrS; threonyl-tRNA synthetase [Yersinia pestis CO92] YPO2433 [Yersinia pestis CO92]  ali follow..  13  115............................EDLALLEKRMHELADKDYDVIKKKVSWQEARDTFAARGEDYK--VAILDENISRDDRPGLYHHEEYVDMCRGPHVPNMRFCHHGDSKNKMLQRIYGTQRLEEAAKRDHRKIGKQLDLYHMQE----EAPGMVFWHNDGWTIFRELETFVRMKLEYQYQEVKGPFMMDRVLWEKTGHWENYAEHMFSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEFGSCHRNEPSG---ALHGLMRVRGFTQDDAHVFCTEEQVRDEVNSCIKMVYDMYSTFGFEKIVVKLSTRPEKRIG----SDELWTRAEDDLAAALTENGIPDFSPGRLSASYIGENNDRQVPVMIHRAILGSMERFIGILTEEYAGF-----FPTWLAP........ 539
26 -15.600IDP90813 threonyl-tRNA synthetase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0287 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  239.................................................................................................................................EAAKRDHRKIGKQLDLFHMQQ----EAPGMVFWHHNGWSIFRDLEIFIRQKLEYGYQEVKGPLMMDRVLWERSGHWDKYADAMFSSENREYAIKPMNCPGHIQIFNQGLKSYRDLPLRMAEFGSCHRNEPSG---SLHGIMRVRGFTQDDAHIFCTEDQIQQEVTSCIKMVYDTYTTFGFQNIVVKLSTRPEKRVG----SDEIWDKSEQALIDSLKAMDIPDFNPTRLGATYVGESNERLIPVMIHRAILGSLERFIGILIEEYAGF-----FPTWLAP........ 540
27 -15.400IDP05335 threonyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS2222 [Bacillus anthracis str. Sterne]  ali follow..  19  241.................................................................................................................................EAAKRNHRKLGNELELFMFSE----EAPGMPFYLPKGQIIRNELEAFLREIQEYNYQEVRTPFMMNQEVWERSGHWGHYKDNMYEVDNKSFALKPMNCPGHMLMFKNKLHSYRELPIRMCEFGQVHRHEFSG---ALNGLLRVRTFCQDDAHLFVTPEQIEDEIKSVMAQIDYVYKTFGFEYEVELSTRPEDSMG-----DDELWEQAEASLENVLQSLNYKDFQPEKFDLNYIDEKNEKRRPVVIHRAVLGSLDRFLAILIEHFGGA-----FPAWVAP........ 541
28 -15.100IDP06155 gene: thrS; threonyl-tRNA synthetase [Helicobacter pylori J99] NP_222834 [Helicobacter pylori J99]  ali follow..  19  213.................................................................................................................................EAKKRDHRKLGVELGLFSFDDEI---GAGLPLWLPKGARLRKRIEDLLSQALLRGYEPVKGPEILKSDVWKISGHYDNYKENMYTIDEQEYGIKPMNCVGHIKVYQSALHSYRDLPLRFYEYGVVHRHEKSG---VLHGLLRVREFTQDDAHIFCSFEQIQSEVSAILDFTHKIMQAFGFSYEMELSTRPAKSIG-----DDKVWEKATNALKEALKEHRIDDMNPERFKLAFTNEYNHAEQPVMIHRAILGSFERFIAILSEHFGGN-----FPFFVAP........ 514
29 -14.600IDP05146 glycyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS4784 [Bacillus anthracis str. Sterne]  ali follow..  19  128.......................................................................................................................................................................................KEHEVKCPDCGSEEFTEIRQFNLMFKTFQGVTESSTNEIF-TAQGIFVNFKNVQRSMRKKLPFGIGQIGKSFRNEITP----GNFTFRTREFEQMELEFFCKPGEDLEWFAFWRETCKNWLLSLGMTMRLRDHGEEELSHYSNATTDIEFKFP---GWGELWGVASRTDFDLKRHMFNYIDPQTNERYVPYCIEPSL-GADRVTLAFLCDAYEEE-VLRFHPALAPY....... 366
30 -14.400IDP05339 gene: glyS; glycyl-tRNA synthetase [Staphylococcus aureus subsp. aureus COL] SACOL1622 [Staphylococcus aureus subsp. aureus COL]  ali follow..  20  131.......................................................................................................................................................................................DDEGIVCPVSKTANWTEIRQFNLMFKTFQGVTEDSTIFLRPTAQGIFVNYKNVQRSMRKKLPFGIGQIGKSFRNEITP----GNFIFRTREFEQMELEFFCKPGEEIEWQNYWKTFASDWLTSLNMSMRLRDHDEDELSHYSNATTDIEYKFP---GWGELWGIASRTDFDLRKHAFRYHDPETNEKYIPYCIEPSL-GADRVTLAFLCDAYDEEGVLHFHPALAPY....... 371
31 -13.900IDP92018 threonyl-tRNA synthetase, putative [Toxoplasma gondii ME49] TGME49_100260 [Toxoplasma gondii ME49]  ali follow..  16  269..................................EESYGRLEAAAAAVIKEDQAFRRLVCSKAEALELFADNPFKVQLIASKIPEHGLTTVYCCGSLVDLPHIPSTGK---GRQHLDSLQRVYGVKLLEEAKKRDHRVLGQNLHLFFFD---TNVSPGSCFWLPDGAKVYNKLCMFMREEYFRGFQEVISPNIFSCDLWKVSGHYQNYKENMYDVEGKEWGLKPMNCPGHCIMFKHLAPSYRQLPLRLADFGVLHRNELSG---SLTGLTRVRRFQQDDAHIFCRLDQVKEEVADALNFLFFVYDQFGFSFELFLSTRPKLG-------ERAVWDSAEAALKAALEETGRPDFQPIRFNLQYRTQDEAVAGIIH--RAILGSIERMCAVVIEHTGGK-----LPFWLSP........ 732

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.