current user: public

If you have questions about the server, please let us know.

Query: gi|12044857|ref|NP_072667.1| DNA polymerase III subunit delta` (MG_007) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MLTTTHALLIIQRKGSFLKPFLDNYLTSIVCENKNGCKKCINCLEILNNKYNSLYWFDQINPFKRENALQLARIFNRERTSVNNKNIYLIEEIEKLSSNSINSLLRLVEDSPINSYGIFTTKNESLILSTFLSRVQKVVLKKASKVPFKVSKNDQEIITSFFTVDEQIEAIENGSFNRFKIILDACLNKKTGTEQIYHAWQIFRDFSNSEIAQLITLIINKTENIDKKSILFNCLKVLPYNPPKSTLFANLVSWLast
1 -72.300IDP90891 gene: dnaX; DNA polymerase III subunits gamma and tau [Yersinia pestis CO92] YPO3122 [Yersinia pestis CO92]  ali follow..  19  35.GRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGTPCGTCANCQEIEQGRFVDLIEIDAASRTKVEDTRELLDNVQY-APARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRAQLELAEQITSDARALQLLARAADGSMRDALSLTDQAVSMGQGQVTTVTVSQMLGTLDDEQPLAIIEALVSA----DGARVMAQIEQAASRGVDWENLLVESLSL 288
2 -70.100IDP90616 DNA polymerase III subunits gamma and tau [Vibrio cholerae O1 biovar eltor str. N16961] VC1054 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  35.NRLHHAYLFSGTRGVGKTTIGRLFAKGLNCETGTPCGQCATCQEIDQGRFVDLLEIDAASRTKVEDTRELLDNVQY-KPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCLQFHLKPISVENIQQQLDHAEQISSDSKALNLLAHAADGSMRDALSLTDQAIALGNGVVKSDIVAHMLGTLDTDHSLHLLQAISLQ----TPQAVMDCIETLAQNGVEWDGLLQQLSTQ 288
3 -68.700IDP91261 DNA polymerase III, delta prime subunit [Bacillus anthracis str. Sterne] NT05BA0041 [Bacillus anthracis str. Sterne]  ali follow..  19  26.ERISHAYLLEGEKGTGKFATAIQMAKSFLCSQREPCHVCTNCKRIDSGNHPNLHIVKDGLSIKKQQIHDLQEEFSK-TGLEANKKVYIIEHADRMTANAANALLKFLEEPSSDTTAILLTEQSHQILNTILSRCQVVTFRPLPTESLIRRLQDEGI----TVSLSTLAAQLTNSFDEALTLCNDEWFAQARALVIKLCEALEKD------------------KASIFFVQEKWGKHFGEKEQLQQGLDMLLLI 259
4 -68.400IDP90924 gene: holB; DNA polymerase III subunit delta` [Yersinia pestis CO92] YPO1606 [Yersinia pestis CO92]  ali follow..  15  21.GRGHHALLLHSLPGNGEDALIYALSRWLMCQQRKSCGECHSCRLMLAGNHPDWYVLKGKSSIGVELVRQLIDKLYSH-AQQGGAKVVWLPHAEVLTDAAANALLKTLEEPPEKTYFLLDCHQPASLLATLRSRCFYWYLACPDTAICLQWLNLQRQIPVEPVAMLAALKLSEGAPLAAERLLQP----ERWSIRSALCSGLREALNRSDLLSLLPQLNHDDAAERLQWLSSLLLDAL................ 261
5 -64.700IDP90644 gene: holB; DNA polymerase III subunit delta` [Salmonella typhimurium LT2] STM1201 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  12  21.GRGHHALLIQALPGMGDEALCYALSRYLLCQQPKSCGHCRGCQLMQAGTHPDYYTLKGKSSLGVDAVREVSEKLYEH-SRLGGAKVVWIADAALLTDAAANALLKTLEEPPEQTWFFLASPEPARLLATLRSRCRLHHLAPPSESYAMSWLS--REVTASQEALLTALRLNAGSPGAALALLQS----ERWAQREALCQALMDSLHTGDWYAVLTALNHEQAPARLHWLATLLVDALKRQHGASYLTN..... 267
6 -59.300IDP90607 DNA polymerase III subunit delta` [Vibrio cholerae O1 biovar eltor str. N16961] VC2015 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  25.GKISSATLIQASEGVGVESLVELMARTLMCTSSEPCGFCHSCGLMQSGNHPDFHVVKPEKIITVEQIRQMNRIAQE-SSQLSGYRLIVIEPADAMNESSANALLKTLEEPAPNCLFILVTSRIKHLLPTIVSRCQRLVLPAPTTALVVEWLKGQGI-----TTPAYALHLCADSPLKTRAFMLE..................................................................... 207
7 -58.100IDP06086 gene: holB; DNA polymerase III subunit delta` [Helicobacter pylori J99] NP_223870 [Helicobacter pylori J99]  ali follow..  14  2..................KNSNRLIYTDNLEEEEAASLFKHHIKFYTEIIEKDKKVIKTFNKDKIEHAKEVISKAHLKH----SELNAFLIAAPSYGVEAQNALLKILEEPPNNVCFIMFAKSPNHVLATIKSRLIKEDLSKLDLKDIYAFLKNKENFDSRENQRERIESLLESIHRHKIPLNEQELQAFDLAIKANSSYYKLSYNLLPLLLSLLS...................................... 213
8 -41.600IDP92073 ruvB-like 2 protein, putative [Toxoplasma gondii ME49] TGME49_088860 [Toxoplasma gondii ME49]  ali follow..  217.FSRAKDYDAVGPATRFVQCPEGELQKRKEVVHSEIDVINSRAQGFLALFAGDTGEIKSEVREQID---QKVADWRAEGKAEVVPGVLFIDEVHMLDIECFSFLNRALEHETSPIVIMATNRGPHGIPLDLLDRSLIIPTQPYEEKDMLKIIEEEEDVELEESARLLLCKIAECSLRYALHLITVANLVRGSVVTVQDIRRVYSLFIDV------KRSTQYLVEYQQEFMFSELPGGAPSQSPSQAVRSAGADR 483
9 -39.400IDP92077 ruvB-like 1, putative [Toxoplasma gondii ME49] TGME49_097370 [Toxoplasma gondii ME49]  ali follow..  219..DLDADEFVPIPRGDVHKKKEVIQDVTLHDLNARPQGGNDFASLLGQLAKPRKTEITEKLRMEIN---KVVNRYIDQGIAELVPGVLFIDEVHMLDIECFTYLNRALESSLTPIVVFATNRSAHGIPVDLLDRMLIARTLPYNLEEIKHVIRKIENLDMEEEAITLLGEIGRTSLRYAVHLLTPASILAETEADEEA-----PAITRDHILRVDSLFQ------DARSSARRLAQEADF.............. 460
10 -35.900IDP92030 ruvB-like 1, putative [Toxoplasma gondii ME49] TGME49_019590 [Toxoplasma gondii ME49]  ali follow..  251..DLEVEEYVPVPKGEVHKRKEVVQVVTLHDANAKPQGGTDIISVMGQFLKPRKTEITEKLRSEIN---KTVNKYIDQGIAELLPGVLFMDEVHMLDIECFTFLNRILESPLSPIIIFATNIEPHGMPVDLLDRLLIVKTAPYTISEVVQVLKQAENVRLSTEALELLGEVGHTSLRYALQLLEPARILGHEIVERKHIEDVDALFDCKSSAQRCAEMRDV................................. 489
11 -35.200IDP00067 gene: ruvB; holliday junction DNA helicase [Campylobacter jejuni subsp. jejuni NCTC 11168] NT01CJ1369 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  49.NECLDHILFSGPAGLGKTTLANIISYEMSANIKTTAAPMIEKSGDLAAILTNLSEGDILFIDEIHRLSPAIEEVLY--PAMEDYRLDIIIGSGPAA--------QTIKIDLPKFTLIGATTRAGMLSNPLRDRFGMFRLEFYKDSELALILQLKLNKTCEEKAALEIAKRSRSTPRIALRLLKRVRDFADVNDEEIITEKRANEAMDLRYLELLTAAKQKPIGLASAAALSEDENTIEDVIEPYLLANGYIE. 308
12 -34.800IDP04216 gene: ruvB; Holliday junction DNA helicase B [Salmonella typhimurium LT2] STM1894_1_336 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  52.GDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVDLAAMLTNLEPHDVLFID-----EIHRLSPVVEEVLY-PAMEDYQLDIMIGEGPA---------ARSIKIDLPPFTLIGATTRAGSLTSPLRDRFGIQRLEFYQVPDLQHIVGRHMGLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGAISAEIAA-----QALDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAI... 290
13 -32.000IDP06190 gene: ruvB; Holliday junction DNA helicase RuvB [Helicobacter pylori J99] NP_223085 [Helicobacter pylori J99]  ali follow..  50.QESLDHMLFFGPPGLGKTSISHIIAKEMETNIKITAAPMIEK---SGDLAAILTNLQAKDILFIDEIHRLSPAIEEV-PAMEDFRLDIIIGSGPAA--------QTIKIDLPPFTLIGATTRAGMLSNPLRDRFMSFRMQFYSPSELSLIIKAKLNQDIKEESADEIAKRSRGTPRIALRLLKRVRDFALVKNSSLMDLSITLHAADLAYLSLLANAQGRPVGLNTAASMREDEGTIEDVIEPFLLANGYLE. 309
14 -30.200IDP05235 gene: ruvB; Holliday junction DNA helicase B [Listeria monocytogenes EGD-e] lmo1532 [Listeria monocytogenes EGD-e]  ali follow..  51.NEALDHVLLYGPPGLGKTTLAMVIASEMGSQIKTTSGPAIERPGDLA---TILTSLEPGDVLFIDEIHRLSRAIEEI-PAMEDYCLDIVIGTGPTA--------RSVRLDLPPFTLIGATTRAGLLSAPLRDRFGVDHLEFYTEEQLTEIVLNILDTKIDDLGAREIARRSRGTPRIANRLLKRVRDFAQVRGNGTVTEKLAKEALTLL------QVDPRGLDTIDQKLLHTIIQSFRGGPVGLDTIAASIG. 290
15 -16.100IDP91277 conserved hypothetical protein [Bacillus anthracis str. Sterne] NT05BA4403 [Bacillus anthracis str. Sterne]  ali follow..  11  11.KQFAPLYLLYGTEAFFINETIKLITTEALEEEDREFN----------------VVTYDLEEAYLEDVVEDARTL----PFFGERKVLLIKSPLFLTSQKIKILEEYIGEPSPFSILVFVAPERKKITKLLKKTADIVEANAMQVQDVQKWIVAEGHVHIDNAAVSLLLELVGSNVTMLAKEMDKLTLYMGGEITPKLVAELVPKSVEQNVFALTEKVVKK----DIAGAMQILDGLFTQQEEPIKLLALLVS. 254
16 -15.800IDP90848 gene: holA; DNA polymerase III subunit delta [Vibrio cholerae O1 biovar eltor str. N16961] VC0953 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14.KTLYPIYLVFGNEPLLLQEAKTAIEKT-----------------AQAQGFLEKHRFSADAGLDWNAVYDCCQALSL----FSSRQLIEIEIPEGVNAQTAKELSALVGQLHQDILLLVIGPKLTAWFKTLAQQACWVNCLTPELSRLVQQRCFALGLKPDAEAVQMLAQWHEGNLFALAQSLEKLLLYPDGLLTLVRLEESLSRHNHFTPYHWMDALLEG----KANRAQRILRQLMLEESEPIILIRTAQK. 251
17 -15.300IDP04212 gene: holA; DNA polymerase III subunit delta [Salmonella typhimurium LT2] STM0646_1_343 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15.EGLRAAYLLLGNDPLLLQESQDAIRLAAA-----------------SQGFEEHHAFTLDPSTDWGSLFSLCQAMSL-----ASRQTLVLQLPENGNAAMNEQLATLSELLHDDLLLIVRGNKLTKWYTALADRSVQVSCQTPEQAQLPAARAKAQNLQLDDAANQLLCYCYEGNLLALAQALERLLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALLMG----KSKRALHILQQLRLEGSEPVILLRTLQR. 252
18 -14.800IDP90919 gene: holA; DNA polymerase III subunit delta [Yersinia pestis CO92] YPO2608 [Yersinia pestis CO92]  ali follow..  15.EGLRACYLLCGNEPLLLQESQDHIRRV-----------------ASQHDFTEHFSFALDAHTEWEHIFSLCQALSL-----ASRQTLLLSFPDGLTAPISEQLVKLSGLLHPDILLILRANKNSAWFKALSKNGVFVSCQTPEQAQLPSARAKSLNLNVDDAAIQLLCYCYEGNLLALSQALERLLLYPDGKLTLPKVEQAVNDAAHFTPYHWLDALLMG----KSKRAWHILQQLQQEDSEPVILLRTVQR. 252
19 -13.200IDP04393 gene: lonB; ATP-dependent protease LonB [Clostridium perfringens ATCC 13124] CPF_1645 [Clostridium perfringens ATCC 13124]  ali follow..  10  93.......VIIYGPPGVGKTAAARIILEEAKKMAASPFNK--DSKFVEIDATTLRFDERGIADPLIGSVHD-VPQPKPGAVTKAHGGILFIDEIGELHPIELNKLLKVLEDPADFRLIGATTRSPEEIVPAIRSRCVEIFFRGLTVEEIALNATNKVGYRISDEGLDIVSRYCTNG-REVINLVQLC-----SGLAINENRDYIKESDIYWVIENGQYNPRMERMINDKPEIGYVNGLAVYGANNGALM...... 369
20 -12.000IDP01132 gene: loN2; ATP-dependent protease LA BA_4703 [Bacillus anthracis str. Ames]  ali follow..  14  94.......VIIYGPPGVGKTAAARLVLEEAKRNPKSPFRT--NATFIELDATTARFDERGIADPLIGSVHD-IPQPKKGAVTDAHGGILFIDEIGELHPIQMNKMLKVLEDPADFRLVGATTRSPEEIPPAIRSRCLEVFFRELDTEEVAKNAADKVEMQIGENGIEMIGMYARNG............................................................................... 303
21 -11.800IDP95071 ATP-dependent protease ATP-binding subunit ClpX [Peptoclostridium difficile 630] YP_001089820 [Peptoclostridium difficile 630]  ali follow..  12  112.......ILLLGPTGSGKTLLAQTLARTL---------------------NVPFAMADATSLTEAGYVGEDVENILLKDIEKAERGIIYIDEIDKIARKSQQALLKILEG-PHQEFLKIDTTNVLFILGGAFDGLEKIIQKRGGDKTLKIESKKELDLGKLYEKVLPEDLLKYGIIPEFIGRIPVLATL--ELLDEDALMQILQEPKNALVKQYKKLLELDDVELEEEGALRAIAKKAIERNTGARGLRSIVE. 372
22 -11.700IDP01666 gene: clpX; ATP-dependent protease ATP-binding subunit [Bacillus anthracis str. `Ames Ancestor`] GBAA4704 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  112.......IALIGPTGSGKTLLAQTLARILN---------------------VPFAIADATSLTEAGYVGEDVENILLKDVEKAEKGIIYIDEIDKVARKSQQALLKILEGTVASVFIQIDTTNILFICGGAFDGIEPIIKRRLGEKVISEKKNADVNEKHVLSHVLPEDLLRFGLIPEFIGRLPVIANL--EPLDEDALVDILTKPKNALVKQFQKLLELDDVELEEEGALIEIAKKAIERKTGARGLRSIIE. 371
23 -11.700IDP02143 gene: clpX; ATP-dependent Clp protease, ATP-binding subunit ClpX [Coxiella burnetii RSA 493] CBU_0739 [Coxiella burnetii RSA 493]  ali follow..  14  111.......ILLIGPTGSGKTLLAQTLAKILD---------------------VPFAIADATTLTEAGYVGEDVENIIQKDVEKAKTGIIYIDEIDKIARKTQQALLKLIEG-PQQEYLQVDTSNILFICGGAFADLHKIIQRRTDKSGIGFAAEVRPKEDFSREASKLIKQTE-GLIPEFVGRLPIITTL--EELDEDALMRILTEPKNALVKQYRKLFEFEGVEIDREDALKAIAKRAIQQKTGARGLRSIVE. 373
24 -11.400IDP95260 DNA-binding ATP-dependent protease La [Acinetobacter baumannii ATCC 17978] YP_001084064 [Acinetobacter baumannii ATCC 17978]  ali follow..  11  72.......LCLVGPPGVGKTSLGESVAKATG----------REFVRMALGGVRDEAEIRGHRRTYIGAM----KIVQSLTKVGVKNPLFLLDEIDKMAQDPASALLEVL-DPSQNSKFFICTANSMNIPEALLDRMEVIRLRYLVPKAIKNNGLRPKELTIHEEAIRDIVQTREAGVRNLEREVSKIARKVVKEAVSKKSKNLQLDVTSANLPEYL....................................... 300
25 -11.200IDP00680 gene: clpX; ATP-dependent protease ATP-binding subunit SACOL1721 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10  113.......IALIGPTGSGKTLLAQTLAKTLN---------------------VPFAIADATSLTEAGYVGDDVENILLRDIDKAEKGIIYVDEIDKIARKSQQALLKILEGTTASVILFILGGAFDGIEEVIKRRLGE------KVIGFSSNEADKYDEQALLAQIRPEDLQAYGLIPEFIGRVPIVANL--ETLDVTALKNILTQPKNALVKQYTKMLELDDVDLETEEALSAISEKAIERKTGARGLRSIIE. 371
26 -10.600IDP91389 Type II secretory pathway, component ExeA [Vibrio vulnificus CMCP6] VV1_1437 [Vibrio vulnificus CMCP6]  ali follow..  46.......VKVTGEVGTGKTMVCRMLIDQL--SDKVNLVYLPNPVLSGHELQMAIAREMGLKTYDSVSLVPLIQDCLIGMRQRGMRTVLLVDEAQALPLEAMEALFGNLETEQEKLLQIVLFGQPE--LRQFRQRITSCQLRPLTIEEGVAFIDSRLAKALTTEQKKALWRGAGGIPRLINQLCHKAF................................................................... 240
27 -10.500IDP00151 gene: mshM; MSHA biogenesis protein MshM VC0403 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  46.......SKLTGEVGTGKTMVCRMLLTHL--GDEVALIYLPNPMLSGEELRQAVAAELQLDVASPVRVVEQIQTRLIELHQQGKRVVALVDEAQALSDEALETLFGNLETEQTKLLQIVLIGQPE--LRQFRQRITNANLRPLTQAETEVYIESRLQKAFNATLKKAVWRASQGIPRLINQICHKAL................................................................... 239
28 -10.400IDP02742 hypothetical protein GBAA2122 [Bacillus anthracis str. `Ames Ancestor`] GBAA2122 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  40....GHV-LLEDVPGVGKTMLVRALSKSIDADYKR---------------TPDLLPSDVTGV----SIYNPKELQFEFKPGPIMGNFILADEINRTSPKTQSALLESMEEPLPKPFFVMATQNPVEYEGTY-AQLDRFLLKPTPEEELLYLQQSVREVSMDKGIKHYIVKLVSQTRSYSSIQLGASPRGSIALMKASQAYAFIHGVIPDDVKFLAPYVLAHR--------LILKMEAKFEGITGEQVISKIVA. 284
29 -10.200IDP06262 gene: clpX; ATP-dependent protease ATP-binding subunit ClpX [Streptococcus pneumoniae TIGR4] NP_346016 [Streptococcus pneumoniae TIGR4]  ali follow..  10  115.......ILMIGPTGSGKTFLAQTLAKSLN---------------------VPFAIADATALTEAGYVGEDVENILLKNIERAERGIIYVDEIDKIAKKSENALLKIIEGTVASVILFIVGGAFDGIEEIVKQRLGE------KVIGFGQNNKAIDENSSYMQEIIAEDIQKFGIIPELIGRLPVFAAL--EQLTVDDLVRILKEPRNALVKQYQTLLSYDDVELEDDEALQEIANKAIEARGLRSIIEETML. 377
30 -10.100IDP02494 hypothetical protein GBAA0550 [Bacillus anthracis str. `Ames Ancestor`] GBAA0550 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  12  95....KRILLLMGPVSGGKSTLVTMLKRGL-CPMHED-NLSPLNVMRLEQEYGSRIE--SPSDPKSQDIADLTGSLDFSTIAKANRGMMEFQEMLKCDEKFLWHLLSLTQEGNFKAELIVAHTNETKKNEALHSRIIVMPVPYNLRVSEEEHISDVSDVHIAPHTLRVAAMFTKDPKRPDIDLIKKMRLYDGETVEGYNAIDVEELIDPRYVINRISSTIIRKEVINALDVLRSLKDGLDQ.............. 445
31 -9.930IDP02333 gene: clpX; ATP-dependent protease ATP-binding subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0625 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  13  108.......VLLIGPTGSGKTLFAQTLAKLLN-------------VPFAIADATTLTEAGYVGDDVENIIVRLLQNADFD-VAKAQKGIIYIDEIDKIARKSESALLKLIEGTVSSVPPKGGRKHPNQDMIQVDTS-HRMDKVSIGFNSDVIQQKNSLDSDKLMQKIESEDLTRFGLIPELIGRLPIVTVL--NELKEEDLVRILTEPKNALIKQYIKLFKFDNVNIETDQALVEIAKKAITKKTGARGLRTILE. 369
32 -9.750IDP01644 gene: lon; DNA-binding, ATP-dependent protease La [Francisella tularensis subsp. tularensis SCHU S4] FTT0626 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  355.......LCLVGPPGVGKTSIGQSIARATG----------REYVRMALGGVRDESEIRGHRRTYIGSM----QIIQKIIKSKTENPLFLLDEIDKISSDPSAALLEVL-DPEQNSTFFVATANSLDIDPALRDRLEIINLSGYTEIE-KQAIAKQYLIPKALEN----NGLTKDEINFTPKAILDIIRYYTREAGVRNLQQKIDGVCRKAVKNLLKDSNTGKISITQKNLEDYL.................... 582
33 -9.440IDP02793 gene: loN; ATP-dependent protease La 1 [Bacillus anthracis str. `Ames Ancestor`] GBAA4702 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  13  349.......LCLVGPPGVGKTSLARSIATSLN----------RNFVRVSLGGVRDESEIRGHRRTYVGAM----RIIQGMKKAKSVNPVFLLDEIDKMSNDPSAALLEVL-DPEQNVMFVATANTLSSIPGPLLDRMEIISIAGYT---------ELEKVHIAREHLLPKQLQEHGLRKGNLQVRDEALLEIIRYYTREAGVRTL----ERQIAKVCRKVAKIIVTAERKRIVVTEKNVVDL.............. 575
34 -9.360IDP90346 gene: lon; ATP-dependent protease La [Chlamydia trachomatis D/UW-3/CX] CT344 [Chlamydia trachomatis D/UW-3/CX]  ali follow..  388.......ICLVGPPGVGKTSIGRSIAKVLH----------RKFFRFSVGGMRDEAEIKGHRRTYIGAM----KLVQALKQSQIMNPVIMIDEVDKIGSSPASALLEVL-DPEQNVLFILTANVLDSIPDPLLDRMEVLRLSGYILEE-KLQIATKYLVPRARKE----MGLSAQNVTFQPEALKHMINNYAREAGVRTLNENIKKVLRKVALKIVQ...................................... 598

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.