current user: public

If you have questions about the server, please let us know.

Query: gi|12044861|ref|NP_072671.1| hypothetical protein (MG_011) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .
# Score Template Links and tools%idFirst MGKIKLKNRKALVVYDNKDDFEKNQTFALSLIKELQKKKLNAEVLLLENKDINFEAKINEAELILNRSRKVDFLKTNNQINTFLVNPFNVVFIANDKYETYKWLKQNRFLTVNSSLLSKETIKSFPVIVKKRNSHGGKDVHLVNSADEIKHLNIENATEWIVQPFLSIGTVEYRAYILFGKIIKVIKKISNANQFKANFSQGAEVSLFKLKWFTKRKIKKIAKRLREGYYAIDFFLNRYNRVIVNEIEDAAGARALVQLCPDLNITKIIIRTIISKFKKFLKKKLISLast
1 -31.100IDP02693 gene: ddlB; D-alanine--D-alanine ligase B [Francisella tularensis subsp. tularensis SCHU S4] FTT0185 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  14  1.....MKNEKIVVLYGGDSEREVSLKSGKAVLDSLISQGYDAVGVDASGKELVAKLLELKPDKCFVALHG-RVSALLEMLEIKHTSSMKSSVITMDKMISKEILMHHRMPTPMAKFLTDEDEISFPVAVKPSSGGSSIATFKVKSIQELKHAYEEASKEVMIEQWVT--GKEITVAIVNDEVYSSVWIEPQNEFYDYESKYSGKSIYHQKELEVRQLAKKAYDLLGCGHARVDFIYDDRGNFYIMEINSSPGMTDNSLSPKSAAAEGVDFDSFVKRIIEQAQ..... 296
2 -30.200IDP00575 gene: ddl; D-alanine--D-alanine ligase YPO0557 [Yersinia pestis CO92]  ali follow..  10  1.....MAEKVAVLLGGTSAEREVSLLSGQAVLAGLKEAGIDAYGVDTKDFPVTQLKE-QGFDKVFIALHG-TLQGVLEFLQLPYTGSVMASALTMDKLRTKLVWQALGLPISPYVALNRQQKLGLPLIVKPSHEGSSVGMSKVDHASELQKALVQHDSDVLIEKWLS--GPEFTVAILGDEVLPSIRIQPPGVDYDAKYLSDKTQYFCESEQQLAALALQAYHALDCGWGRVDVMQDRDGHFYLLEVNTSPGMTSHSLVPMAARQYGLSFSQLVARI.......... 301
3 -29.400IDP05293 gene: ddl; D-alanine--D-alanine ligase [Clostridium difficile 630] CD1408 [Peptoclostridium difficile 630]  ali follow..  14  2........KIAVIMGGISSEREVSLNSGKEIYNNLDKNKYEVVKVIIDDKKDIFTKIPEDIDFAILALHG-CIQSILETMDIPYSGCPLCSGMCMDKNITKKMLRDSNLPTAPWVLVKSVDNIGYPVFIKPNSGGSSVATFFIHSKDEVEEAVREVDEFVMIEKYIP--GGEYTSFILNGEVFPTISIKSDSGDYEAKYSVEKGAKEEELQKRVNEISETCWKIFNCAYVRVDMIIS-EGIPYVLELNTLPGMTQTS-AARGIKYSELLDKLIEYSLN......... 299
4 -29.300IDP01207 D-alanine--D-alanine ligase (D-alanylalanine synthetase) (D-Ala-D-Ala ligase) BA_2610 [Bacillus anthracis str. Ames]  ali follow..  16  2........RIGVIMGGVSSEKQVSIMTGNEMIANLDKNKYEIVPITLNE-KMDLIEKAKDIDFALLALHG-TVQGTLESLGIPYSGSMLSSGICMDKNISKKILRYEGIETPDWIELTKMEKLGFPLVVKPNSGGSSVGVKIVYDKDELISMLEEWDSEVVIEKYIK--GEEITCSIFDGKQLPIISIRHAAEDYNAKYDDASTIEPAELKERVNKASLACYKALKCVYARVDMMVK-DGIPYVMEVNTLPGMTQAS-DAAGIHYSKLLDMIIETSLRVRKEEGF.. 304
5 -27.200IDP06289 gene: ddl; D-alanyl-alanine synthetase A [Streptococcus pneumoniae TIGR4] NP_346110 [Streptococcus pneumoniae TIGR4]  ali follow..  13  1.....MKQTIILLYGGRSAEREVSVLSAESVMRAVDYDRFTVKTFFISQKKVAPSAIYEEGAVVFPVLHGPSVQGFLEVLKMPYVGCILSSSLAMDKITTKRVLESAGIAQVPYVAIVEGDKLAYPVFTKPSNMGSSVGISKSENQEELRQALKRYDSRVLVEQGVN--AREIEVGLLGNYLPGEVVKDVAFYDYDAKYIDNNITMDIDVVAVMRQNAETAFRAIGGGLSRCDFFYTDKGEIFLNELNTMPGFTQWS-DNMGISYPKLIERLVDLAKESFDKRE... 343
6 -26.500IDP91799 gene: vanE; VanE [Enterococcus faecalis] AAL27442 [Enterococcus faecalis]  ali follow..  16  2.......KTVAIIFGGVSSEYEVSLKSAVAIIKNMESIDYNVMKIGITEFVLKNSKKIIKPDILFPVLHGGAMQGVFELLDIPYVGGIGAAAISMNKIMLHQFAEAIGVKSTPSMIIEKGQIHGFPLYIKPNEAGSSKGISKVERKSDLYKAIDKYDSRILIQKEVK--GVEIGCGILGNEECDQISLVDGFFDYEEKYNLVTAEILLDKKEDIQMKAKKLYRLLGCGLARIDFFLTDDGEILLNEINTMPGFTEHS-NEIGMDYKEIIENLLVLAVENHEKKL... 348
7 -26.500IDP00919 gene: ddl; D-alanyl-alanine synthetase A STM0380 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  14  1.....MAKLRVGIVFGGKSEHEVSLQSAKNIVDAIDKTRFDVVLLGIDKINAQNGQPLPTVDVIFPIVHGTSLQGMLRVANLPFVGSVLSSAACMDKDVAKRLLRDAGLNIAPFITLTRTNRLGLPLFVKPANQGSSVGVSKVANEAQYQQAVAEFDHKVVVEQGIK--GREIECAVLGNDTCGEIVLNSEFYAYDTKYIDDNGAQVVEVNDKIRAIAIQAYQTLGCGMARVDVFLTADNEVVINEINTLPGFTNIS-QASGLGYTDLISRLIELALERHTANNALK 361
8 -26.400IDP91787 gene: vanC; D-alanine-D-alanine ligase-related protein [Enterococcus gallinarum] AAA24786 [Enterococcus gallinarum]  ali follow..  14  2.......KKIAVLFGGNSPEYSVSLTSAASVIQAIDPLKYEVMTIGIAP-GFILGEKRIVPDVLFPVLHGKCIQGLLELMNLPYVGHVAASALCMNKWLLHQLADTMGIASAPTLLLSRYEDHGFPIFIKPNEAGSSKGITKVTDKTALQSALTAYGSTVLIQKAIA--GIEIGCGILGNEACDAISLVDGFFDFEEKYQLISATITVALESQIKEQAQLLYRNLGLGLARIDFFVTNQGAIYLNEINTMPGFTGHS-AEVGLSYEILVEQLIALAEEDKR...... 343
9 -26.400IDP91788 gene: vanD; D-Ala:D-Lac ligase VanD [Enterococcus faecium] ACM47287 [Enterococcus faecium]  ali follow..  14  1.....MFKIKVAVLFGGCSEHNVSIKSAMEIAANIDTKKYQPYYIGITKIQKDTGYEIQPVDVVFPMIHGKSIQGLLELSGIPYVGDIQSSVICMDKALAYTVVKNAGIAVPGFRILQEGDDLVYPVFVKPARSGSSFGVNKVCKAEELQAAIRKYDSKILIEEAVT--GSEVGCAILGNEEVDQIELRHGFFKIHQEAQPEKGSENAEVRERIRKTAMKIYRILGCGLARIDLFLREDGCIVLNEVNTMPGFTSYS-TAAGFTLSEILDRLIEFSLRR........ 343
10 -26.300IDP01488 gene: ddl; D-alanyl-alanine synthetase A VCA0572 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  1.....MTKTTILLLCEHEISLVSANYIQQQLELTPEFHVIRVEMLDTNSATLNSDKASYPIDFVVPCIHGFDIQSMLELAGIPYLGGPEASANSFNKITSKLWYDALDIPNTPYLFLTQNTGHWGSIFVKAARQGSSVGCYKVTTEDQIAPAIEGFSEQVLVEQAVK--PRELEVSAYEMNPGEVIAPEGTFYSYEEKYSANSHARTVKHKELIQTYAERVFIHMKLHLSRIDFFLTQEGQIYLNEVNTFPGMTPIS-EHNGHRFSEFLVQCVTNTLVNAK...... 334
11 -26.200IDP91050 gene: vanB; D-Ala:D-Lac ligase [Enterococcus faecalis] EFE0001 [Enterococcus faecalis]  ali follow..  12  1.....MNKIKVAIIFGGCSEHDVSVKSAIEIAANINTEKFDPHYIGITKVMKEREYETRRIDVAFPVLHGKAIQGLFELSGIPYVGDIQSSAACMDKSLAYILTKNAGIAVPEFQMIEKARTLTYPVFVKPARSGSSFGVTKVNSTEELNAAIEQYDGKILIEQAIS--GCEVGCAVMGNEEVDQIRLSHGIFRIHQENEPEKGSENAEERNRVQETAKKVYRVLGCGLARVDLFLQEDGGIVLNEVNTLPGFTSYS-AAAGITLPALIDSLITLAIER........ 342
12 -25.800IDP02225 D-alanine--D-alanine ligase [Coxiella burnetii RSA 493] CBU_1338 [Coxiella burnetii RSA 493]  ali follow..  14  98...........................................................SADCVFPMVHGTALQGLLELLNLPYVGAVQSSAVCMEKDLTKTVLRAGGIPVVDWHTLSPDRWGTSELFVKAVSLGSSVATLPVKTETEFTKAVKRYDDRLMVEPRIR--GREIECAVLGNGLPGEIIPHHDYYSYDAKYLDPNGATTTSVTKQIQQIAIDAFKMVHCGMARVDFFVTPNNKVLVNEINTIPGFTNIS-EASGLPCPNLLDQLIELAIDRHQEQQKLI 362
13 -25.700IDP91879 gene: vanG; D-Ala:D-Ser ligase [Enterococcus faecalis] AAQ16273 [Enterococcus faecalis]  ali follow..  14  97...........................................................KVDLVFPVLHGKTLQGIFELAGIPVVGDTLSSALCMDKDRAHKLVSLAGISVPKSVTFKREANLTYPLFIKPVRAGSSFGITKVIEKQELDAAIEEHDTEVIVEETIN--GFEVGCAVLGIDRVDEIELSSGFFDYTEKYTLKSSKIYMEAEKRIQEAAVTIYKALGCGFSRVDMFYTPSGEIVFNEVNTIPGFTSHS-KGIGLSFSQMLDKLIGLYVE......... 349
14 -25.600IDP91878 gene: vanB; VanA protein [Enterococcus faecium] pVEF1_014 [Enterococcus faecium]  ali follow..  18  1.....MNRIKVAILFGGCSEHDVSVKSAIEIAANINKEKYEPLYIGITKVKKNHEYEINHVDVAFSALHGKSIQGLFELSGIPFVGCIQSSAICMDKSLTYIVAKNAGIATPAFWVINKDDTFTYPVFVKPARSGSSFGVKKVNSADELDYAIEQYDSKILIEQAVS--GCEVGCAVLGNSEVDQIRLQYGIFRIHQEVEPEKGSENAEERGRIQETAKKIYKALGCGLARVDMFLQDNGRIVLNEVNTLPGFTSYS-AAAGIALPELIDRLIVLALKG........ 343
15 -24.900IDP90640 gene: ddl; D-alanyl-alanine synthetase A [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0798c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  19  86...........................................................ECECVINLIHGRKIAALFEFYSIKFIGRLEASVLSFNKELTKLYAKSVGVKTLDYTILRKNQKLSFPCIIKPARLGSSIGISIVKDEKDLEYAKDEFDNDLVVEEFKNN--KEYNLAGCMINSIIEEPKKKEFLDFEQKYLSFSGHNELELKEKLKDSFKKIYNPLFKALIRCDFFIL-DNEIYLNEINPNPGSLANY-TTLNALADQISLEKMIKINYNFLHSI... 339
16 -22.600IDP02255 gene: cphA; cyanophycin synthetase [Francisella tularensis subsp. tularensis SCHU S4] FTT1130c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  14  174..........................STASLVEAAKKRDIPYIRLNDQSLV----------------QFGYGKYQQRIRATITGKTTSIAVDLSCDKEQTNTILSSLGLPVPKQRMVTTEEGLGFPLVVKPLDGNHGRGISILKTIEEIKEAANKVSRYVLLEQYVI--GFDHRMLVVDGKLIAVAKRVPGH---TANLSTGGTAIDVIVHPDNRDMAERAIKAIGLDVGGVDFLIDDISQSYICECNAAPGFRMHVAPSEGKDVAGAVIDMLIPREYGNARIPIAA 498
17 -21.000IDP04418 gene: purT; phosphoribosylglycinamide formyltransferase 2 [Francisella tularensis subsp. tularensis SCHU S4] FTT1767c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  15  18............................KEFIIAAQRLGIHTIVVDRYK-ALEQLILAKNPTYIVIEAINTDSLVKLEAHNFNIIPCAKAAKLTMDRQGIRALAQQLNLQTSKFAFANSEQEYGLPFVIKPVMSSSGKGQSIVKEHNEIKKAWDYAAKGVIVEQFIDFD-YEITLLTVDGTSFCDPIGHIQKDGDYRFSWQPHTMPD-TALAKSQEIAKEITDALGYGVFGVELFIK-GDEVFFNEVSPRPHDTGVTLISQNINEFELHLRAIVG............ 302
18 -20.000IDP02449 gene: purT; phosphoribosylglycinamide formyltransferase 2 [Yersinia pestis CO92] YPO1775 [Yersinia pestis CO92]  ali follow..  11  25............................KEVAIECQRLGLEVIAVDRYA-ALKQLVAQEKPHYIVIEAIATDMLVELEKMGQHVVPCAEATRLTMNREGIRRLAAETQLPTSSYRFADTDSAFGYPCIVKPVMSSSGKGQSLIRSEEHLQAAWEYAQQRVIIEGLVHFD-FEITLLTIGIHFCAPIGHRQEDGDYRESWQPQAMSD--IALQRAKEISAQVVTALGFGLFGVELFVCGDD-VIFSEVSPRPHDTGVTLISQNMSEFALHVRAFLG............ 309
19 -19.200IDP00922 gene: purK; phosphoribosylaminoimidazole carboxylase ATPase subunit STM0533 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  14............................RMLRQAGEPLGIAVWPVGLDA---EPTAVPVQQSVITAEIERWPETALTRELAHPAFVNRDVFPIIADRLTQKQLFDKLGLATAPWQLLTSTDEWGELAIIKRRVGYDGRGQWRLRADETGQLPDDCYGE-CIVERGIHFS-GEVSLVGADGSTVFYPLTHNLHQDGILRTSVAFPQANAEQQEQAESMLSAIMQALNVGVMAMECFITPEG-LLINELAPRVHNSG................................ 247
20 -18.200IDP02328 acetyl-CoA carboxylase biotin carboxylase subunit [Bacillus anthracis str. `Ames Ancestor`] GBAA2548 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  10  86...................................................................SENPSFPVRCKEEGIVFIGSEEIITKMGSKIESRIAMQAADVPVVPEEAIEIAKQIGYPLMLKASAGGGGIGMQLMETEQTLTKAFESNKTRMYLERYIADA-HHIEIQLLAGNTVYLWERECSVQRRNQKVIEEAPSPFLGTRKAMGEIAVQAAKALGYTNAGVEFLVDEQKNFYFLEMNTRLQVEPVTEEITGLDLVEQQLLIAYGEKLSFTQDDI.. 328
21 -18.200IDP90722 gene: accC; biotin carboxylase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1290c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  11  87...................................................................SENQNFVEICAKHNIKFIGSVEAMNLMSDKSKAKQVMQRAGVPVIPEAAKKLAKEIGYPVILKAAAGGGGRGMRVVENEKDLEKAYWSAESEMYMEKYIQNP-RHIEVQVIGGNVIHVGERDCSMQRRHQKLIEESPAILLKTRTRLHETAIKAAKAIGYEGAGFEFLVDKNLDFYFIEMNTRLQVECVSEMVSGIDIIEQMIKVAEGY........... 320
22 -18.100IDP00671 gene: carB; carbamoyl phosphate synthase large subunit SACOL1215 [Staphylococcus aureus subsp. aureus COL]  ali follow..  11  3....KRNDIKTILVIGS--QAAEFDYAGTQACLALKEEGYRVILVNSNPATIMTDKEIADPDALLPTAIQLHESGVLQDNNVQLLGELTSIQQAEDREMFRTLMNDLNVPVPESDIVNTVEQVGYPLIVRPAFTMGGTGGGICHNDEELHEIVSNGATQCLLEKSIAGF-KEIEYEVMRDKNDNAIVVCNMENIDPVGIHTGDSIVVAPSQQMLRDVSLKVIRALGIGGCNVQLLDPHSFDYYIIEVNPRVSRSSLASKATGYPIAKLAAKIAVGLTLDEMLNPI.. 338
23 -18.000IDP04479 gene: purK; phosphoribosylaminoimidazole carboxylase ATPase subunit PurK [Yersinia pestis CO92] YPO3077 [Yersinia pestis CO92]  ali follow..  13  14............................RMLRQAGEPLGIAVYPVGLDA---EPEAVPYQHSVITAEIERWPETALTRELAHTAFVNRDIFPRLADRLPQKQLLDSLGLATAPWQLLSSASEWGELAIVKRRVGYDGRGQWRLRPGEQGTLPPDA-YGECIVEQGINFS-GEVSLIGAQGESVFYPLTHNLHEDGILRMSVALPQPNSKLQQQAEKMLSAIMDKLNVGVMAMECFIVGDR-LLINELAPRVHNSG................................ 247
24 -17.700IDP04645 gene: purK; phosphoribosylaminoimidazole carboxylase ATPase subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0897 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  15  13............................RMLSLAGTPLGLEFHCLGKNG---DVVAWAKQFDVITFENENISHELIKANHEVSVYPSAKAIAISQDRLLEKSFMQDHGIATAKFVNIDSLAKLGLPAILKTRRGYDGKGQFVIRSQEDITKAWDVLPDGLIYEAFVDFD-YEVSQICTADLKGNIAFYPLARNTHKQGIIVESEAPFEVLAEKAQQIAKILVKEFAVGTLAIEFFVKGDE-LIVNEIAPRVHNSG................................ 268
25 -17.600IDP90592 gene: carB; carbamoyl phosphate synthase large subunit [Vibrio cholerae O1 biovar eltor str. N16961] VC2389 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  3....KRTDIQSILILGA--QACEFDYSGAQACKALREEGYRVILVNSNPATIMTDPEMAD-QTALNCALALEKHGVLAEFGVEMIGTADAIDKAEDRSRFDKAMKSIGLECPRADTAKSMEEVGFPCIIRPSFTMGGSGGGIAYNREEFEEICTRGTNELLIDESLIGW-KEYEMEVVRDKNDNCIIVCAIENFDPMGIHTGDSITVAPAQQIMRNASLAVLREIGVETGGSNVINPKDGRMVIIEMNPRVSRSSLASKATGFPIAKVAAKLAVGFTLDELMNDI.. 339
26 -17.200IDP90725 acetyl-CoA carboxylase biotin carboxylase subunit [Vibrio cholerae O1 biovar eltor str. N16961] VC0295 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  86...................................................................SENADFAEQVERSGFIFVGRAETIRLMGDKVSAINAMKKAGVPCVPAKNKAHAKRIGYPVIIKASGGGGGRGMRVVRNEAELTKSIQMTRAEVYMEKFLENP-RHVEVQVIAGNAIHLAERDCSMQRRHQKVVEEAPAPGIEMRKFIGERCTRACIEIGYRGAGFEFLYE-NGEFYFIEMNTRIQVEPVTEMITGVDLIKEQLRIAAGQPLSFKQEDI.. 328
27 -17.100IDP02748 gene: accC; acetyl-CoA carboxylase biotin carboxylase subunit [Bacillus anthracis str. `Ames Ancestor`] GBAA4408 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  86...................................................................AENADFAELCRECNLIFIGSPEAISKMGTKDVARDTMKEAGVPIVPEEAIELANQIGYPVIIKATAGGGGKGIRVARHEEELVKGIQITQQEVYLEKYVEDF-RHVEIQIMAGNAIHLGERDCTIQRRLQKLLEESPSPALNVRKQMGEAAVKAAVAVDYTGAGVEFIYEKTKSFYFMEMNTRIQVEPVTEMVTGVDLIKEQILVASGEKLSLQQEEV.. 329
28 -16.400IDP90807 gene: carB; carbamoyl phosphate synthase large subunit [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0279 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12  3....KRTDIKSILLIGS--QACEFDYSGTQAAKTLKELGYRVVLINSNPATIMTDPEFADIDAILPTNVAMEVYESGLLGDVKFLGNPEAIKKGEDRQVFKECMKKIGMDLPKSMYAYNYDEIDFPLMIRASYTLGGAGSGVVYNMDEFKELTNTAIHEILIEESLLGW-KEYEMEVIRDRADNCIIVCSIENIDPMGVHTGDSITIAPALQVMRNASFAILREIGVDTGGSNVINPKNGRMIVIEMNPRVSRSSLASKATGYPIAKVATLLAVGFSLDEIKNDI.. 337
29 -16.000IDP04310 D-alanine--D-alanine ligase, C-terminus [Bacillus anthracis str. Sterne] BAS0231 [Bacillus anthracis str. Sterne]  ali follow..  21  4................................................................................................................................................................................................................EESNVIKRDAIVAFQSLDGGLTRADFFLTKDGEVYINEVNTMPGFTPFS-QHTGLPYPELIEELIRLAMERHEEKQKIK 88
30 -14.700IDP04490 gene: purD; phosphoribosylamine--glycine ligase [Yersinia pestis CO92] YPO3729 [Yersinia pestis CO92]  ali follow..  53...........................IAGLLAFAQSHDIGLTIVGPEAPLVI------------------GVVDAFRAAGLAIFGPTQAAQLEGSKAFTKDFLARHNIPSAEYQNFTDVEAAGAPIVIKADGLAAGKGVIVAMTQEEAETAVNDAGHRIVVEEFLDGEEASFIVMVDGENVMATSQDHKRVGDGDTGPNTGGMGAYSPAPVVTDDVHQRVMDQVGNIYTGFGLMISADGQPKVIEFNGDPETQPIMLRMRS-DLVELCLAGTQGKLNE........ 321
31 -14.700IDP90620 phosphoribosylamine--glycine ligase [Vibrio cholerae O1 biovar eltor str. N16961] VC0275 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  53...........................IPALVAFAQDKAIELTIVGPEAPLVI------------------GVVDAFRAAGLPIFGPTQAAQLEGSKAFTKDFLARHNIPTAAYANFTEIEPAGAPIVVKADGLAAGKGVIVAMTLQEAEDAIQDAGSRVVVEEFLDGEEASFIVMVDGENVMATSQDHKRVGDADTGPNTGGMGAYSPAPVVTQDVHDRVMREVGNTYTGFGLMIDSTGAPKVIEYNGDPETQPIMMRLQS-DLVELCQAAIAGKLDQ........ 321
32 -13.800IDP04425 gene: carB; carbamoyl phosphate synthase large subunit [Bacillus anthracis str. `Ames Ancestor`] GBAA4025 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  1MPKRLDINTILVIGSGPIVQAAEFDYSGTQACQSLKEEGYKVILVNSNPATIMTDTATERPDAILPTAVELAKSGVLEECGVEILGKLSAIEQAEDRDLFRTLMQELNEPTPPSEIIHNLDEIGYPVIVRPAFTLGGTGGGICHNEEELIEIVTSGVTQCLLEKSIA-GCKEIEYEVMRDSNDNAIVVCNMENIDPVGVHTGDSIVVAPSQQMLRNTSLRIIRALGIGGCNVQLLDPYSFQYYVIEVNPRVSSSALASKATGYPIAKLAAKIAVGLTLDEIVNPVTQ 340
33 -13.100IDP90274 carbamoyl phosphate synthetase II [Toxoplasma gondii ME49] TGME49_015260 [Toxoplasma gondii ME49]  ali follow..  13  509IKALKEQNIFVVVVNPNIATVQTSQHMADRVYFLPVTDEFVTKVIEKEMILCTFGGQTA-----LNCAVKLHEQGVLAKFGCKILSPIEAIIATEDRKVFAAKLEEIGEKVAESAAATNAKAIGYPVLIRAAFALGGLGSGFAEDEETVRRICKEASSQVFVDKSLK-GWKEVEYEVVRDCKNNCITVCNMENLDPLGIHTGDSIVVAPSQYRLRDTALKVIRHFGIGECNIQYLDPNSEKYYIVEVNARLS--ALASKATGYPLAYIAAKLALGS........... 802
34 -12.900IDP04230 gene: purD; phosphoribosylamine--glycine ligase [Clostridium perfringens ATCC 13124] CPF_0678 [Clostridium perfringens ATCC 13124]  ali follow..  10  51...........................ICDLLKFAKNNNIDLTIVGPEEPLIN------------------GIVDAFKGEGLKIFGPDKGAMLEGSKSFSKDFMKKYGVKTADYEVFYDYEEAKYPRVIKADGLAAGKGVVICENKNQAIETLDLAGKKIVVEEFLQGIEASILSVTDGKVIFLSAKDHKQIFDGNKGKNTGGMGVISPNKYVTEEVLADFYENIGFDFKGVGIMITEEG-AKLLEYNGDPETQSVLSLMES-DLVDIILNALDEKLNE........ 318
35 -12.700IDP02239 gene: purD; phosphoribosylamine--glycine ligase [Bacillus anthracis str. `Ames Ancestor`] GBAA0299 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  51...........................FDALVLFAKENHVELTFVGPEIPLMN------------------GIVDRFKEEGLRVFGPNKAAVIEGSKAFTKELMKKYNIPTAAYETFTDYEEAGAPIVIKADGLAAGKGVTVAMTLEEALQAAKEASKKVVIEEFLDGQEFSLMAFVNGTTVMVIAQDHKRAFDGDKGPNTGGMGAYSPVPQISESAVQEAIETVNRSFTGIGLILTNDG-PKVIEFNGDPETEVVLPRLEN-DLVDVCNAVLDESELT........ 318
36 -12.000IDP90869 gene: purD; phosphoribosylamine--glycine ligase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1250 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  11  49...........................PVVLATYAKEKGFDLCIVGSESFLAE------------------GVVDIFKQQGLAIFGPSKAAMLETSKSFMKSFLKKYRIKTAKFLNTNDIEKATPPIVVKADGLCAGKGVIIAKTHEEAIEETAKAGKLVVIEEFLDGYELSIFAVCDGNDFLPAAQDHKKLLDNDQGPNTGGMGAYAPSSLANESLLRKVQKDIGAEFCGVGAMIVGNK-PYVLEFNVRFG................................... 287
37 -11.700IDP04357 gene: purCD; fusion protein PurC/PurD [Francisella tularensis subsp. tularensis SCHU S4] FTT0894 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  381...........................CDEVLEYAKSQSIDIAIIGPEAPLEA------------------GLADALKTAAIGVVGPTKLAQLETSKGFTRDLIRDYDIGANPFFRKFNSKKYQNQFVIKADGLCGGKGVLVWGDHLHSLDEAIRAGKEFVIEEKLVGQEFSLISFADGKNFIHM-HKRAHEGDKGPNTGMGTYSDANHSLPFLSAADIERAKQIGEPYQGIGFMATKDD-TKVIEYNGDPEAMNLLTLLET-DFVEIAQAITQGKLDT........ 651

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 8 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Sikora S, Godzik A. Combination of multiple alignment analysis and surface mapping paves a way for a detailed pathway reconstruction--the case of VHL (von Hippel-Lindau) protein and angiogenesis regulatory pathway. Protein Sci. 2004 Mar;13(3):786-96. Epub 2004 Feb 06.