current user: public

If you have questions about the server, please let us know.

Query: gi|12044856|ref|NP_072666.1| thymidylate kinase (MG_006) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MNKGVFVVIEGVDGAGKTALIEGFKKLYPTKFLNYQLTYTREPGGTLLAEKIRQLLLNETMEPLTEAYLFAAARTEHISKLIKPAIEKEQLVISDRFVFSSFAYQGLSKKIGIDTVKQINHHALRNMMPNFTFILDCNFKEALQRMQKRGNDNLLDEFIKGKNDFDTVRSYYLSLVDKKNCFLINGDNKQEHLEKFIELLTRCLQQPTHYLast
1 -86.100IDP90611 gene: tmk; thymidylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC2016 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  32  2..NAKFIVIEGLEGAGKSTAIQVVVETLQQNGID-HITRTREPGGTLLAEKLRALVKEEHLQDITELLLVYAARVQLVENVIKPALARGEWVVGDRHDMSSQAYQGGGRQIAPSTMQSLKQTALGDFKPDLTLYLDIDPKLGLERARGRGE---LDRIEMDISFFERARERYLELANSDSVVMIDAAQSIEQVTADIRRALQDWLSQVN. 210
2 -76.000IDP90678 gene: tdk; thymidylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0766c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  28  1....MYVVFEGIDCVGKSTQISLLKEIYK------DAIFTLEPGGTELGKHLREILLNKTINKRAELLLFLADRAQHFEEILKTN--QNKLIISDRSFISGMAYA---KDFENDLLFALNSFALENFFPQKIIFLKGDANLIQERLSQKE----LDSIERGIEYFLSVQDKLEKVLHSVEILTLDAKESKEKLHQQIKEFLQ........ 192
3 -65.600IDP92081 thymidylate kinase, putative [Toxoplasma gondii ME49] TGME49_106970 [Toxoplasma gondii ME49]  ali follow..  20  7.KRGCLVVFEGIDRSGKSTQARLAYERLTKE--GHAAELIRFPDTTPIGQVLDRFLANAVPPPQLTHLLFAANRWEAQ-ARILRALGEGRTVLVDRYSFSGIAYTVGAAPSVAETATFCRESERGLLAPDAVFFLDVAPQETQKRGGYGD-----EVYEK-LATQERVYQVYRQFDNPYWRRIAASSLSIEELHEKLFEQLKSVIEATQ. 251
4 -24.000IDP05086 deoxynucleoside kinase family protein [Bacillus anthracis str. Ames] BA_0014 [Bacillus anthracis str. Ames]  ali follow..  13  9IPNDAVITIAGTVGVGKSTMTTALANALGYR-------TSFEK--VDSNPYLDKFYADFTRWSFHLQVYFLAERFKEQKRI----FEYGGGFVQDRSIYEDTGIKGTMTETDYETYKGLFDAMVMTPHPDLLIYLEGSFDDIVDRIQERGRPMEQQTPIEYWKEMHGRYENWINNFNSCPVLRLNINEKDGDSIEPIIKKIGHFLKQTRK 219
5 -16.800IDP02084 gene: adk; adenylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0639c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  5......FLIIGAPGSGKTTDASLIAQAITHYSTG-DLLRAEVASGSELGKTIDSFISKGNLVP-----------LDVVINTIVYALKAAP--------TKTIIIDGYPRSVEQMMEFDKVLSEQNEICLKGVIEVRVSEEVAKERVLGRNRDDNEEVFYNRMKVYTEPLNEILDYQKKKLHFIIDGERTIEPIVADMKELIKKIQS.... 191
6 -14.800IDP06058 gene: coaE; dephospho-CoA kinase [Helicobacter pylori J99] NP_223488 [Helicobacter pylori J99]  ali follow..  11  1MILKNAIALTGGIGTGKSTTLKILESQLDADKIAHQLL---QEHRLEIAQRFGSDILEKNRKKLGAIVFQNANELKWLEDFLHPLIRE-------CMLKKACELEKNHQAYFLDIPLFFEVGGKKRYPVSRVVLIYAPRALQIERLLERDKAEILQRLACQMDIEQKRAMS----------YIIDNSSSLKDLNKQVERFLKTLL..... 196
7 -14.600IDP06247 gene: adk; adenylate kinase [Streptococcus pneumoniae TIGR4] NP_344771 [Streptococcus pneumoniae TIGR4]  ali follow..  12  3......LLIMGLPGAGKGTQAAKIVEQFHVAHISTDMFRAAMANQTEMGVLAKSYIDKGELVP------------EVTNGIVKERLSQDDI------KETGFLLDGYPRTIEQAHALD-KTLAELGIELEGVINIEVNPDSLLERLSGRREDDKPETVKRRLDVNIAQGEPIIAHYRAKGLVHIEGNQDINDVFSDIEKVLTNL...... 211
8 -14.100IDP90539 gene: gmk; guanylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC2708 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  23MGKGTLYIVSAPSGAGKSSLIAALLEQNPTYAMKVSVHTTRGMRPGEQDEHFIELIGKGEFLEYAEVFYYGTSRVW-----IENTLNKGIDVFLD------IDWQGARQ--------------IRSQMPEAKSIFILPPSKEERRLNTRGQ-------DSDAVIAKRMGEAKSEISHYSEYDYVIINDDFDVALMDFKAIIRA....... 207
9 -14.000IDP92034 adenylate kinase, putative [Toxoplasma gondii ME49] TGME49_024900 [Toxoplasma gondii ME49]  ali follow..  12  34.KPEGRYIFIGAPGSGKGTQSVKLKKSHCLCHLSTDMLRHAVATGTEYGKQAKAKLDAGELVS------------EIVLGLIDEKLKTPE-------CRRGFILDGFPRNEAQAAGLD-NLLKQKNQKLDGVLYFDVPDNILVERVSGRRKDDNEATLKKRLDVFHKETVPVIEHYAKMGLLYMDAAKDSTAVTKEMYDFVGKHHKSF.. 255
10 -13.800IDP01471 phosphoribulokinase VC2613 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  3.AKHPIIAVTGSSGAGTTTTSEAFRKMFNMMSIKPAWVEGDSFHRFTRPEMDVEIRKAREQGRHISYFGPQANDFPTLEEFFR-QYGKVGTGQVRRYLHTFDEAVPYNQMPGTSLPENSDVLFYEGLHGDFLIGMVPIVNLEWIQKYVRDTRDRGHSREAVMDSIVRSMDDYLKFITPQF-INFQRVPTVDTSNPLNAKGIPTLDESF.. 229
11 -13.800IDP04119 adenylate kinase [Bacillus anthracis str. Sterne] BAS0131 [Bacillus anthracis str. Sterne]  ali follow..  12  3......LILMGLPGAGKGTQAEQIVAKYNIPHISTDMFRAAMKAETEMGLQAKSFIDKGALVP------------EVTIGIVRERLSQED-------CVRGFLLDGFPRTVAQASALE-EIMKDLGKKIDYVLNINVDSGLLLKRLTGRRSDDNEETVANRLDVNIKQTKPLLDFYEELGYLQINGEQDINKVFADIDVLIGGL...... 215
12 -13.700IDP02287 gene: adk; adenylate kinase [Francisella tularensis subsp. tularensis SCHU S4] FTT1161 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  16  3......IILLGAPGAGKGTQAKIIEQKYNIAHISTDMIRETIKSGSALGQELKKVLDAGELVS------------EFIIKIVKDRISKND-------CNNGFLLDGVPR-----TIPQAQELDKLGVNIDYIVEVDVADNLLIERITGRRGEPLITRTDDNEDTVKQRLSVYHAQTAKPKYIKINGDQAVEKVSQDIFDQLNK....... 217
13 -13.700IDP05129 gene: adk; adenylate kinase [Clostridium difficile 630] CD0091 [Peptoclostridium difficile 630]  ali follow..  13  3.MDNMRIILLGPPGAGKGTQAVGIVEKYNIPHISTDIFRKNIKEGTELGKKAKEYMDQGLLVP------------ELTVGLVTDRISQED-------CKNGFMLDGFPRNVAQGEHLD-IFLKNAGISLDKVVNIEVDKSILVSRAVGRRADDNEETVSKRIQVYLDETKPLVDYYSKQGIIAIKGDQAIDKVFEDIVAALGS....... 219
14 -13.600IDP06283 gene: gmk; guanylate kinase [Streptococcus pneumoniae TIGR4] NP_346174 [Streptococcus pneumoniae TIGR4]  ali follow..  12  3.DRGLLIVFSGPSGVGKGTVRREIFESSENQFQYSVSMTTRAQRPGEVDEEFEELIRQGQM---LEYAEYVGNYYGTPLTYVNETLDKGIDVFLE------IEVQGALQ--------------VKKKVPDAVFIFLTPPDLDEDRLVGRGT-------DSAEVIAQRIEKAKEEIALMREYDYAIVNDQVPLAAERVKCVIEA....... 185
15 -13.500IDP02139 gene: gmk; guanylate kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4009 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  14  4.RRGLLIVLSGPSGVGKGTVRKELFSHEDTRFQYSISVTTRKPREGEVDEEFEEMIRNEKL---LEWAEFVGNYYGTPIDYVEKTLQEGKDVFLE------IEVQGAIQ--------------VKKAFPEGVFIFLAPPSLSENRIVGRGT-------ETEDVIENRLTVAKEEIDMMDAYDYVVENDQVELACERIKAIVVG....... 186
16 -13.500IDP01611 gene: gmk; hypothetical protein lmo1827 [Listeria monocytogenes EGD-e] lmo1827 [Listeria monocytogenes EGD-e]  ali follow..  15  3.ERGLLIVLSGPSGVGKGTVREAVFKDPETSFDYSISMTTRLPREGEQDEVFEQAIKDGKM---LEYAEYVGNYYGTPLEYVEEKLAAGVDIFLE------IEVQGAMQ--------------VRKAMPEGIFIFLTPPDLSENRIIGRGT-------ESMEVVEERMETAKKEIEMMASYDYAVVNDVVANAVQKIKGIVET....... 185
17 -13.400IDP91820 gene: adk; adenylate kinase [Escherichia coli str. K-12 substr. MG1655] b0474 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  12  3......IILLGAPGAGKGTQAQFIMEKYGIPQISTDMLRAAVKSGSELGKQAKDIMDAGKLVT------------ELVIALVKERIAQED-------CRNGFLLDGFPR-----TIPQADAMKEAGINVDYVLEFDVPDELIVDRIVGRRGEELTTRKDDQEETVRKRLVEYHQMTAPTKYAKVDGTKPVAEVRADLEKILG........ 214
18 -13.400IDP02096 gene: prk; phosphoribulokinase 1 [Yersinia pestis CO92] YPO0178 [Yersinia pestis CO92]  ali follow..  3.TKHPVIAVTGSSGAGTTTTSLAFRKIFQQLDIRAAQIEGDSFHRYTRPEMDAAIRKARDQGRHISYFGPEANDFGQLEQSVA-EYSKHGTGRSRKYLHTYDEAVPYNQIPGTPLPEPTDVLFYEGLHGDLLVGVVPIVNLEWIQKLVRDTGERGHSREAVMDSVVRSMDDYINYITPQF-INFQRVPTVDTSNPFAAKAIPSLDESF.. 229
19 -13.400IDP00480 gene: adk; adenylate kinase YPO3118 [Yersinia pestis CO92]  ali follow..  12  3......IILLGAPGAGKGTQAQFIMEKYGIPQISTDMLRAAVKAGSELGLKAKEIMDAGKLVT------------ELVIALVKERITQED-------CRDGFLLDGFPR-----TIPQADAMKEAGIKVDYVLEFDVPDELIVERIVGRRGEELTIRKDDQEATVRKRLIEYHQQTAPTQYFKLDGTRNVAEVSAELATILG........ 214
20 -13.300IDP01891 gene: prkB; putative phosphoribulokinase [Salmonella typhimurium LT2] STM3464 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  3.AKHPVIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEVEGDSFHRYTRPEMDMAIRKARDAGRHISYFGPEANDFSLLEHTFI-EYGQTGKGQSRKYLHTYDEAVPWNQVPGTPLPEPTDVLFYEGLHGDLLVGVVPIVNLEWIQKLIRDTSERGHSREAVMDSVVRSMDDYINYITPQF-INFQRVPTVDTSNPFAAKGIPSLDES... 228
21 -13.300IDP90623 gene: gmk; guanylate kinase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1177c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  3.LQGFVLLISGPSGAGKSTLLKKLFDEFEDELYFSISSTTRKPREGEKNGIHYHFISHEEFQKGIEWARVHENFYGTSLKHTQNALDNGKIVVFD---------------IDVQGFKIARKKMADKIV--SVFITTKNKDELKKRLIKRNT-------DTIIQLEKRLQNASDEMKELSEYDYLIINDELKQSYEALRAILIA....... 186
22 -13.300IDP04500 gene: adk; adenylate kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC0986 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  3......IILLGAPGAGKGTQAQFIMEKFGIPQISTDMLRAAIKAGTELGKQAKAVIDAGQLVS------------DIILGLIKERIAQAD-------CEKGFLLDGFPR-----TIPQADGLKEMGINVDYVIEFDVADDVIVERMAGRRGEDLVIREDDKEETVRARLNVYHTQTAPTQYLKFDGTKQVSEVSADIAKALA........ 214
23 -13.200IDP01835 gene: coaE; dephospho-CoA kinase [Coxiella burnetii RSA 493] CBU_0152 [Coxiella burnetii RSA 493]  ali follow..  11  2....LRIGLTGGIGSGKSTVANYFAELIDADQIAHEITKPDQAAFKQIINHFGNAVLTKG-TKLRELIFENPDDRQWLENLLHPLIIAKMKTQLKKIKAPYCILA----------IPLLAEASQSVDFIDRILVVDAPETLQIQRTKSRDQLSDQQILQSQSPREKRLAIA----------DVIVNDQTIPILRKAVFQLHCKYLQIAQ. 198
24 -13.000IDP06121 gene: gmk; guanylate kinase [Helicobacter pylori J99] NP_223024 [Helicobacter pylori J99]  ali follow..  15  3.NDFNLLILSGPSGAGKSTLTKYLQEKIPKTHFSLST-TTRKPREGEVDGLHYNFVSEEEFKQGLEWAIVHNHYYGTSKIPVEKALKEGKIVIFD------IDVQGHEI--------------LKKHYPNACSVFISTKNQEIERLLLRGT-------DSKETIEKRLINAYKEMQCLESFDYLIINEDLEKSKEIILSIAKTLVHRLK. 190
25 -12.900IDP02800 gene: coaE; dephospho-CoA kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4828 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  12  3....VVIGLTGGIASGKSTVSQMFRELIDADIIAREVVEKGKPAYNKIVEVFGTEVLQED-PKLGSVVFYNEEKRLQLNKIVHPAVRE-------EMNRQKEMYIKEGMQAVVLDIPLLFESKLTSLV-DRVLVVAVKPHTQLERLMKRNNFSEEERIQSQMPLEEKVKNA----------EVINNDGTIMGTKTQLQAILKKWNI.... 198
26 -12.300IDP00907 gene: coaE; dephospho-CoA kinase STM0140 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  3....YTVALTGGIGSGKSTVADAFADLIDADIIARQMVEPGQPALNAIAEHFGSELIAAD-RALRERIFSHPEEKAWLNALLHPLIQQETQRQFQQATSPYVLWV----------VPLLVENRLYQKA-NRVLVVDVTPETQLIRTMQRDDVTREHILAAQATREARLAVA----------DVIDNNGAPDAIASDVARLHASYLK.... 195
27 -12.300IDP06310 gene: coaE; dephospho-CoA kinase [Streptococcus pneumoniae TIGR4] NP_345452 [Streptococcus pneumoniae TIGR4]  ali follow..  10  3....KIIGITGGIASGKSTVTNFLRQQVDADAVVHQLQKPGGRLFEALVQHFGQEIILEN-PLLASLIFSNPDEREWSKQIQGEIIRE---------LATLREQLAQTEEIFFMDIPLLFEQDYSDWF-AETWLVYVDRDAQVERLMKRDQLSKDERLAAQWPLEKKKDLA----------QVLDNNGNQNQLLNQVHILLEGGRQDDR. 200
28 -12.000IDP04485 conserved hypothetical protein [Yersinia pestis CO92] YPO3430 [Yersinia pestis CO92]  ali follow..  11  3....YIVALTGGIGSGKSTVANAFANLVDADIIARQVVEPGTSALAAIASRYGENILQQD-AALRQKIFSEQQEKAWLNSLLHPLIQQETQRQLAGIDQPYALWV----------VPLLVENGLHHRA-DRVLVVDVTPDIQLARTMARDGITRQQILASQVSRQQRLACA----------DIIDNSGDPLMIAQHVASLHHRYLK.... 195
29 -11.900IDP90167 Shikimate kinase CD1838 [Peptoclostridium difficile 630]  ali follow..  14  9......LILIGMPGSGKTTIGKLLAKEYNCSFCDMDDYIIQISQKS-----IAELFSEGE-----------DIFRNYETQACRELSISDKTVIS----------TGGGVIKKDVNMEILKE--------GIIIFIDRPIQKILEDININSRPLLKNGKDRLYNLYNERINLYKKFSD----IEILNDKSLNNAVYNITNAVSENFK.... 171
30 -11.900IDP92045 guanylate kinase, putative [Toxoplasma gondii ME49] TGME49_042730 [Toxoplasma gondii ME49]  ali follow..  11  103.TAPRILVVAGPSGVGKGTLVKRIFAKWPQAFGFSISHTSRQPRPGETHEEFEKLKKEGHFVESAEFSCYGTSFAA-----VDNVRRGERICLLE------IDMAG------------VLQIQSTPLAQEANFVFIQPPSIEEARLRGRRT-------ENEEHIAKRLAAAQRELAKETHFDFYLTNDNLEDAWQKLEAQLVQ....... 289
31 -11.900IDP04090 gene: aroK; shikimate kinase [Clostridium perfringens ATCC 13124] CPF_0694 [Clostridium perfringens ATCC 13124]  ali follow..  18  6......VLLIGMPGAGKTTIGRDLSTVLKMNFLDMDEFIERSTG-----KEIKELFAQGE-----------EVFRDLESKSCELLSTLKNVVIS----------SGGGIVTREENMGNFKE--------FITVFINRPLDLIMEDIDTEGRPLLWDGKERLTNLYRDRIDLYKKHSD----IEIINDGTTKEAIREIVKAISEL...... 165
32 -11.400IDP00333 gene: coaE; Dephospho-CoA kinase FTT1487 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  3FINTYPIGITGGIASGKSTATRILKEKLNLNVVCADTISREITKKPSVIKKIDEIVMNKQINMLRAIITESKEAKKWLEDYLHPVINKEIKKQVKESDTVMTI-------VDIPLLGPYNFRHYDYL--KKVIVIKADLETRIRRLMERDGKNRQQFINLQISDKEREKIA--------DFVIDNTELTNQELESKLITTINEITNLTN. 204
33 -11.300IDP04177 shikimate kinase [Vibrio cholerae O1 biovar El Tor str. N16961] VC2629 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  1MAEKRNIFLVGPMGAGKSTIGRHLAQQLHMEFIDSDTVIEERTGAD-----IAWVFDVEGEEGFRKR-----------EAVINDLTEQQGIVLA----------TGGGSVISKENRNRLSARG-------IVVYLETTIEKQLARTNRDKKRPLLQTDCPREVLEQLAEDRNPLYEEIADITVRTDDQSAKVVANQIVKMLEEHI..... 173
34 -11.300IDP00856 gene: aroL; shikimate kinase II STM0388 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  10  1MMQPLYLV--GPRGCGKTTIGMALAQATGFRFADTDRWLQSHVQMS-----VADIVEKEGWGGFRA-----------RETAALEAVSAPSTVVA----------TGGGIILTEYNRRYMHRVG-------VVIYLCAPVSTLVNRLEAEPEADLKPLSEEVREVLEQRDALYRETAH----YIIDATKAPAQVVSEIIAALPPSTQRLQ. 176
35 -11.200IDP91206 shikimate kinase [Bacteroides thetaiotaomicron VPI-5482] BT_3393 [Bacteroides thetaiotaomicron VPI-5482]  ali follow..  14  4......IFLTGYMGAGKTTLGKAFARKLNVPFIDLDWYIEERFH-----KTVGELFTERGEAGFREL-----------RNMLHEVAEFENVVIS----------TGGGAPCFYDNMEFMNRTG-------KTVFLNVHPDVLFRRLRIAKQQRPILQGKEDDELMDFIIQALEKFYTQAQYIFNADELEDRWQIESSVQRLQELLE.... 174
36 -11.200IDP00325 gene: coaE; dephospho-CoA kinase Cj1530 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  10  3....NAFFVTASIACGKSTFIEIANSLISADKIAHKILDENALELEKIFSPFKNLLKKEDRKILGEIVFNNKEAKKILENFTHPKIRAKILEQMQIFVEIPLFFESGAYEN------------------GKVIVIYTPKELSLKRIMQRDKEAAKARLDSQIDIEEKLKKA----------FIIKNTNSYADFRQECVKVIQEISKG... 199
37 -11.000IDP01198 Cytidylate kinase (CK) (Cytidine monophosphate kinase) (CMP kinase) BA_1518 [Bacillus anthracis str. Ames]  ali follow..  11  1MDKRISIAIDGPAAAGKSTVAKVVAKKLMEVVKNVKIEFQQGENTQLVGQDVSEVIRTPEVTNRVSIVAKHRLVREEMVRRQQELAEKGGVVMDGRDIGTHVLPDA-----------------------EVKIFMLASVEERAERNMNKGFDSNLEQLKEEIAQRDKLEREVSPLKKADDALELDTTSSIEEVVQKIMGIVLGVFAK... 225
38 -10.400IDP02159 gene: aroK; shikimate kinase [Coxiella burnetii RSA 493] CBU_1892 [Coxiella burnetii RSA 493]  ali follow..  14  8......IYLIGLMGAGKTSVGSQLAKLTKRILYDSDKEIEKRTGAD-----IAWIFEMEGEAGFRRR-----------REMIEALCKLDNIILA----------TGGGVVLDEKNRQQISETG-------VVIYLTASIDTQLKRIGQKGEMRRPNSKEKLQQLNEIRKPLYQAMAD---LVYPTDDLNPRQLATQILVDIKQTYSD... 178
39 -10.300IDP02271 gene: aroK; shikimate kinase I [Francisella tularensis subsp. tularensis SCHU S4] FTT1155c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  14  1MIRTKNIFLIGPVGAGKSTIGKQLAKQLKLEFIDSDDVIEKKCGVD-----INWIFDLEGEEG------FRKREREVIAEILAEK-------------QNIVLATGGGAILDPETRSLLSSRG-------KVVYLEATIEQQLERTSKDTKRPLLRVDDKRPVLEQLMAEREPLYRSIADVVVETNGATVKNIVNKISTFLVE....... 172
40 -10.300IDP02572 gene: cmk; hypothetical protein lmo1939 [Listeria monocytogenes EGD-e] lmo1939 [Listeria monocytogenes EGD-e]  ali follow..  12  1MTKKICIAIDGPAAAGKSTVAKIVAKKLRFVYIDTGAMYIAYEDEKAIAALLQKTVIRFEPGEVQQVFV-EVIRSIEVTNHVSIVAAREALQERQQVFATEGGIVMDGRDIGTAVLPNA----------ELKIFLLASVEERAERNMAKGFTGDLDQLKKEIEERDHLTRTHSPLKKADDAIEVDTTSSIDQVANKILSLAELKINN... 224
41 -9.880IDP04640 gene: cmk; cytidylate kinase [Francisella tularensis subsp. tularensis SCHU S4] FTT0559c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  1MNNSKIITIDGPSGVGKGTLAKALAKYYCKTLRNLDISFKIEDDLVKANQDVTKDIRTEQIGMLASKVAAYPTVRAILLNKQREFATEQGLVADGRDMGTVVFPQA-----------------------QYKFFLDASTEITAKRLKTKGQKPNFEKILADIKQRDFRNRKVAPLRPANDAIIVDTSQFIKEVFDSVIKKIT........ 220
42 -9.700IDP02377 gene: cysC; adenylylsulfate kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA1442 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  12  23.HHSFVIWFTGLSASGKSTVANAVARKLFEKNIGNYVL----------GDNIRHGL-------NKDLGFSESDRMENIRRIVAKLFVDQGAVVLTAFISPFRVDRKQVRDLLAVD------------------FIEVFVKCPIEECEKRDPKGLYKKARKDIKEFTGIDSPYEEPEKAE-LIVETHKYSIEECAEQIVKYLQE....... 193
43 -9.700IDP90625 gene: coaA; pantothenate kinase [Yersinia pestis CO92] YPO3758 [Yersinia pestis CO92]  ali follow..  11  86.RIPYVIGIAGSVAVGKSTTARLLQALLSRWPEHRSVELITTDGFLHPNKVLNE-LMKKKGFPESHNLVKFVSEVKSGADYVTPVYSH---LIYDVVPDGNLILEGLNVLQSGMDYPHDPHHVFVSDFVDFSIYVDAPEDLLQSWYINRFLKFRQGAFSNPDSYFHNATQLWNEINGLNLKQNILPTRERASL................. 299
44 -9.520IDP02625 gene: aroK; shikimate kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4457 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  13  4......IYITGYMGAGKTTIGKALSKELHMDVVDTDQKIEEKQG-----KVIRDIFAEEG-----------EMAFREYESEMLCSLPVDNVIIT----------TGGGIVEREENRKWMKENG-------TVVYLYCDPHVIAERLREDTTRPLFQ--KKDIDAFVTKFESRRAYYEEAHIHIDTTNKSVKQIMNELKEKINE....... 165
45 -9.360IDP00863 gene: ccmA; heme exporter protein STM2254 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  24VEAGEWVQVTGGNGAGKTTLLRLLTGLARPDGQGEPLRRVRDSFHRSLLWIGHQPGIKTRLTARENLHFFHPGDGARLPEAL-------AQAGLAGFEDVPVAQLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQ......................................................... 174
46 -9.260IDP01066 gene: ccmA; heme exporter protein STM3819 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  24VDAGEWVQVTGGNGAGKTTLLRLLTGLARPDGQGEPLRRVRDSFHRSLLWIGHQPGIKTRLTARENLHFFHPGDGARLPEAL-------AQAGLAGFEDVPVAQLSAGQQRRVALARLWLTRAALWVLDEPFTAIDVNGVARLTRRMAAHTAQ......................................................... 174
47 -9.230IDP90561 gene: cmk; cytidylate kinase [Yersinia pestis CO92] YPO1391 [Yersinia pestis CO92]  ali follow..  12  3.AIAPVITVDGPSGAGKGTLCKALAESLVPLAAHLDVRFVSQNGQLQVGEDVSNEIRTETVGNTASQAAAFPRVREALLRRQRAFREAPGLIADGRDMGTIVFPDA-----------------------PVKIFLDASSQERAHRLQERGFNVNFERLLAEIQERDNRNRSVAPLVPAADALVLDSTSSIEQVIEQALAYAQRILAL... 226
48 -9.010IDP02756 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_2038 [Coxiella burnetii RSA 493]  ali follow..  12  40VSPGEIIGITGTNYSGKTTLLEFILGFHTPTKGEIRI------DGKNIENYDKMILREKIAYLPARGQIFRGTLLENITERAKQALELSDHFGLSELIWPL---NGFDTTVGGGCSEILSR-TIRALISKPKILLSDEANALLDLKTDQLFLKILQSLKKDCTMI--ISHRPSTLALADRLYELDSGRLILKTHSNGRSL.......... 240

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24