current user: public

If you have questions about the server, please let us know.

Query: gi|12044864|ref|NP_072674.1|(removed signalp:1-25) ABC transporter, ATP-binding/permease protein (MG_014) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .
# Score Template Links and tools%idFirst QIVIDLIIPSFLASAISVVFSIDKLKQDESGGKTISVDFIGGANINFANVREAQIVLATTVILLALCGLFFGLISIYCASYVSANTSFLLRKKIFAKLMRITTPSHDHYGSSTLLVRLTNDVYLMEVIAFDFLRLIIRAPLLFIGGLVFAVTTNQDMSISLLITFPLILLVIGILNRKSIPLFKENQKSVDKINERVEEDVSGYKVIQSFNLHSFTNNKFKIANEGWKKNSTSSLFINSLNIPFTFFLSSLTIIIALLLVFQLDSSVSVDPLPQDAAIRPNIFAFFQYNFYIVLGFILTSLTMVNFNRSRVALGRIKDILSQPEIKTITNKDQKELLPTLEFRNISFGLGNKNNNNFLQNLSFKFEAYKTYGIVGPTGSGKSLIANIIGGLYEPNEGEILIGGEKIQSIDSLYLSEMIGIVFQQNILFKGTISSNIKIGIETRSDWKNQSDLQKNEAMKNAAKIACADTFIEKFSDSYDHNVEQLGKNLSGGQKQRVAIARTLITKPRILVFDDSMSALDALTEKKVRENIENDLKLTTKIIISQNINSIKHADKILVIDNGRIVGFDSDQKLMKNCSLYQKMKESQKDLGGDFDAVNLast
1 -125.000IDP91071 putative ABC transporter, ATP-binding protein [Neisseria gonorrhoeae FA 1090] NGO2165 [Neisseria gonorrhoeae FA 1090]  ali follow..  19  19MRLMAYVRPYIVAALIAIFGVAATESYLAAFIAPLINHGFSAPAYMVWGTENKIWTVPLFLIILVVIRGICRFTSTYLMTWVSVMTISKIRKDMFAKMLTLSSRYHQETPSGTVLMNMLNLTEQSVSNASDIFTVLTRDTMIVTGLTIVLLYLNWQLSLIVVLMFPLLSLLSRYYRDRLKHVISDSQKSIGTMNNVIAETHQGHRVVKLFNGQAQAANRFDAVNRTIVRLSKKITQATAAHSPFSELIASIALAVVIFIALW--------QSQNGYTTIGEFMAFIVAMLQMYAPIKSLANISIPMQTMFLAADGVCAFLDTPPEQDKGTLAPQRVEGRISFRNVDVEYRS-DGIKALDNFNLDIRQGERVALVGRSGSGKSTVVNLLPRFVEPSAGNICIDGIDIADIKLDCLRAQFALVSQDVFLFDDTLFENVRYSRPDAGE----------AEVLSALQAANLQSLIDASPLGLHQPIGSNGSNLSGGQRQRVAIARAILKDAPILLLDEATSALDNESERLVQQALERLMENRTGIIVAHRLTTVESADRIIVMDGGKIIEQGTHDQLMFQNGYYTMLRNISGKDTAAVQTA. 622
2 -123.000IDP91077 gene: msbA; Lipid A transport protein, ABC transporter,ATP-binding and membrane protein [Francisella tularensis subsp. tularensis SCHU S4] FTT_0109 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  23  33KRLLLQVKHLLLLAAIGSIFFSAADASMIYLINPILNYGFGPGGGITKQSATILMLMGVGMVGLLALRSVGSFVSQYFIGSLGQKVVYKFRKDIYKRLMDLPASFFDKHSTGQIISRLLYNVDQVIEATSTAIITVVQDGTFVIGLIVVMFVSSWQLSLFLIVVGPFLGLFISIINKKFRNLSRNTQSSMGNVTHTAEETIRNYKEIRIFGAQQKQQNKFFKNLDYTYSQQIRTIALDALTSPVIQIIASLVLAFSLFTIAIFGTN---EGDGSSWLTAGSFASFFAAAAAILKPIKNLTKVNVVIQKAVAATEDIFYILDYPAEKETGSKELAKVDGNVTIKDLSFAF---GEHKVLSGVSVDIKAGQTVAFVGKSGSGKTTLTSIISRFYTQHEGEILLDGVDTRELTLENLRSHLSIVSQNVHLFDDTVYNNIAFGL---------SREVSEEEVIDALKRANAYEFVQELSDGINTNIGNNGSKLSGGQRQRISIARALLKNAPVLIFDEATSALDNESERVVQQALESLTKSCTTIVIAHRLSTVENADKIVVMDGGRVVESGKHQELLEQGGLYTRLYQSGLQ......... 609
3 -123.000IDP91083 ABC transporter, ATP-binding/permease protein [Bacillus anthracis str. Ames] BA_0528 [Bacillus anthracis str. Ames]  ali follow..  22  5KRYLQFVKPYIAITIMIGLVKFGIPLIMPWLLKYIIDDVIQGAGSLQDKTSQLVTAIGIAFFIFAVLRPPIEYYRQYFAQRIANTILYDLRKHIFGHLQKLSLRYYSNTKTGEIISRVIHDVEQTKDFVITGLMNVWLDTATIAIAIIVMFSMNIKLTFVALLILPIYVVAVKYFFGRLRKLTKERSQALATMQGYLHERIQGMQVTRSFALEEYEGKQFEKRNNEFLTKALTHTSWTARTFSAVNTLTDLGPLLVIGFAAY--------EVIQGQLTLGTMVAFVGYMDSLYSPLRRLVNSSTTLTQSFASMDRVFELLDEKYDIVNSAVQTKKLNGEVIFDNVSFRYNA-DEKEILHNLSLTMLPGEKVALVGASGGGKSSLASLIPRFYDVSSGAVYVDGIDVRKYDMRNLRSHIGIVLQDNLLFSDTIGANILYGNPKATE----------EEVIAAAKAAQIHDFIIELPDGYDTVVGERGVKLSGGQRQRVAIARVFLKNPSLLILDEATPALDLENERYIQEALQTLAADRTTIIIAHRLATITHVDTIIYIEDGEIKETGSHEELMKKRGYYYNLYQLQHITETAPLA.. 586
4 -123.000IDP91078 ABC transporter, ATP-binding/permease protein CBU_0856 [Coxiella burnetii RSA 493]  ali follow..  22  20GRLLQATKQYFLIGVVGMIAVSLSDAGFTWLIKPIINRGF------IARDLVFIRWLPFIIVLVFLFRGAANFLSTYFINRVARNIVMDFRRAIFSHLLRLPAEFYDRHSSGHLLSTVIYNVEQVAQASSDALIITLQASSLVVGLLVVMFLVSWKLTLFFLVITPLIAWVMRVCSARLRHLSTSVQKSVGEVTHIASEAIEAYKIVRLYGGQKYENEKFRHATKLNQQRELKVVVTNSVGTSLVQLLIAIPIAIVLFFATQPS----------FHVTAGSFASIVSAMIMMLRPVRRLTMVNSYIQKGIAAAESIFKLLDEDVEKDRGERHLVRARGAIEYQGVSFAYDN-SKKTILSEISFSIEPGQMVAIVGRSGAGKSTLINLLPRFYDASTGVIKIDDINIKEFRLQELRNQFGLVSQHTTLFNDTILNNIAYGQAGSID---------KRKIIEAARAAHAMEFIEQLPEGLDTVIGENGVRLSGGQRQRIAIARALFKNAPIHILDEATSSLDTHSERHIQAALDNLMDQCTTLVIAHRLSTIERADWIMVLEEGRLIEKGTHQQLLTLNGAYAELYRMQFAEKPAAMT.. 592
5 -122.000IDP91074 ABC transporter, ATP-binding protein [Mycobacterium smegmatis str. MC2 155] MSMEG_5659 [Mycobacterium smegmatis str. MC2 155]  ali follow..  21  35SLLISLLRPYVAVLALVVIVENAARLSVPVLVQRGIDHGIPPIL--AGGPARELMVIVATLCAVVLVQATSRMFFLRRSGRVGQKVLLELRRRVFRHFQRLDLAFHDRYTSGRVVSRSTNDVEAIQDMLETGFDSLITAVLTLFGTAVLLVVLDWRLGLMCLAAFPILVALVWWFRNESARTYRKVRESAALVIVQFVETMTGIKAVQAYRREPRNQEIFSDIADDYREINEKTFKLLAIFMPGVKLVGNITTGVVLIYGGYR--------VLNDQMTIGTLAAFLLYLRMFFEPMQEISQFFNTFQSASSALEKLAGVLAQRPGIADPEVALHAVAGTITFDHVHFAYA--PGRPVLPDLTLTVPAGQTVALVGTTGAGKTTIAKLIARFYDPTSGTVTLDGVDLRDLSQSELRRHVVMVTQENFMFEGTVADNIRFGRPDATD----------AQVRAAAEAVGADRFIATLPEGYGTDVAKRGGRLSAGQRQLIAFARAFLADPAVLILDEATSSLDIPSERMVQRALETVLADRTALVIAHRLSTVQIADRVLVLEHGRIIEDGSPADLIGRDGAYAALHRAWVDSLA...... 610
6 -122.000IDP91081 ABC transporter, ATP-binding/permease protein [Clostridium difficile 630] CD2817 [Peptoclostridium difficile 630]  ali follow..  22  12GRLLPFVKKYFIIAIICIISAATMNALAPKTEGLIITQLTKDVIPGASVNFDYVTKILVILACIYFANAIFTYTSSFLLTNAIQNTMRDLRNEVENKIRRLPISYFDSNSFGDVLSRISNDVDTISNALQQSFMQIVNSILVIILALSMMFTINIYMALIALFIIPISYFVSKFVVKKSQSRFSLQQNALGKLNGKVQEMYTGFNEIKLYGKEEDSIKEFKKVNQELCENGFKAQFISSMMNPMVSLVTYFGIAAVAVVGSIY--------AVSGGITVGNLQAFVRYIWQINQPLSQMTQLSTVIQSSFAAIERVFEILDEEEEIPDNPVKIENVKGNVTFEHVNFGYG--ENSTLIEDLNAEVKSGQMVAIVGPTGAGKTTLINLLMRFYDVKKGAIKIDGVDIRDMKRKDLRSMFGMVLQDTWLFNGTIFENIEYGRFGATK----------EEIIQAAKVANVHHFITTLPDGYNMFLNEEASNISLGEKQLLTIARAFISDPSILILDEATSSVDTRLELMLQKAMRNLMNGRTSFVIAHRLSTIRNADLILVMNNGSIIEQGNHDELMEKGGFYEKLYNSQFADKESE.... 596
7 -122.000IDP91084 ABC transporter, ATP-binding/permease protein [Bacillus anthracis str. Ames] BA_2444 [Bacillus anthracis str. Ames]  ali follow..  25  30MRVWNYMGYQLTFVIFLVLVTTLLGLLGPYLMGVIIDQYI------VPKDVSGTARMCLLLIAIYGVTVLLTWLQTFVMVNVALKTIQKIRQDIFKKIQTLSLRFFDVRSQGDLMSRVTNDIDNLNQALTQSVVQIISSALTFIGVTIAMFALDWILAIVTLITVPIMFFVTKKLVAYSGKNFAKRQKDLGELNGFIEEAITGADVTTLYGKEKETVQKFNKINEQLRVSATKADTFSAFIFPSMNFINNLGMGLVIGTGSVM--------VLNGMTTVGVIAAFINYSRQFSRPLSQFATLMNTIQAAVAGGERVFEIMDEVPEIKNDAFVIQNLHGHVALENVSFGYE--ENKTILKEVSLKARPGETIALVGPTGSGKTTIINLLTRFYDVQQGQIYIDEKNIKEYDLNSLRSKIGVVLQDTYLFAGSIMDNIRYGRLDASD----------EEVINAAKAASAHSFIKHLPNQYETKIATEGSNLSQGQKQLLAIARAILADTDILILDEATSNIDTRTELQIQEGLNNLMRGRTSFVIAHRLKTIEKADQILVIKDGSILEKGNHESLMEDRGFYFDLYTSQFK......... 597
8 -122.000IDP91941 ABC transporter, ATP-binding/permease protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100000177 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  22  5QFFWHYFKVYFVVVILMIVLATFAQALFPVFSGQAVTQLANLVQANPELVWQSLSGIMVNLGLLVLVLFISSVIYMCLMTRVIAESTNEMRKGLFGKLAQLTVSFFDRRQDGDILSHFTSDLDNILQAFNESLIQVMSNIVLYIGLILVMFSRNVTLALITIASTPLAFLMLIFIVKMARKYTNLQQKEVGKLNAYMDESISGQKAVIVQGIQEDMMAGFLEQNERVRKATFKGRMFSGILFPVMNGMSLINTAIVIFAGSAVLLN---DKSIETSTALGLIVMFAQFSQQYYQPIIQVAASWGSLQLAFTGAERIQEMFDAEEIRPEKAPTFTKLQESVEISHIDFSYL--PDKPILKDISISAPKGQMTAVVGPTGSGKTTIMNLINRFYDVDAGGIYFDGKDIRGYDLDSLRSKVGIVLQDSVLFSGTIRDNIRFGVPDASQ----------EMVEVAAKATHIHDYIESLPDKYDTLIDDDQSIFSTGQKQLISIARTLMTDPEVLILDEATSNVDTVTESKIQHAMEVVVAGRTSFVIAHRLKTILNADQIIVLKDGEVIERGNHHELLKLGGFYSELYHNQFVFE....... 588
9 -121.000IDP91082 ABC transporter, permease/ATP-binding protein [Clostridium perfringens ATCC 13124] CPF_1776 [Clostridium perfringens ATCC 13124]  ali follow..  22  16KRLLKYVAPYTIGIILMLLLIMSCNTLNPYLMKVSIDKFV------SAKDVNGLLGIGAVLLLLNIIAMILSKIRMLSMSKITNQILVNIRHELYTHIQTLSFSFFDSRPVGKILSRVVGDVNALNNLLNHSIVNLIPNLFTILLVIFMMFLMDPSLTLVCLTVLPFLFAGMFFIEIKSNKRWRVFRENRSALLGYTHEAFSGMKVVQGFNREEYSREKFENHLEGHAGGFLHAVRLQDYFWPTVDICRGFGIAIVLFAGYKL--------TRGGNLSLGTLMAFIMYIEMLWRPIMNLSAFYNAFVTNLSAAERIFDIMDTKNHMVNAEEKLPKIKGEIHFEDVTFSYDN-DGNHALKDVTFTLNPGEKIALVGETGAGKTTITNLISRFYEPTKGKIFIDGIDISTVDVESLRSQMGIMLQDSFLFASSIKENIRYGKLDATD----------EEIIQAAKAVNAHNFIEKLEEGYNTNVNERGSRLSLGQRQLIAFARALISDPRILILDEATANIDTETERLVQEGIKKLMEGRTSIVIAHRLSTIRDCDKIFVLSHGKIVEDGTHEELLNRKGYYYNLYCAQYSFLKEE.... 589
10 -121.000IDP91076 fused lipid transporter subunits of ABC superfamily: membrane component/ATP-binding component [Haemophilus influenzae PittII] CGSHiII_09046 [Haemophilus influenzae PittII]  ali follow..  27  18KRLWPMIKPFLIVSGVALVFNALADSGLIYLLKPLLDDGFG------KANHSFLKMMAFVVVGMIILRGITNFISNYCLAWVSGKVVMTMRRRLFKHLMFMPVSFFDQNSTGRLLSRITYDSEEIASSSSGSLITIVREGAYIISLFAVMFYTSWELTIVLFIIGPIIAVLIRLVSKIFRRLSKNLQDSMGELTSATEQMLKGHKVVLSFGGQHVEEVHFNHVSNDMRRKSMKMVTANSISDPVVQVIASLALATVLYLATTPL-------IAEDNLSAGSFTVVFSSMLAMMRPLKSLTAVNAQFQSGMAACQTLFAILDLEPEKDDGAYKAEPAKGELEFKNVSFAYQGK-EELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYDIEQGEILLDGVNIQDYRLSNLRENCAVVSQQVHLFNDTIANNIAYAAQDKY---------SREEIIAAAKAAYALEFIEKLPQGFDTVIGENGASLSGGQRQRLAIARALLRNSPVLILDEATSALDTESERAIQSALEELKKDRTVVVIAHRLSTIENADEILVIDHGEIRERGNHKTLLEQNGAYKQLHSMQFT......... 586
11 -121.000IDP91073 gene: msbA; probable transport ATP-binding protein YPO1395 [Yersinia pestis CO92]  ali follow..  23  14RRLWPTISPYLIVAAIALILNAASDTFMLSLLKPLLDDGF------GNSNSSILKWMPLAVIGLMVVRGVTGFVSSYCISWVSGKVVMHIRRRLFSHMMGMPVSFFDQQSTGTLLSRITYDSEQVAASSSSALVTVVREGASIIGLFIMMFYYSWQLSLILIVIAPIVSISIRLVSKRFRNISKNMQNTMGEVTTSAEQMLKGHKEVLIFGGQKVETERFDAVSNRMRQQGMKLVSASSISDPIIQLIASFALALVLYAASF--------PSVMETLTAGTITVVFSAMIALMRPLKSLTNVNTQFQRGMAACQTLFSILDMEQEKDEGKLEVERAKGDIEFRHVTFYYPG-KDTPALNDINIHLEAGKTVALVGRSGSGKSTIANLLTRFYDVSEGSILLDGHDLRDYRLGALRNQVALVSQNVHLFNDTVANNIAYARNEQY---------SRAEIEEAARMAYAMDFINKMEHGLDTVIGENGIMLSGGQRQRIAIARALLRNCPILILDEATSALDTESERAIQAALDELQKNRTSLVIAHRLSTIEKADEIVVIEDGRIVERGVHAELLVQQGVYAQLNRMQFGQ........ 582
12 -121.000IDP91899 ABC transporter, ATP-binding/permease protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002520 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  30  2..LIQKIKTYKLASLLMTGLMVASSLLQPRYLQEVLGALL-------TGKYEAIYSIGAWLIGVAVVGLVAGGLNVVLAAYIAQGVSSDLREDAFRKIQTFSYADIEQFNAGNLVVRMTNDINQIQNVVMMTFQILFRLPLLFIGSFILAVQTLPSLWWVIVLMVVLIFGLTAVMMGIMGPRFAKFQTLLERINAIAKENLRGVRVVKSFVQEKEQFAKFTEVSDELLGQNLYIGYAFSVVEPFMMLVGYGAVFLSIWLVAGM--------VQSDPSVVGSIASFVNYLSQIIFTIVMVGFLGNSVSRAMISMRRIREILDAEPAMTFKDIPDEELVGSLSFENVTFTYPM-DKEPMLKVVSFTIEPGQMVGVVGATGAGKSTLAQLIPRLFDPQDGAIKIGGKDIREVSEGTLRKTVSIVLQRAILFSGTIADNLRQGKGNATL----------FEMERAANIAQASEFIHRMEKTFESPVEERGTNFSGGQKQRMSIARGIVSNPRILIFDDSTSALDAKSERLVQEALNKDLKGTTTIIIAQKISSVVHADKILVLNQGRLIGQGTHADLVANNAVYREIYETQ........... 563
13 -121.000IDP91069 ABC transporter, ATP-binding/permease protein [Streptococcus pneumoniae TIGR4] SP_1357 [Streptococcus pneumoniae TIGR4]  ali follow..  23  24KRLAVDLASHLFLAFLGTIAQVGLSIYLPILIGQVIDQVL------VAGSSPVFWQIFLQMLLVVIGNTLVQWANPLLYNRLIFSYTRDLRERIIHKLHRLPIAFVDRQGSGEMVSRVTTDIEQLAAGLTMIFNQFFIGVLMILVSILAMLQIHLLMTLLVLLLTPLSMVISRFIAKKSYHLFQKQTETRGIQTQLIEESLSQQTIIQSFNAQTEFIQRLREAHDNYSGYSQSAIFYSSTVNPSTRFVNALIYALLAGVGAYRI-------MMGSALTVGRLVTFLNYVQQYTKPFNDISSVLAELQSALACVERIYGVLDSPEVAETGKTTSDQVKGAISFKHVSFGYH--PEKILIKDLSIDIPAGSKVAIVGPTGAGKSTLINLLMRFYPISSGDILLDGQSIYDYTRVSLRQQFGMVLQETWLTQGTIHDNIAFGNPEASR----------EQVIAAAKAANADFFIQQLPQGYDTKLENAGESLSVGQAQLLTIARVFLAIPKILILDEATSSIDTRTEVLVQDAFAKLMKGRTSFIIAHRLSTIQDADLILVLVDGDIVEYGNHQELMDRKGKYYQMQKAAAFSSE...... 596
14 -121.000IDP91068 gene: msbA; lipid transporter ATP-binding/permease protein [Vibrio fischeri ES114] VF_A0424 [Vibrio fischeri ES114]  ali follow..  22  14KRLWPHISLYLGVAVVALVINALSDTYMISLLKPLLDEGF------GSADSDFLKKMPFIILAMMFIRGLSGFVSGYCMSWVASNVVMRIRRQIFNHFMHMPVSYFDQESTGRLLSRITYDSEQVAAATSKALVNIVRESASIIGLLGLMFWNSWQLSLVLVVIAPVVAFAISNVSKRFRKISKNMQTAMGSLTATSEQMLKGHKVVLSYGGQKVESERFDNISNHMRQQNMKMVVAQGLANPIIQMIASFALVTVLYLASV--------DSIKETLTPGTFTVVFSAMFGLLRPLKGLTSVTSDFQRGMAACQTLFELMDMDKEKDDGTIEKDTVKGDIKVDNVTFTYPT-ADGPALRNVSFDLPAGKTIALVGRSGSGKSTIANLFTRFYDVDSGEISLDGDKIEDYRLPNLRKHFALVSQNVHLFNDTVANNIAYASEGKF---------TRLEIEKAAELAYASDFINKMDDGFDTMIGENGASLSGGQRQRIAIARALLQNAPVLILDEATSALDTESEKAIQSALDELQKDKTVLVIAHRLSTIEDADQILVVDEGEVVERGNHAELIAHDGAYAQLHRIQFGD........ 582
15 -121.000IDP91334 ABC-type multidrug transport system, ATPase and permease component [Vibrio vulnificus CMCP6] VV2_0179 [Vibrio vulnificus CMCP6]  ali follow..  24  13LKLSTFVSPYVAAALVALVATASLTLSVGYGVRMLIDQGFA------QQSLHELTNAIQFIVGVTLCIAIGTFFRFYLVSSVGERVSADIRLAVFNHVITLHPSYFETNSSGDIMSRLTTDTTLLQSIIGSSFSMAMRSALMCVGAIIMLFATNFKLTLIVLASVPFVLVPILVYGRRVRALSRQSQDSMADVGSYAGEAIEHIKTVQSFSSEQHEKAAFAVEVEKAYEIGRQRVKQRAILISGVIVIVFGAIAGMLWVGGSD--------VIHGKMSAGDLGAFVFYAIMVASSTATISEVLGELQRAAGATERLIEILQVESDIKAPSHQQADIPAEVSFDSVNFNYPSRPNQPAIKGLNLTAEQGKVLALVGPSGAGKTTLFELLQRFYDPQQGHVLLGGIDIRQFDPNELRQQMALVPQQPALFSHDVFHNIRYGNPDATD----------EQVIEAAKKAHAHEFIEKLPEGYHSFLGERGVRLSGGQKQRIAIARAILKDPKILLLDEATSALDSESEHHVQQALEALMKGRTTLIIAHRLSTIQHADKIAVLDNGELVDIGNHHALMQSCELYQRLVALQFKHLN...... 586
16 -119.000IDP91080 gene: msbA; lipid export ABC transport protein Cj0803 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  23  12IRFKPFYKRYFAIAIFGMILASGGTAGSFYALEPILNYIF------VEKNEALLYTVPFLLVLMYFFKNLGTYLQSFYVSFIGTDMLRVLRARVLKNVLRLDMDFFKRYRSGELVSRCTNDINALQSIVSNIIPDFFRELLTAIGLLAVVLYQSPTLAFFALVILPLAIFPLVWFAKKLKKYARNIQETNSDLLSYLGEIFSNIELIKANDNEKKESDKFAKHNDTLCKLNLKSARIDALTSPLMDMMGSVGVAVVIIVGGR--------EVINGSMSVGSFISFVSALFAIYTPLKRLSSLYGKLQGAVAASERTFYLLDLEPQIKGGSKELK-NIEKISFENVEFAYEN-PHKSVLKGVNFDFVKGQMLALVGTSGGGKSSIINLLMYFYEKQKGKILLNQEDISTFTIESLHAKIGLVTQNIYLFNDSFAANIAYSEE-----------LEEEKVIQALKLANAYEFVKEMG-GIWAEVKEHGKNLSGGQKQRIAIARALYKNPDVLIFDEATSALDNESEKAIVKTIENLKQDRLILVVAHRLSTIENADKIVVLDKGKVLAIGKDEELLQTCSLYQKFKSKEKTKPSF..... 579
17 -118.000IDP91893 ABC transporter, ATP-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100003665 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  22  12KRLMSYLKPYTFLALSFLLATTVIKSVIPLVASHFIDQYLSNLN-------QLAVTVLLVYYGLYILQTMVQYVGNLLFARVSYSIVRDIRRDAFANMEKLGMSYFDKTPAGSIVSRLTNDTETISDMFSGILSSFISAVFIFLTTLYTMLVLDFRLTTLVLIFLPLIFLLVNLYRKKSVKIIEKTRSLLSDINSKLAENIEGIRIIQAFNQEKRLQAEFDEINQEHLVYANRSVALDALFLPAMSLLKLLGYAVLMAYFGY--------RGFSIGITAGTMYAFIQYINRLFDPLIEVTQNFSTLQTSMVSAGRVFALIDETYEPLQENGQAVIKEGNIRFEHVCFSYD--GKHPILDDISFSVNKGETIAFVGHTGSGKSSIINVLMRFYEFQSGRVLLDSVDIRAYSQEELRTNIGLVLQDPFLYHGTIKSNIAMYQE-----------ISDEQVRAAAAFVDADSFIQELPQGYDSPVSERGSSFSTGQRQLLAFARTVASQPKILILDEATANIDSETESLVQASLAKMRQGRTTIAIAHRLSTIQDANCIYVLDKGRIIESGTHEELLALGGTYHKMYSLQAGAMS...... 580
18 -118.000IDP91900 ABC transporter, ATP-binding/permease protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100003670 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  23  5QKLWWFFKLEYLVGIVALVLVSVLNLIPPMVMGRVIDAITSG-----QLTQQDLLLSLFYLLLAAFGMYYLRYVWRMYILGTSYCLGQIMRSRLFKHFTKMSSAFYQTYRTGDLMAHATNDINALTRLAGGGVMSAVDASITLVTLLTMLFSISWQMTLVAILPLPFMAYATSRLGRKTHKAFGESQAAFSELNNKVQESVSGIKVTKSFGYQADELKSFQAVNELTFQKNLQTMKYDSLFDPMVLVFVGSSYVLTLLVGSLM--------VQEGQITVGNLVTFISYLDMLVWPLMAIGFLFNTTQRGKVSYQRIENLLSQSPVQDPEFPLDGIENGRLEYTIDSFAFE---NEETLTNVHFSLEKGQTLGLVGQTGSGKTSLIKLLLREYDVDKGTIYLNGHDIRDYRLTDLRSLMGYVPQDQFLFATSILDNIRFGNPNLPL----------SAVEEATKLAQVYQDIVAMPQGFDTLIGEKGVSLSGGQKQRLAMSRAMILDPDILILDDSLSAVDAKTEYAIIDNLKETRKDKTTIITAHRLSAVVHADLILVLQNGQIIERGTHDDLLALDGWYAQTYQSQQLEMKGEEDAE 581
19 -114.000IDP00214 putative toxin transport protein YPO2252 [Yersinia pestis CO92]  ali follow..  19  146SWFIPVVMKSLRNIILISLLLQAILLVTPMLFETVIDKVL------VSRGVDSLVVLGGAMVALAITEPGYTLLRSWLFAHLSSRVGAELNTQLYRHLLGLPLGYFTGQQTGQTIAKM-REMEQIRSFLTGSALTMVLDLFFVVTFIAVMFRYSGQLTGIVLISLLCYLLFWSAVGGRLRKRVAQQYETSAQATSFLTEAVSGGETIKTSATESQFNRRWRQVLARYVRASFGSSQAGNLAGQGISLINKITSAILLWFGVTL--------VLAGKLSPGELVAFNMFAGYVTQPILRLAQAWQDFQHTQIALERIGTILDSPTEPGSAGLANCKRAGSLSFKQVRFRY-RPDTAEVLQNLNLEIAGGEFIGITGPSGCGKSTLTKLMQRLYTPQHGQILVDGQDLAITDPTTLRRQMSVVLQESVLFSGSIRDNICQCRPNADE----------AHVIHIARLAGAHDFIIALPQGYQTQVGEKGGLLSGGQCQRIALARALMADPKILILDEATSALDYESEAAIMRQLPEITRNRTVICIAHRLNTLRQCHRILLLKDGQIAEQGSHEVLVASGGNYARLWQQQTE......... 712
20 -113.000IDP91075 gene: msbA; multi-drug resistance protein [Helicobacter pylori J99] jhp0343 [Helicobacter pylori J99]  ali follow..  24  6RRYSKYLKEHFIVVLFSSLVVALSTAWGTYLVKPTLDEIF------INKDTHMLKILPFLVILAYLGKSGGMYVGTYFTNFIGLDIVKKIRNAMLESLLKMEMDFFNRTKKGELIARITNDIGLIRASLSNYLSESLREGLTIVGLVGVVIYQSPKLALVGLVIMPLAAIPISKIIRKVKKLAKAHQESNAKITARLSEVFNNVEAIKISNGEKLEHRAFVKENEAFFKIGIKNIAVAEISSPLMEFLGSIAIALVIYLGGN--------EVIKGHISVGAFFSFITALFMLYTPIKRLTRIVSNFQEALVASDRIHEILEREPAIIDGELTLDDAIHTIEFKKVWLAYALEQERYVLSDINLKFQQNEIVALKGESGSGKSSLVNLILRLYEPSKGEIFINDQKIESITQKSLREKISVVTQRVFIFNGSVAENVAYGLE-----------IDEIKIKECLKKAQALDFVEKMPHGIESVLDEFGANLSGGQRQRIAIARALYKDAQVLIFDEATSALDNHTEESVKQSILELKQNRLIILISHNPSTLKLATKHVKLEHGRLIEC............................... 551
21 -111.000IDP91315 ABC-type bacteriocin/lantibiotic exporter [Vibrio vulnificus CMCP6] VV2_0482 [Vibrio vulnificus CMCP6]  ali follow..  22  2..........................................DKVLVHQAWSTLDVLVFGLVVTGVIEVVLRGLREYQYAHTANRIDIQLGLKLVKHLFGLPLMFFKSRQVGAIVTRV-RELDTVREFLTGSMFTLTVELLFMFVFLYVMSLLSGPLTWLFIATIPCYALLAWWLTPRMQAAIEKQFSHAAANTSFLTETVAGSETLKSLAVEPRFIRRWDEQTEKMVSTGYDVQQLNNRSNHLVQLLQKITSVAILWLGATE--------VLSLEMTIGQLIAFNMMTNHIAQPLARMVELWGQFIQTRVAVEKLGDMLNLPVEQH-TGSDIVTLHGAVSFKNILFRY-QPDIPPTINDLSLDIRAGETLGVVGTSGSGKSTLARLLLRLYSPEQGSITIDGIPLNHIHIQQLRQQVGVVLQENFLFNKSVSENIAQSKPDASL----------EEIIEAAKLSGAHEFILKLPMGYDTILAEGGQSLSGGQRQRLAIARTLLSDPKVLILDEATSALDDESQALIQSNMANIARGRTVITIAHRLSTVRDCDRIIVLHQGAIVEQGSHQQLLTHGKQYKQLWQLQQELKQEETTA. 535
22 -110.000IDP91072 putative ABC transport protein YPO2588 [Yersinia pestis CO92]  ali follow..  20  43KFLLPYLWPKLIIALFFMVIAKISTTLVPLAYKSMVDTLSSEN----AKMLAIPISLIIAYGVARVSASLFEELRNVMFVHVSQNATRLLGLRVFRQLHALSLRFHLERQTGGLSLSIERGTQAVSTVLSRLLFSILPILFEITLVSVIMWRLSGWFALAILVTVSCYILFTVMAVGWRTRFRRELNKANADANTKSIDSLLNYETVKYFGNEDFEAERFNLSRQLYEYAAIKNQISFTVLSFGQTAIISVGLIVMMAMAAQ--------GIVQGQMTIGDFVLVNAYLLQLYQPLNFFGFIYSEIRQALIDMENMLDLLMVKQEITDDALPLQLTKGEVRFDAVSFSYD--PRRPILNNVSFTIPPGKTVAIVGASGAGKSTLARLLFRFYDVTAGAVYLDDQDIRGVTQSSLREAIGIVPQDTVLFNDTLRYNIGYGKTDSTD----------EEIERAAKLAHIHEFIISLPDGYETRVGERGLKLSGGEKQRVAIARTILKKPSILVFDEATSALDTHTEREIQSHLREVSRDHTTLVIAHRLSTIIDADEIIVLEAGSIVERGRHDELLLKNGRYAGMWQNQYHEEEAYHEAE 627
23 -109.000IDP91070 multidrug resistance transporter ATM1 [Rickettsia prowazekii str. Madrid E] RP205 [Rickettsia prowazekii str. Madrid E]  ali follow..  22  21YLLLTYLWSKIVTSLICLVIAKVINIFVPIVYKYIIDGLNQ------NLSLSVLIGVIIGYGGTKILAQIFSELRNIIFSKVGCQATRLVALNVFKHMHNLSMRFHITRKTGGLSRSIERGTKGIEAVLRYSLFNIFPTSLEIILVIGILWYFHGIWFAVTLLITMIVYVCYTLLISTWRSFAREMNQSDNTANNRAIDSLLNFETVKYFNNEEYEAIKFNDALQAYEKSATKITNSLSILNIGQDVIISLGLVSLMILSVN--------AINQNKMMVGDLIMVNAYLFQLSIPLSILGFAYREIKNALVNMEDMFKLLDIPAEIQDDAKELIISKCKVSFNNVSFAYN--KERTILHNITFTIESGKTIAVVGSSGAGKSTISRLLFRFYDINSGSIIIDNQDIREVKQGSLRKSIGIVPQDTVLFNDTIYYNIAYGNNAASY----------DEVIAASKNAHIHEFISVLPEGYATQVGERGLKLSGGEKQRIAIARTILKNPSIYVFDEATSSLDTKTEKLIQASLKEISANHTTLIIAHRLSTIVDADEIIVLDNGYIVERGNHKTLLKNQGYYAELWYKQQEECNQDTQ.. 600
24 -108.000IDP91316 toxin secretion ATP-binding protein [Vibrio vulnificus CMCP6] VV2_1515 [Vibrio vulnificus CMCP6]  ali follow..  16  144HWFRQVLMEVYRDLLLASFVINLLAMVVPLFTMNVYDRVV------PNQAFHTLWVLSVGVIIVVVFDWVLREARSSVTDMAGRYVENKLSAQLFQKVLGMRLEQRPQ--SVGAFARQLQDFDSVKDFLTSVSLVTLVDLPFTLFFLLLIGWLGGAMMLIPLAVMAALLLLSFVMKGRLAQTFTESARLSTQRQAHVYDSLSALTDIKQNNAEGMTQKRWEQTVSALSEWQTRSRFYSNIVSHSIMSSQQVVTIALIIFGVYQ--------IAEGLLSMGGLIAIVMLSGRAASSINQLSMLMLRYQQTQTAMEGLNQIMATPQESTSHQVDRGEFHGNVALRNVSFAYPE-MQIHALEAISLDIKAGEKIGVIGNAGSGKSTLMALLARQLLPTAGQMYYETIDAQLWPPSVIRAGIGWVGQNPGLIYGTIYENITFGDQSIDE----------QRLLNAVMLSGLNDYMPRLANGLETQVGEQGRFLSGGQRQAVAIARAIYRDPAMLLLDEPTSALDKAAEECFFHALQRLPADKTLVISSHKQSFLTLCDRILVLDKGKLVAQGTPHEIFTQQGSARVRSRVKSVSVVKGGQS. 717
25 -106.000IDP91079 ABC transporter, ATP-binding/permease protein [Burkholderia mallei ATCC 23344] BMA0204 [Burkholderia mallei ATCC 23344]  ali follow..  19  25RSLLPYLSAYVAFALACLIGAKVANLGVPVVMKRIVDSLAAVQHSATVVLAGGVGLLVIAYALARLSTSLFTELREILFSKVTESAVRRLALQVFRHLHGLSLRFHLERQTGGMSRDIERGTRGIQQLISYSLYSILPTLVEVGLVLGFFVVYEAYYAYVTFAALITYIVFTVKVTNWRTHLRRTMNELDSRANSRAIDSLINYETVKYFGNEEWEAQRYDENLKRYRKAAIRSQNSLSFLNFGQQAIIGTGLVFILWRATQ--------GVLAGRLTLGDLVLINTFMLQLYIPLNFLGVVYRELKQSLTDMDRMFGLLSAAREVDDGAGALKVSGARVRFERVDFSYE--PSRQILHDVDFTIEAGSTTAVVGHSGSGKSTLSRLLFRFYDATGGAITIDGQDIRDVKQETLRASIGIVPQDTVLFNDTIYYNIAYGRPSATR----------DEVIAAARAAHIHAFIESLPKGYDTPVGERGLKLSGGEKQRVAIARTILKNPPILVFDEATSALDSRSERAIQHELDQIARHRTTLVIAHRLSTVVHADQIIVMDHGRIVERGTHAQLLRADGLYAQMWALQQQRAAADGAAA 620
26 -100.000IDP04221 putative ABC-type bacteriocin/lantibiotic exporter [Salmonella typhimurium LT2] STM4262_1_688 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  17  141NIIKNSLSMNYTKYFFSSLFMAIFALTIPVFSNLFYDKLV------PSASVSSLFGVAIIVAVFIVFEFILRTSKDIYQSITARQDDVDIDIAFLEAVLYSKKKNGRS--MSSAFVLW-NEFQKIKPVLLNSIFQRIADIPIFIIFLIVIYVNLGLVVIVPITMFIVSIIISLVNHHYTNELMNKQKEGQKNRNIFISEVFLSIKMIHTLNNQGLLFDWVNTSNEQS-YLNLKIRKLNLIYQSILGSMSSITQITIMVIAFFM--------VIKGDVTTGAIVSSVIVSGRISGIISNFSSTLISILSAEKTGKDLLSFFDEDQAEKTPALSISKCNGDISIRGVSYQYDA-QSPMIINRLSIDIPAGQRVAVVGECGAGKSSLLGMLSGYLSPTDGAILYDGYNLGHLSQNFFSQHLSVVTTHDVLFTGTIESNFALKPQ-----------NDRGRVLKALQLANCG-FILQHPMGLKFPVNFMAKNLSSGQQQQLLLARSLSSDASVFLWDEPTSNLDENTEKQIFDNLDEFIHGKTLIMVTHRRYLIKYFDRVLVMKGGKIIRDCSPDKLL........................ 687
27 -92.100IDP91940 ABC transporter, ATP-binding protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100006879 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  21  1..MYTIIKSNISLLTIFIVAGQLLLIYAATINALVLNELI-------AMNLERFLKLSIYQMIVWCGIIFLDWVVKNYQVEVIQEFNLEIRNRVATDISNSTYQEFHSKSSGTYLSWLNNDVQTLNDQAFKQLFLVIKGISGTIFAVVTLNHYHWSLTVATLFSLMIMLLVPKIFASKMREVSLNLTSQNEAFLKSSETILNGFDVLASLNLLYVLPKKIKEAGILLKMVIQRKTTVETLAGAISFFLNIFFQISLVFLTGYL--------AIKGIVKIGTIEAIGALTGVIFTALGELGGQLSSIIGTKPIFLKLYSINPIESNKDIEPNEVNRDFPLYEAKNICYKY---GDKEILKNLNFCFQRNEKYLILGESGSGKSTLLKLLNGFLRDYSGELRFCGDDIKKTSYLNMVSNVLYVDQKAYLFEGTIRDNILLEEN-----------YTDEEILQSLEQVGLS-VKDFPNNILDYYVGDDGRLLSGGQKQKITLARGLIRNKKIVLIDEGTSAIDRRTSLAIERKILD-REDLTVIIVTHAPHLKQYFTKIYQFPKDFI.................................. 538
28 -91.800IDP06045 ABC transporter ATP-binding protein [Helicobacter pylori J99] NP_223847 [Helicobacter pylori J99]  ali follow..  19  19KQIYRLITFKEKMIFFLLVLMAVFSSFVEVMSLTLLMPFITLDFFHFSSPVRLMYFFSFCLVGIYLFRMFYGVFFTYLRGRFSNKKAYQIKQQLFLQHIKNNYLSHLNHNLDSLRDIINNKAEGMFMSFNAFLS-LLTEITVIVFFYSTLILTNWKITLVFTTILALQIFFIKKVTVLIKKKGEMAAKSKAQTLKVFSKFFSNFKITKLKDNHEEAHKLFGENSRKAHDTEIIYSTLQVVPRYSIETVGFSLLILAVAYILF--------KYGEARMVLPTISMYALALYRILPSVTGVISYYNEIAYNQLATNVVFKSLSKTI--VEEDLVPLDFNEKITLQNISFAYKS--KHPVLKNFNLTIQKGQKIALIGHSGCGKSTLADIIMGLTYPKSGEIFIDNTLLTSENRRSWRKKIGYIPQNIYLFDGTVGDNIAFGSA-----------IDEKRLIKVCKMAHIYDFLCE-HEGLKTQVGEGGAKLSGGQKQRIGIARALYDNPEILVLDEATSALDNETESKIMDEIYQIAKNKTLIVIAHRLSTIERCEVIIDMSQHKD-NLG.............................. 578
29 -74.600IDP02756 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_2038 [Coxiella burnetii RSA 493]  ali follow..  25  4......................................................................................................................................................................................................................................................................................................................................KGKLSDAAITKGDIVFDHVSFHYE--KEKPLLEDINLHVSPGEIIGITGTNYSGKTTLLEFILGFHTPTKGEIRIDGKNIENYDKMILREKIAYLPARGQIFRGTLLENITMFRPERA-----------KQALELSDHFGLSELIWPLPNGFDTTVGGGCSELSRGVVQVVSTIRALISKPKILLSDEANALLDLKTDQLFLKILQSLKKDCTMIIISHRPSTLALADRLYELDSGRLIL-KTHSNGRS....................... 239
30 -53.200IDP01675 ABC transporter ATP-binding protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5217 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  19  3................................................................................................................................................................................................................................................................................................................................................GSTLTVKDLHVSIDGKE---ILKGVNLEVKGGEIHAIMGPNGTGKSTLSSAIMGHYEVTEGSIIIDGEDVLEMEVDEAQAGLFLAMQYPSEISGVTNADFLRSAINARR----EEGDEISLMKFIRKLDKNMEFLEMDPEMAQRYLNEG---FSGGEKKRNEILQLMMIEPKIAILDEIDSGLDIDALKVVSKGINEMREEFGCLMITHRLLNYITPDFVHVMMNGRIVKSGGPELAQRLEAEGYDWIKKELGIEDETTEQE 260
31 -53.000IDP02099 ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0972 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  17  3...................................................................................................................................................................................................................................................................................................................................................LEIKDLHVSVGEQ-KKQILKGLNLTVKKGEVHAIMGPNGAGKSTLSNVLADGYEITQGSITFDGKDLNDLSISE-RAAAGIFLSLQYPIEIPGVSNVQFLKTALNS----------IRKQNGEDEIDAISFMKKLKENMQVLKIDQNEGFSGGEKKRNEMLQLMMLEPKLAILDETDSGLDIDALQVVSQGANSMRADRSFLVITHRLLDHIQPDFVHVLADGKIVKTGGKELALELEEKGYSWLNS............ 249
32 -50.700IDP01125 ABC transporter, ATP-binding protein BA_5175 [Bacillus anthracis str. Ames]  ali follow..  26  2..........................................................................................................................................................................................................................................................................................................................................................FILKDVTYKDILHIPYLQIQKEKITCIIGESGSGKSTLLRMLNDLQSPTSGIIEYNGKLISDYPPIQLRRDVVMLGQTPPIFDGTIKDNLLMGLR------SEKPFPNDDILRSALKTI-----------SLEKNLEDNADSLSGGEKQRLAFARIVLMDPPVYLLDEPTSALDSDTERRVMKQFTTLARKKTVIFITHSQQLPEEADDIIEISKANG---ATRKEVLSVEGRY.................. 219
33 -49.300IDP00731 ABC transporter, ATP-binding protein SACOL2462 [Staphylococcus aureus subsp. aureus COL]  ali follow..  27  3...................................................................................................................................................................................................................................................................................................................................................LEIKDLVYKA---SDRIILDHISLKVDKGESIAIIGPSGSGKSTFQKQICNLFSPTSGELYFKGKPYNDYDPEELRQRISYLMQQSDLFGETIEDNMIFPSLARNDKFDRKRAKQLIKDVGLG----------------HYQLSSEVENMSGGERQRIAIARQLMYTPDILLLDESTSALDVNNKEKIENIIFKLADGVAIMWITHSDDSMRHFQKRITIVDGQISNTEELNQ.......................... 218
34 -46.500IDP06323 phosphate transporter ATP-binding protein [Streptococcus pneumoniae TIGR4] NP_345855 [Streptococcus pneumoniae TIGR4]  ali follow..  24  1...............................................................................................................................................................................................................................................................................................................................MSTYNWDEKHILTFPEEKVALSTKDVHVYYGKNE---SIKGIDMQFERNKITALIGPSGSGKSTYLRSLNRMNDKVTGQILYRGIDVPEINVYEMRKHIGMVFQRPNPFAKSIYRNITFAHERAGVKDKQVLDEIVETSLRQA----------ALWDQVKDDLHKSALTLSGGQQQRLCIARAISVKPDILLMDEPASALDPIATMQLEETMFELKKNFTIIIVTHNMQQAARSDYTGFFYLGDLIEYDKTATIFQN...................... 252
35 -45.900IDP01150 Phosphate import ATP-binding protein pstB (Phosphate-transporting ATPase) (ABC phosphate transporter) BA_4493 [Bacillus anthracis str. Ames]  ali follow..  23  1...........................................................................................................................................................................................................................................................................................................................MVATVVNVQVKNEEKIETAPKKVVFDTKNLNLWYG---EDHALKDINLSIHENEVTAIIGPSGCGKSTYLKTLNRMVERTTGVIEYRERNIKSYPVEELRTHVGMVFQKPNPFPKSIYENVAYGPKIHGISDKKTLDEIVEKSLRGAAIW----------DELKDRLHDNAYGLSGGQQQRLCIARCLAIEPDVILMDEPTSALDPISTLKVEELIQELKKDFSIVIVTHNMQQAARSDKTAFFLSGEVVEYTDTNKLFTT...................... 256
36 -45.600IDP00717 phosphate ABC transporter, ATP-binding protein SACOL1421 [Staphylococcus aureus subsp. aureus COL]  ali follow..  26  17...............................................................................................................................................................................................................................................................................................................................FDVSQSHHKTPDDTNSHSVIYSTQNLDLWYG---ENHALQNINLDIYENQITAIIGPSGCGKSTYIKTLNRMVEKTAGKILYRDQDIQKYSKEQLRTNVGMVFQQPNPFPKSIYDNITYGKIHGIKNKKVLDEIVEKSLRGAAIWDELKDRLHTNAY-----------SLSGGQQQRVCIARCLAIEPEVILMDEPTSALDPISTLRVEELVQELKEKYTIIMVTHNMQQAARSDKTAFFLNGYVNEYDDTDKIFSN...................... 268
37 -45.500IDP01333 phosphate ABC transporter, ATP-binding protein VC0726 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  22  9.................................................................................................................................................................................................................................................................................................................................GYYVPPLDVNNLTDQQTAISIEHLSLYYQQSR---ALSDISMRIPKGQVTAFIGPSGCGKSTLLRCINRMNDLVEGEVKLHGKNIPDVDVPTLRRRVGMVFQRPNPFPKSIYENVVYGLRLQGIKNSRALDDAAEQSLRAA----------ALWDEVKHRLHENAFGLSGGQQQRLVIARAIAIEPEVLLLDEPTSALDPISTLTIEELIHDLKTKYTVVIVTHNMQQAARSDHTAFIHMGKLIEYADTDSIFTS...................... 258
38 -45.300IDP01340 phosphate ABC transporter, ATP-binding protein VCA0073 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  23  6...................................................................................................................................................................................................................................................................................................................................................FNIENLDLFYGENQ---ALKSINLPIPTRQVTALIGPSGCGKSTLLRCLNRMNDLIEGKLTMDGQDVGNIDVSDLRIRVGMVFQKPNPFPMSIYENVAYGLRAQGIKDKKHLDEVVERSLRGA----------ALWDEVKDRLKSHAFGLSGGQQQRLCIARTIAMEPDVILMDEPTSALDPIATHKIEELMEDLKKNYTIVIVTHSMQQARRSDRTAFFLMGELVEHDDTQVIFSN...................... 236
39 -45.000IDP01067 gene: pstB; phosphate transporter subunit STM3854 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  24  2..........................................................................................................................................................................................................................................................................................................................................SMVETAPSKIQVRDLNFYYGKFH---ALKNINLDIAKNQVTAFIGPSGCGKSTLLRTFNKMYSRAEGEILLDGDNINTQDIALLRAKVGMVFQKPTPFPMSIYDNIAFGVRLFEKLSRADMDERVQWALTKA----------ALWNETKDKLHQSGYSLSGGQQQRLCIARGIAIRPEVLLLDEPCSALDPISTGRIEELITELKQDYTVVIVTHNMQQAARSDHTAFMYLGELIEFSNTDDLFTK...................... 242
40 -44.000IDP00752 ABC transporter, ATP-binding protein SACOL2211 [Staphylococcus aureus subsp. aureus COL]  ali follow..  25  1............................................................................................................................................................................................................................................................................................................................................MEDKNSVIVFKNVSFQYQS-DASFTLKDVSFNIPKGQWTSIVGHNGSGKSTIAKLMIGIEKVKSGEIFYNNQAITDDNFEKLRKDIGIVFQDNQFVGSIVKYDVAFGLENHA----VPYDEMHRRVSEALKQVDMLERADYEPN-----------ALSGGQKQRVAIASVLALNPSVIILDEATSMLDPDARQNLLDLVRKVKSNITIISITHDLSEAMEADHVIVMNKGTVYKEGTATEIFDNAEELTRI............... 239
41 -43.500IDP00608 phosphonate ABC transporter, ATP-binding protein SACOL0127 [Staphylococcus aureus subsp. aureus COL]  ali follow..  25  4...................................................................................................................................................................................................................................................................................................................................................IEFKNVSKVYPN--GHVGLKNINLNIEKGEFAVIVGLSGAGKSTLLRSVNRLHDITSGEIFIQGKSITKAHLLEMRRNIGMIFQHFNLVKRSVLRNVLSGRVGYHPTWKMVLGLFPKEDKI-----KAMDALERV--NILDKYNQRSDELSGGQQQRISIARALCQESEIILADEPVASLDPLTTKQVMDDLRKINQGITILINLHFVDLAKEGTRIIGLRDGEVVYDGPASEATDD...................... 238
42 -43.200IDP00939 gene: glnQ; glutamine ABC transporter ATP-binding protein STM0828 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  30  2...................................................................................................................................................................................................................................................................................................................................................IEFKNVSKHFGPTQ---VLHNIDLNIRQGEVVVIIGPSGSGKSTLLRCINKLEEITSGDLIVDGLKVNDPDERLIRQEAGMVFQQFYLFPHTALENVMFG---PLRVRGVKKEEAEKQAKALLAKVGLAERAHHYPS-----------ELSGGQQQRVAIARALAVKPKMMLFDEPTSALDPELRHEVLKVMQDLAEGMTMVIVTHEIGFAEKASRLIFIDKGRIAEDGSPQALIEN...................... 226
43 -43.000IDP00933 gene: gltL; glutamate/aspartate transporter STM0662 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  25  2...................................................................................................................................................................................................................................................................................................................................................ITLKNVSKWYGHFQ---VLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPVQKGEITVNGIIVKKTDLAKLRSRVGMVFQHFELFPHSIIENLTLA---QVKVLKRDKAAARDKGLKLLERVGLSAHANKFPA-----------QLSGGQQQRVAIARALCMDPIAMLFDEPTSALDPEMINEVLDVMVELANGMTMMVVTHEMGFARKANRVIFMDEGKIVEDSPKEEFFAN...................... 226
44 -42.900IDP01147 amino acid ABC transporter, ATP-binding protein BA_0639 [Bacillus anthracis str. Ames]  ali follow..  27  3...................................................................................................................................................................................................................................................................................................................................................IEFRNVNKYYGNFQ---VLKDINVQVKKGEVVVVVGPSGSGKSTLLRCINQLESITDGELIVQNTEVAKTDMNELRRNIGMVFQHFYLYPHTVLQNITLA---PIKVNKISKEEAEKTAMFYLEKVGIPEKANVYPH-----------QLSGGQQQRVAIARGLAMQPEIMLFDEPTSALDPEMIGEVLDVMKTLAKGMTMVVVTHEMGFAREADRILFMDDGKIIEDTTPAQFFAS...................... 227
45 -42.900IDP02474 gene: pebC; amino acid ABC transporter ATP-binding protein [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0922c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  26  2...................................................................................................................................................................................................................................................................................................................................................IELKNVNKYYGTHH---VLKNINLSVKEGEKLVIIGPSGSGKSTTIRCMNGLEEVSSGEVVVNNLVLNH-KIEICRKYCAMVFQHFNLYPHTVLQNLTLA---PMKLQKKSKKEAEETAFKYLKVVGLLDKANVYPA-----------TLSGGQQQRVAIARSLCTKKPYILFDEPTSALDPETIQEVLDVMKEISHNTTMVVVTHEMGFAKEADRIIFMEDGAIVEENIPSEFFSN...................... 226
46 -42.900IDP01157 Phosphonates import ATP-binding protein phnC BA_3749 [Bacillus anthracis str. Ames]  ali follow..  27  2...................................................................................................................................................................................................................................................................................................................................................IEFRNVSKVYPN--GTKGLNNINLKIQKGEFVVMVGLSGAGKSTLLRSVNRLHEITEGEIMIEGESITAAKLRRMRRDIGMIFQSFNLVKRTVLKNVLAGRVGYHSTLRTTLGLFPKEDLELAF-----QSLKRV--NILEKAYARADELSGGQQQRVSIARALAQEAKIILADEPVASLDPLTTKQVLEDLKKINEGITTIVNLHSIDLARQATRIIGLHAGEIVFDGLVEEATDE...................... 236
47 -42.800IDP00696 amino acid ABC transporter, ATP-binding protein SACOL2410 [Staphylococcus aureus subsp. aureus COL]  ali follow..  24  2...................................................................................................................................................................................................................................................................................................................................................IQLTNIHKSFNDVE---VIKGIDLSVEQGEVVTLIGRSGSGKTTLLRMINALEIPTEGTVYVNGKTYTSKDKKSQRKQSGMVFQSYNLFPHTALENVMEG---LITVKKLKKDEARGKSLELLEKVGLTHVKDQRPH-----------ALSGGQQQRVAIARALAMNPKVMLFDEPTSALDPELVNDVLKVIKDLANGMTMVIVTHEMRFAKESNNIVFIHEGMIGEQGAPEEMFNR...................... 227
48 -42.800IDP01414 amino acid ABC transporter, ATP-binding protein VC1359 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  25  11...................................................................................................................................................................................................................................................................................................................................................IQIKDMNKWYGEFH---VLKNINLNVKKGERIVICGPSGSGKSTMIRCINRLEEHQKGQIIVAGNELDLKNIELVRREVGMCFQHFNLFPHTVLENCTLA---PIWVKKMPKDKAEEIAMKYLTRVRIPEQADKYPG-----------QLSGGQQQRVAIARSLCMNPQIMLFDEPTSALDPEMVREVLDVMVELAEGMTMLCVTHEMGFAKEADRVIFMDAGEIIEENNPKEFFEN...................... 235
49 -42.600IDP00978 gene: yecC; putative amino-acid ABC transporter ATP-binding protein YecC STM1951 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  26  4...................................................................................................................................................................................................................................................................................................................................................IEVTNLVKKFHGQT---VLHGIDLEVKPGEVVAIIGPSGSGKTTLLRCINLLEQPEAGTIKVGDIIIQKGLIRQLRQHVGFVFQSFNLFPHTVLENIIEG---PVIVKGEPKAEATALARELLAKVGLAGKESRYPR-----------RLSGGQQQRVAIARALAMRPEVILFDEPTSALDPELVGEVLNTIRQLAQKRTMVIVTHEMSFARDADRAIFMDQGQIVEQGPAKTLFAD...................... 234
50 -42.600IDP01113 amino acid ABC transporter, ATP-binding protein BA_0368 [Bacillus anthracis str. Ames]  ali follow..  27  2...................................................................................................................................................................................................................................................................................................................................................IQVRNLVKSFGSLD---VLKGIDLEVNEKEVVVLIGASGSGKSTLLRCLNFLEMYDEGEIHLQGERIKHSNLNKVRENVGMVFQHFNLFPHTSLENIIEA---PIHVKKLETANAKEIGNQLLQKVGLQDKADVTPH-----------LLSGGQKQRIAIARALAMNPKIMLFDEPTSALDPELVGEVLQVMKELAEGMTMVIVTHEMNFARDADRVIFMDDGKIVEDAPPAQFFST...................... 226
51 -42.500IDP01355 amino acid ABC transporter, ATP-binding protein VC0008 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  24  2...................................................................................................................................................................................................................................................................................................................................................IKLQNIHKRFGTSE---VLKGIDLEIQRGEIVVIIGSSGTGKSTLLRCVNFLEQADQGSIRIDELTVTKADVLALRRKTGFVFQNYALFAHTARQNIAEA---LITVRGWKKAQAHQRAQQILDDIGLGDKGDSYPA-----------ALSGGQQQRVGIGRAMALQPELLLFDEPTSALDPEWVGEVLALMKKLATHQTMLVVTHEMQFAKEADRVIFMAEGKIVEQGSPQDIFDH...................... 229
52 -42.300IDP01154 Cobalt import ATP-binding protein cbiO 1 BA_0139 [Bacillus anthracis str. Ames]  ali follow..  27  6...................................................................................................................................................................................................................................................................................................................................................LRTENISFQYPGAA-TYALKDVSFSLFEGEWVSVIGQNGSGKSTLAKLLNGLFLPEAGTITVNDTMILS-TVWDVRKQIGMVFQDNQFVGTTVQDDVVFGLENIG-----PREQMVERLNQALRLVRMEDFLNDEP-----------HSLSGGQKQRVAIAGVLALQPSILILDEATSMLDPQGRREVVETVRQLVNGITVLSITHDLEEAAQSDRVIILNKGEILEEGTPEQIFKSSHMLQEI............... 238
53 -42.200IDP01431 amino acid ABC transporter, ATP-binding protein VC1864 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  23  7...................................................................................................................................................................................................................................................................................................................................................LEIKNLHKTFGQNE---VLKGISLQAQKGDVISIIGSSGSGKSTFLRCINLLETPTAGEIWVKGELIKEKQVQRIRSRLAMVFQSFNLWSHTVLENVIEA---PVHVLGVPKAQAIEQAERLLRKVGLYERKDYYPG-----------HLSGGQQQRAAIARALAVEPEVMLFDEPTSALDPELVGEVLGVMRDLAEGRTMLVVTHEMAFARDSNHVMFLHQGKVEEQGKPEKLFKN...................... 242
54 -42.200IDP02608 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0178 [Coxiella burnetii RSA 493]  ali follow..  28  2...................................................................................................................................................................................................................................................................................................................................................ITLDRITKFYRSV-KSPAVDSVSFEVKDGETLVLLGSSGSGKTTLMKMINRLIEPTSGTIKIEGKDVREYNLSELRRSIGYVFQQIGLFP-TIEKNITIL-------------LKLLHYPKAKRIQRAAELLEMVHLDPQKFAQRYSDELSGGQQQRVGVARALAADPKYLLMDEPFGALDAMTRSALQEEMIHLNQGKTIVFVTHDIFAFRIADRIAVMHKGKLEQIGTKNELLNN...................... 228
55 -42.100IDP01464 ABC transporter, ATP-binding protein VC2520 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  21  7...................................................................................................................................................................................................................................................................................................................................................VTIKNLRFSRS---QRVIFDDIDLHVPKGKVTAIMGPSGIGKTTLLRLIGGQLLPEQGEIWFDGENIPTLKLYRARKKMSMLFQSGALFTDNVFDNVAYP---LREHTELDEAMIKTLVLLKLEAVGLRGAAYLMPS-----------ELSGGMARRAALARAIALDPELIMYDEPFVGQDPITMGVLVELIRNLNRGVTSVVVSHDVPEVMSADWVYLLADGKVIAQGSPQALRDN...................... 233
56 -41.900IDP02457 ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1248 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  20  6...................................................................................................................................................................................................................................................................................................................................................IQVRDLSTKFG---KEWIHKDLNLDIPFEKISCIIGASGCGKTTLMREILMLQPIYSGKIFLLGQEINPIKRKAISSKMSMMFQHCALFSSTNLQNVIFPLRQHTKLPIDILTDIAIIKLKMVGLK-------------EEAFNKYPSEISGGMLKRVALARTIALDPKVVFLDEPNAGLDPYSARAMDDLILYLKEKMSVVMITHDLSTIWHVDDIIYMDEKRIMLHDSVEFVSQQ...................... 235
57 -41.800IDP01505 amino acid ABC transporter, ATP-binding protein VCA1037 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  29  4...................................................................................................................................................................................................................................................................................................................................................IEFHQVSKWYGQFQ---ALKSISLTVNKGEIVVICGPSGSGKSTLIRTVNGLESIDSGEIIVLP---ELDERTRRSGKIGMVFQHFNLFPHTVLENLTLA---PIRTLKLSAQEAKERAYHFLQRVKITDQTHKYPI-----------QLSGGQQQRVAIARSLCMQPEILLFDEPTSALDPETINEVLEVMVDLAQGITMMCVTHEMGFARKAHRVMFMDEGEILEVGSPEQLFQN...................... 223
58 -41.600IDP01607 ABC transporter, ATP-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1608 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  24  2.................................................................................................................................................................................................................................................................................................................................................CDISFKNVSFYRD---SRCIYDDITFTIPTNKITTILGPSGAGKTTILQLIAGLIKPTLGKICIDNAIIKETQLEKLRHRMGFLFQSGALFTHSVYDNIAFP---LRKNTNLDEKLIRNIVLLKLQAVGLAHTINMMPS-----------ELSGGMARRVALARSIAMDPDIMMYDEPFTGQDPASFNKLLELISTLNENMTSIIVSHDIQESLSSDHIIIVGNKKIIASDSPENIKNSKDQQ.................. 235
59 -41.600IDP01641 gene: artP; amino acid ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0481 [Coxiella burnetii RSA 493]  ali follow..  23  4...................................................................................................................................................................................................................................................................................................................................................IQVESLKKSYHGTV---VLKEVSFAAKAGEVVTLLGDSGAGKSTLLRCLNLLEMPDEGRMVINDLEFTRQSLIALRSKVGMVFQQFHLWAHTILQNLIEA---PCQVLKISKAEAVKKAECLLDQVGILAKKDDYPA-----------RLSGGQQQRAAIARALMMEPEVMLFDEPTSALDPKMITAMRDLIHELAQGMTIVIATHEMKFAREAHKTVFLHEGRIVEEGQPEVMFRS...................... 235
60 -41.100IDP93868 cobalt transport ATP-binding protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001006902 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  23  2...................................................................................................................................................................................................................................................................................................................................................LATRQLGFSYQEEQ---VLHDLTLDFSQHAVTGVLGANGCGKSTLFMNLTGILQPQQGAVLWQGEPLKKANLRELRQRVTTVFQEQQIFYTDIDSDIAFSLRNLG----MPEEIIAQRVDRALTLVDAQGFRHKSIQ-----------HLSHGQKKRVAIAGALVMEAEYLLLDEPTAGLDPAGRQHMITIIERIAEGKRVILSSHDIDLIYKCDYLYVLSHGHLMIAGETTEVFLQQDKLQAA............... 233
61 -41.100IDP00944 gene: artP; arginine transporter ATP-binding subunit STM0891 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  23  2..................................................................................................................................................................................................................................................................................................................................................SIQLNGINCFYGAHQ---ALFDITLDCPEGETLVLLGPSGAGKSSLLRVLNLLEMPRSGTLTIAGNHFSDKAIRELRQNVGMVFQQYNLWPHTVVQNLIEA---PCRVLGLTKDQALARAEKLLERLRLKPYSDRYPL-----------HLSGGQQQRVAIARALMMEPQVLLFDEPTAALDPEITAQIVSIIHELAENITQVIVTHEVEVARKASRVIYMENGHIVEHGDAG........................... 226
62 -40.800IDP01758 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0728 [Coxiella burnetii RSA 493]  ali follow..  19  2..........................................................................................................................................................................................................................................................................................................................................TAIEPSEPLIEIHGLCNEFG---EQRVHDDLNLTIHRGEIVAIIGPSGCGKTTLLRSILMLRKPTAGTINVFGINILECEALSVQRRWGVMFQSSALFSSRVLENVLFPLHEYSHLHSEAQTKLALLKIALVGLDR--EAVPKYPA-----------ELSGGMKKRAALARAMALDPELLFLDEPTTGLDAKSARELNELILHLRKELTFVMVTHDLDTLWQPDRVFFLGEGKVLAALPMDGLVHHKHPL.................. 242
63 -40.800IDP00728 ABC transporter, ATP-binding protein SACOL2210 [Staphylococcus aureus subsp. aureus COL]  ali follow..  24  2..................................................................................................................................................................................................................................................................................................................................................TIRFDNVSYTYQKGTQHQAIHDVNTEFEQGKYYAIVGQTGSGKSTLIQNINALLKPTTGTVTVDDITIKDKYIRPVRKRIGMVFQESQLFEDTVEREMIFGPKNFK----MNLDEAKNYAHRLLMDLGFSRDVMSQS-----------FQMSGGQMRKIAIVSILAMNPDIIVVDEPTAGLDPQSKRQVMRLLKSLQTNKAIILISHDMNEVARADEVIVMKEGSIVSQTSPKELFKDKKKLADW............... 243
64 -40.600IDP06166 ABC transporter ATP-binding protein [Helicobacter pylori J99] NP_223403 [Helicobacter pylori J99]  ali follow..  21  5...................................................................................................................................................................................................................................................................................................................................................IAANNLCLQY--QQNEPVIKHANLRIKRKDFVFISGPSGSGKSTLLRSFYGDLKVFSGKLEVCNINMNNASILDLRKNIGVVFQDYKLIQDTIEQNIKLPMVICGIKKEECHLQLEKLLGHI---------------DLRHKANRYPKELSGGEQQRVAMARAMANCPELILADEPTGNLDDYSSDKIWSLLRGMNTNATIVVVTHKFPKNFSYHRKFYIEEGEVYEYS.............................. 223
65 -40.600IDP02663 hypothetical protein lmo2182 [Listeria monocytogenes EGD-e] lmo2182 [Listeria monocytogenes EGD-e]  ali follow..  26  1...................................................................................................................................................................................................................................................................................................................................................MEVRDVNFSYNG--TDAILKNVSFTIQKNKINTIVGPNGSGKSTLLEILARLLSPNSGDVLLEGKSIFEWKAKEFAQNVAIVHQSNVLNELMVKELLYFGRLPYKNWRMTRTKEDDLAVERALMQTELTEKAEKF------------DSLSGGERQRVFIATALVQDTPILLLDEPTTFLDMYFQLEILELVKRLNQNLTIVMILHDLNALMYSDHLIVMKNGEVVAKGEPEELLTTDLI-AETYGVV........... 238
66 -40.500IDP00706 ABC transporter, ATP-binding protein SACOL0504 [Staphylococcus aureus subsp. aureus COL]  ali follow..  26  2...................................................................................................................................................................................................................................................................................................................................................IEFRQVSKTFNKKKQKDALKDVSFTVNRNDIFGVIGYSGAGKSTLVRLVNHLEAASNGQVIVDGHDITNYSDKMMKKDIGMIFQHFNLLNSTVFKNVAMP-----ILSKKSKTEIKQRVTEMLEFVGLSDKKDQFPD-----------ELSGGQKQRVAIARALVTNPKILLCDEATSALDPATTASILTLLKNVNQGITIMMITHEMRVIKDCNRVAVMEKGKVVETGTVKEVFSH...................... 231
67 -40.500IDP06314 cell division ABC transporter ATP-binding protein FtsE [Streptococcus pneumoniae TIGR4] NP_345254 [Streptococcus pneumoniae TIGR4]  ali follow..  24  4...................................................................................................................................................................................................................................................................................................................................................IEMRDVVKKYDN--GTTALRGVSVSVQPGEFAYIVGPSGAGKSTFIRSLYREVKIDKGSLSVAGFNLVKIKVPLLRRSVGVVFQDYKLLPKTVYENIAYAMEVIGENRRNIKRRVMEVLDLV---------------GLKHKVRSFPNELSGGEQQRIAIARAIVNNPKVLIADEPTGNLDPDNSWEIMNLLERILQGTTILMATHNSQIVNTRHRVIAIENGRVVRDESKGEYGYDD..................... 230
68 -40.500IDP00547 gene: ftsE; cell division protein FtsE YPO3813 [Yersinia pestis CO92]  ali follow..  23  2...................................................................................................................................................................................................................................................................................................................................................IRFEQVSKAYLG--GRQALQGVDFHLRPAEMAFLTGHSGAGKSTLLKLICGIERPSAGHIWFGGHDISRLKVPFLRRQIGMIFQDHHLLLDTVYDNVAMPLIIAGASSEDIRRRVSAALDKV---------------GLLDKAKNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILRLFEEFNRGVTVLMATHDTSLIARRYPILTLSQGRMSGAHHGE........................... 222
69 -40.500IDP00865 gene: ftsE; cell division protein FtsE STM3570 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  23  2...................................................................................................................................................................................................................................................................................................................................................IRFEHVSKAYLG--GRQALQGVTFHMRPGEMAFLTGHSGAGKSTLLKLICGIERPSAGKIFFSGHDITRLKVPFLRRQIGMIFQDHHLLMDTVYDNVAIPLIIAGASGDDIRRRVSAALDKV---------------GLLDKARNFPIQLSGGEQQRVGIARAVVNKPAVLLADEPTGNLDDALSEGILRLFEEFNRGVTVLMATHDIGLISRSYRQLVLSDGHLHGGLANE........................... 222
70 -40.500IDP02371 gene: ftsE; cell division ABC transporter, ATP-binding protein FtsE [Coxiella burnetii RSA 493] CBU_1904 [Coxiella burnetii RSA 493]  ali follow..  21  2...................................................................................................................................................................................................................................................................................................................................................IRFANVTKNYPN--GHQALNNISFTLKQGEMAFLTGHSGAGKTTLLKLMMMIEAITRGQIYINNRNLSRLSIPYLRRRIGMIFQNPQLLYHTVFDNVGIPLVISGYRHSEIKRRVRAALDKV---------------GLLKKEKLYPFSLSTGEQQRIGIARAIVNKPMLVIADEPTGNLDPELSSEIMRLFEAFNAGVTVLIATHDLSLIAPNYRIITLKEGRLVE................................ 217
71 -40.500IDP01155 Methionine import ATP-binding protein metN 2 BA_0312 [Bacillus anthracis str. Ames]  ali follow..  25  2...................................................................................................................................................................................................................................................................................................................................................ISFNNVSKVYESGGQSHAVEDVTLSVEKGEIFGIIGFSGAGKSTLLRLVNMLERPTAGTISIDDKDITSLSTKELRQRIGMIFQSFNLFNSTVFGNIAYP-----KLAKVPKNEIKERVNELLKFVGLEDKANNYPE-----------QLSGGQKQRVGIARALATSPDILICDEATSALDPETTTEILNLLKKVNRNLTILLITHEMHVVKECHRVAVMEKGKVIEEGKLFDVFTQ...................... 231
72 -40.400IDP00099 gene: ynhD; putative ATP-binding component of a transport system NT02SF1983 [Shigella flexneri 2a str. 2457T]  ali follow..  20  2...................................................................................................................................................................................................................................................................................................................................................LSIKDLHVSVEDKA---ILRGLSLDVRPGEVHAIMGPNGSGKSTLSATLAGRYEVTGGTVEFKGKDLLALSPEDRGEGIFMAFQYPVEIPGSNQFFLQTA------LNAVRSYRGQETLDRFDFQDLMEEKIALLKMPEDLLTRSVNVGFSGGEKKRNDILQMAVLEPELCILDESDSGLDIDALKVVADGVNSLRDKRSFIIVTHYQRILDYPDYVHVLYQGRIVKSGDFTLVKQL...................... 236
73 -40.400IDP02015 ABC transporter, ATP-binding protein [Coxiella burnetii RSA 493] CBU_0107 [Coxiella burnetii RSA 493]  ali follow..  27  2...................................................................................................................................................................................................................................................................................................................................................IELRNVTKTYSAKQGGLALSDINLRVSAGEMFGVIGKSGAGKSTLIRCVNLLERPDKGSVIVDGQVLTTLSSKVLRHRMGMVFQHFNLLSATAYQNIAFP-----QLLGKNPTEIRKVVLPLLELTDLTAKINAYPS-----------QLSGGQKQRVAIARALVTNPTVLLCDEMTSALDPETTHSILQLLKNINRNLSILLITHEMEVIKTADRVAVLDQGRIVEENDVVSLFKR...................... 231
74 -40.300IDP00143 gene: viuC; vibriobactin and enterobactin ABC transporter, ATP-binding protein VC0779 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  19  1...............................................................................................................................................................................................................................................................................................................................MDTIWDADLQSAALKAEHHRLKTERLSLGYEGKS---VCDALDLAIPHGKFSVIVGPNGCGKSTLLKSLCRLLKPLAGQVLLDGQNIHQLPTKVVAKQLGLLPQSALTEGIKVVDLVSRGRYPHQGLFRQWSRVDERAVEEAMRATHVHELAQHS------------DQLSGGQRQRVWVAMALAQQTPYLLLDEPTTYLDIAHQIELLDLFWRLNRGHTLVAVLHDLNACRYADHLIVLQEGKIVAQGDPHSLVTPALV-KQVFGID........... 257
75 -40.300IDP02039 putative ABC transport ATP-binding subunit [Yersinia pestis CO92] YPO1198 [Yersinia pestis CO92]  ali follow..  25  2...................................................................................................................................................................................................................................................................................................................................................IQFHQVSKYFAGKR---AVDNLSLQISKGEFTVLIGTSGSGKSTTLKMINRLIEHDEGKIRFAGEEIRNYKPEDLRRRMGYAIQSIGLFP-TVERNIATV-------------PQLLKWPKDRIRQRVVELLELLHLDPQQFCHRYPHQLSGGQQQRVGVARALAVDPEVLLMDEPFGALDPVTRSALQLEITRIHQGRTIVLVTHDIDALSLADRIVLMDEGRVIQQGTPLEMLAQ...................... 226

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Q, Zmasek CM, Dishaw LJ, Mueller MG, Ye Y, Litman GW, Godzik A. Novel genes dramatically alter regulatory network topology in amphioxus. Genome Biol.2008 Aug 4;9(8):R123.