current user: public

If you have questions about the server, please let us know.

Query: gi|12044859|ref|NP_072669.1| TatD family deoxyribonuclease (MG_009) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# Score Template Links and tools%idFirst MEYFDAHCHLNCEPLLSEIEKSIANFKLINLKANVVGTDLDNSKIAVELAKKYPDLLKATIGIHPNDVHLVDFKKTKKQLNELLINNRNFISCIGEYGFDYHYTTEFIELQNKFFEMQFEIAETNKLVHMLHIRDAHEKIYEILTRLKPTQPVIFHCFSQDINIAKKLLSLKDLNIDIFFSIPGIVTFKNAQALHEALKIIPSELLLSETDSPWLTPSPFRGKVNWPEYVVHTVSTVAEIKKIEIAEMKRIIVKNAKKLFWHLast
1 -102.000IDP00957 gene: ycfH; predicted metallodependent hydrolase STM1202 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  30  1MFLVDSHCHLDGLDYQKDVDDVLAKAAARDVKFCLVATTLPGYRHMRKLVGKRDN-VVFSCGVHPLNQDEAYDVEELRLLAA-----EDDVVAMGETGLDYFYTPETKIRQQASFIHHIQIGRELHKPVIVHTRDARADTLAILREEKTDCGGVLHCFTEDRETAGKLLDL-----GFYISFSGIVTFRNAEQLRDAARYVPLDRLLVETDSPYLAPVPHRGKENQPAMVRDVAEYMAVLKGVAVEELAQITTDNFARLFH. 255
2 -98.000IDP00130 gene: yjjV; putative deoxyribonuclease YjjV NT01ST5659 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  22  3WRFIDTHCHFDFPPFTGDERASIQRACEAGVEKIIPATEAAHFPRVLALAARFPS-LYAALGLHPIVIERHADDDSDKLQQALAQQQN--VVAVGEIGLDLYRDDPQFARQERFLDAQLQLAKRYDLPVILHSRRTHDKLAMHLKRQDLPRTGVVHGFAGSLQQAERFVRL-----GYKIGVGGTITYPRASKTRDVMARLPLDALLLETDAPDMPLKGFQGQPNRPEQAARVFDALCELRPEPAEVIADTLYRNTITLFR. 256
3 -97.600IDP01786 hydrolase, putative [Coxiella burnetii RSA 493] CBU_0502 [Coxiella burnetii RSA 493]  ali follow..  30  5...............................HILCVGVDLTHAQTVIEIAARFEN-VSASVGLHPSEKVDHEPT--VQELVEVANHPK--VVAIGETGLDYYYNHSELGKMRDRFRCHVQAALKLKKPLIIHSRSAQTDTIQIMQEENQSVGGVMHCFTESWEMAEQAMKL-----GFYISFSGIVTFKNAKNVAEVAKKVPLEKMLIETDAPYLAPVPYRGKKNEPQYIPYVAERIAELKNIPLNEVARKTTENYYHLFG. 225
4 -14.000IDP04461 gene: pyrC; dihydroorotase [Yersinia pestis CO92] YPO1587 [Yersinia pestis CO92]  ali follow..  12  13..PDDWHIHLRDDEMLSTVLPYTSEVFARAIVMPNLAQPITTVASAIAYRERILAAVPAGHKFTPLMTCYLTNSLDAKELTTGFE--QGVFTAAKLYPANATTNSTHGVSDIPAIYPLFEQMQKIGMPLLIHGEVTDAAV--IRQKFPELKIVFEHITTKDVLAGNRFLGATVTPQHLMFNRNHMLRSTHQQALRAAVASGSDRFFLGTDSAPHAKHRK--GVFNAPAALPAYASVFEE--LNALQHLEAFCALNGPRFYG. 305
5 -13.700IDP00873 gene: pyrC; dihydroorotase STM1163 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  13..PDDWHVHLRDGDMLKTVVPYTSEIYGRAIVMPNLASPITTVDAAIAYRQRILDAVPAGHDFTPLMTCYLTDSLDADELER--GFHEGVFTAAKLYPANATTNSSHGVTSVDAIMPVLERMEKLGIPLLVHGEVTHADV--LRQRLTALKVVFEHITTKDVRDGNDYLAATITPQHLMFNRNDMLRNIHQQALRELVASGFTRAFLGTDSAPHSRHRK--GCFNAPSALGSYAAVFEE--MNALAHFEAFCSLNGPQFYG. 305
6 -12.400IDP90750 gene: pyrC; dihydroorotase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0259 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  11  6..PLDMHLHLR----DNQMLELIAPLSARDFCAAVIMPNLIPPLCNLEDLKAYKMRILKACKDENFTPLMTLFFKNYDEKFLYSAKDEIFGIKLYPAGITTNSNGGVSSFDIEYLKPTLEAMSDLNIPLLVHGETNDKIYEKLAKHFPRLKIVMEHITTTLCELLKDYENLYATITLHHLIIT-AKRYEDKEALCELAFSGYEKVMFGSDSAPHPKDTK--GVFSAPVILPVLAELFKQ--NSSEENLQKFLSDNTCKIYD. 291
7 -11.400IDP90537 RecName: Full=Dihydroorotase; Short=DHOase Q9KL24 [Vibrio cholerae]  ali follow..  9..PDDWHVHLR----DGDVLADTVRDISRYNGRALIMPNTVPPVTTTEMALAYRERIMAAQPQAHFEPLMALYLTDNTSPEEIRKAKASGKVV----AAKLYPAGATTNTSAKNIYPVLQAMQEVGMLLLVHGEVTTHEV--IVNDFPQLKIVLEHITTADVQQAGDNVAATITAHHLLFNRNHMLRATHQHALVAAATSGSKKFFLGTDSAPHAKGRK--GSYTAHAALELYAEVFEK--EGKLENLEAFASFNGPDFYG. 300
8 -10.500IDP00351 gene: adeC; hypothetical protein lmo1742 lmo1742 [Listeria monocytogenes EGD-e]  ali follow..  10  74..FIDAHVHVESAMVTP--AEFARVLLPNGVTTIVTDAGEKGIEFMLEDAKGAPLDMFVMLPSSVPATEGEHNGETLHAEKLHPLYRHEKVIGLAEV-----MDFPSVAKGSDDILRKIIDAKKEGGRIDGHGAGLTSADLNNYLAVG---------IRTDHESTTAKEATDRLRAGMFVMLREGTVGRDLLQTIPAVSEKNSHRFCFCTDDKLINDLITEGSINY-------NIKLAIKNGIDPITAIQMATINAANCHN. 316
9 -8.720IDP92021 adenosine/AMP deaminase domain containing protein [Toxoplasma gondii ME49] TGME49_005720 [Toxoplasma gondii ME49]  ali follow..  13  16LPKIELHAHLF-DDIVYALRRVLEDFSQDNVVYLELRTTVALLVEELKSAEKQYPMIVRLI-NRSRLTSEVETREETVKILDLVAKYPEWIVGVDIAGDPRKGNILPALEVLEKEVMNPSGAHHGKLKVTVHTSEVEEKETKAVLKLAPHRIG--HGCYLAVDQREFLLK---EKICVEICPSSNMCTLNLRDLKDYGKKVLSNAVCICTDDIGLF-----------TSLSKELHVLSQAYNLSLSDVMDLQRSALAAAF.. 348
10 -8.400IDP00795 gene: pyrC; dihydroorotase SACOL1213 [Staphylococcus aureus subsp. aureus COL]  ali follow..  54..FVDVHVHLREPEYKETIETGTKAAARGGFTTVCPMPNTRPVPDSVEHFEALQKLIDDNAQVRVLPYASITTRQLGKELVDFP--------ALVKEGAFAFTDDGVGVQTASMMYEGMIEAAKVNKAIVAHCEDNSLIYGGAMHEGKRSKELGIPGIPNICEQIARDVLLAEA-AGCHYHVCHVSTKESVRVIRDAKRA----HVTAEVTPHHLNP-PLRSTEDREALLEGLLDGTIDCGDWTLQQLVDYLTIKPCETFN. 361

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.