current user: public

If you have questions about the server, please let us know.

Query: gi|12044860|ref|NP_072670.1| DNA primase-related protein (MG_010) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MDVRTERLNELFFVYHKNLKNQSKSKYSRAVNYLKRRGFNLQDFLKVGGGVGYLQNKEWLNLPLYSFDGNLIGFLNRKVSYKKEFLYTPFNKPPSKSEAFVGLRELVIKDNSIYLVEGDFDWLAFRKAGILNSLPLCGLTISNQQVQWLKQKKIKKIFICFDNDLAGKNGAKNLKEYLTKQGFITKVIEIKAAAKDWNDLFLLNNSNWSAVLTNQLLFLast
1 -63.400IDP90503 DNA primase [Vibrio cholerae O1 biovar eltor str. N16961] NP_230169 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  154.GLSGEIVQKFGIGY-------IADEWDLVRRNFGQQRSSEDMLVTAVMGRRYDRFRGRVMFPIRDRRGRVIGFGGRITEQTPKYLNSPETPIFHKGKELYGLYEVYREPPQILVVEGYMDVVALAQYGVDYSVASLGTSTTGDHLQLLF-RQTNHVICCYDGDRAGRDAAWRALENYLKSGNILKFLFLPD-GEDPDSYVRKYGADFEQQVANATPL 375
2 -62.600IDP05233 gene: dnaG; DNA primase [Listeria monocytogenes EGD-e] lmo1455 [Listeria monocytogenes EGD-e]  ali follow..  19  151.GMSEQMMTTFQIGF-------APNHHATITSFLEKRGMDLQLAGAAGLGQMVDRFRNRIMFPITNDRGQIIAFSGRLFDDGPKYLNSPETPVFNKRRILFHFSEAIRKQEEITLMEGFMDVISAEEAGVQNAVASMGTSLTEEHADLIK-RLTNRAIICYDGDRAGIEAAYKAGTLLVERRLDVFVLQLPA-GKDPDDFIRASGEKFKEVYKQQR.. 369
3 -62.200IDP90681 gene: dnaG; DNA primase [Salmonella typhimurium LT2] STM3210 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  17  147.GLSAEIIQRFAIGF-------APPGWDNALKRFGNNSDNKALLLDAGMGSTYDRFRNRVMFPIRDKRGRVIGFGGRVLGNTPKYLNSPETDIFHKGRQLYGLYEASAEPQRLLVVEGYMDVVALAQYDINYAVASLGTSTTADHMHMLF-RATNNVICCYDGDRAGRDAAWRALETYMTDGRQVRFMFLPD-GEDPDTLVRKEGAAFEARMEQAQPL 368
4 -61.900IDP06259 gene: dnaG; DNA primase [Streptococcus pneumoniae TIGR4] NP_345545 [Streptococcus pneumoniae TIGR4]  ali follow..  19  143.GLTDEVLKHFWIGL-------APPERNYLYQRL-SDQYREEDLLDSGLNQFVDTFHNRIMFPLTNDQGKVIAFSGRIWSQTSKYKNSRSTAIFNKSYELYHMDRASGKASEIYLMEGFMDVIAAYRAGIENAVASMGTALSREHVEHLK-RLTKKLVLVYDGDKAGQAATLKALDEI--GDMPVQIVSMPD-NLDPDEYLQKNGEDLAYLLTKTR.. 359
5 -61.700IDP90594 gene: dnaG; DNA primase [Yersinia pestis CO92] YPO0644 [Yersinia pestis CO92]  ali follow..  17  147.GLSEEIIQHFAIGF-------APPGWDNALKRFGRDGESRTALNDAGMGRTYDRFRERVMFPIRDKRGRVIAFGGRILGDVPKYLNSPETEIFHKGRQLYGLYEAHPNPTRLLVVEGYMDVVALAQFGIDYAVASLGTATTAEHIQLLF-RATDNVICCYDGDRAGRDAAWRALETYLNDGRQLRFMFLPD-GEDPDTLVRKEGDAFEQRMEAAQPL 368
6 -59.000IDP90712 gene: dnaG; DNA primase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1638 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  21  136.ALNDKDIAKFELGF-------AGASEDSI-RLLQNQKIPLEDAMSVGANEFYASFIWRITFPIYDHKDLLVGFGGRTLNPNAKYVNSPQNILFDKSRIFYAFNIAIAKKKEIIVCEGYMDAIAFHKAGFNNAVAVLGTALTEHHLPLIR-RYDAKVILCFDNDEAGLKAATRSAFLLSTNKIDGKVAILQG-GKDPAELVAKNETKLHNILDEGIEL 354
7 -31.100IDP06295 primase-like protein [Streptococcus pneumoniae TIGR4] NP_346417 [Streptococcus pneumoniae TIGR4]  ali follow..  12  3...........................................................................................................EKISQVIVVEGRDDTVNLKRYFDVETYETRGSAINAQDIERIQRHQRHGVIVFTDPDFNGERIRRMIMMVVQHAFLKRDEAVPKSKTKGRSLGIEHASEDLKTALAQVTEQ 118
8 -12.800IDP92130 helicase, putative [Toxoplasma gondii ME49] TGME49_061800 [Toxoplasma gondii ME49]  ali follow..  17  390...........................SAGQRLRRSKGVSQPGEASDEDCAHSRKDASS------AATLPVVRVKARSISEKSCMRLLPAG----GQWGLFGAATVPADADTLVLTEGEFDAMSVFQQTKVPAVSV-AHSLPVQVLPFLER--FKKIILWMDDDAAGREGAELFAAKL........................................ 530
9 -7.330IDP01496 aminopeptidase VCA0813 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  125...............................................................ITNTIRALSSFNNRFYTTASDWLANEWRSL--NQKSVVLTIQGSEKPDEWVIVGGHLDSTLGSHTGADD---ASGIASLSEIIRVLRDNNFR-ALMAYAAEEVGLRGSQDLANQYKAQGLQLDMTNYRGSAEDIVFITDYTDSNLTQFLTTLID. 313
10 -6.950IDP95167 pyrroloquinoline quinone biosynthesis protein PqqE [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001335473 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  30.........................................................................SNPLDFARQDKELTTEQWIEVFRQARAMGSVQLGFSGGEPLTRKDLPELIRARDLGFYTNLITSGIGLTESKLDAFSEAGLDHIQISFQASDEAFQQKLTMAKAVKARDYPMVLNFV---------LHRHNIDQLDKIIELCIEL 177

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Q, Zmasek CM, Dishaw LJ, Mueller MG, Ye Y, Litman GW, Godzik A. Novel genes dramatically alter regulatory network topology in amphioxus. Genome Biol.2008 Aug 4;9(8):R123.