current user: public

If you have questions about the server, please let us know.

Query: gi|108885075|ref|NP_072661.2| DNA polymerase III, beta subunit (MG_001) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380
# Score Template Links and tools%idFirst MKILINKSELNKILKKMNNVIISNNKIKPHHSYFLIEAKEKEINFYANNEYFSVKCNLNKNIDILEQGSLIVKGKIFNDLINGIKEEIITIQEKDQTLLVKTKKTSINLNTINVNEFPRIRFNEKNDLSEFNQFKINYSLLVKGIKKIFHSVSNNREISSKFNGVNFNGSNGKEIFLEASDTYKLSVFEIKQETEPFDFILESNLLSFINSFNPEEDKSIVFYYRKDNKDSFSTEMLISMDNFMISYTSVNEKFPEVNYFFEFEPETKIVVQKNELKDALQRIQTLAQNERTFLCDMQINSSELKIRAIVNNIGNSLEEISCLKFEGYKLNISFNPSSLLDHIESFESNEINFDFQGNSKYFLITSKSEPELKQILVPSRLast
1 -95.8004tr6_A mol:protein length:380 DNA polymerase III subunit beta  ali model follow..  21  3MKFTIQKDRLVESVQDVLKAVSSRTTI-PILTGIKIVASDDGVSFTGSDSDISIESFIPKEVTIEQPGSIVLQARFFSEIVKKLPMATVEIEVQNQYTIIRSGKAEFNLNGLDADEYPHLPQIEEHH-----AIQIPTDLLKNLIRQTVFAVSTS-ETRPILTGVNWKVEQSE-LLCTATDSHRLALRKAKLDDRSYNVVIPGKSLTELSKILDDNQELVDIVITE-------TQVLFKAKNVLFFSRLLDGNYPDTTSLIPQDSKTEIIVNTKEFLQAIDRASLLAREGRNNVVKLSAKPAEIEISSNSPEIGKVVEAIVADQIEGEELNISFSPKYMLDALKVLEGAEIRVSFTGAMRPFLIRTPNDETIVQLILPVR 378
2 -94.7006amq_A mol:protein length:366 DNA polymerase III subunit beta  ali model follow..  16  1MKFTVEREHLLKPLQQVSGPLGGRPTL-PILGNLLLQVADGTLSLTGTDLEMEMIARVTL-SQPHEAGATTVPARKFFDICRGLPEGAIAVQLEGDRMLVRSGRSRFSLSTLPAADFPNLDDWQSEV-----EFTLPQATMKRLIEATQFSMAHQ-DVRYYLNGMLFET-EGEELRTVATDGHRLAVCSMPIGDPNHSVIVPRKGVIELMRMLDGGDTPLRVQIGS-------NNIRAHVGDFVFTSKLVDGRFPDYRRVLPKNPDKTLEAGCDSLKQAFARAAILS-NEKFRGVRLYVSENQIKITANNPEQEEAEEILD-VTYAGTEMEIGFNVSYVLDVLNALKCENVRILLTDSVSSVQIEDAASQSAAYVVMPMR 365
3 -94.7003pwe_A mol:protein length:366 DNA polymerase III subunit beta  ali model follow..  17  1MKFTVEREHLLKPLQQVSGPLGGRPTL-PILGNLLLQVADGTLSLTGTDLEMEMVARVAL-VQPHEPGATTVPARKFFDICRGLPEGAIAVQLEGERMLVRSGCSRFSLSTLPAADFPNLDDWQSEV-----EFTLPQATMKRLIEATQFSMAHQ-DVRYYLNGMLFET-EGEELRTVATDGHRLAVCSMPIGQPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGS-------NNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGSDLLKQAFARAAILS-NEKFRGVRLYVSENQLKITANNPEQEEAEECLD-VTYSGAEMEIGFNVSYVLDVLNALKSENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR 365
4 -94.5003f1v_A mol:protein length:366 DNA polymerase III subunit beta  ali model follow..  17  1MKFTVEREHLLKPLQQVSGPLGGRPTL-PILGNLLLQVADGTLSLTGTDLEMEMVARVAL-VQPHEPGATTVPARKFFDICRGLPEGAIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEV-----EFTLPQATMKRLIEATQFSMAAA-AAAYYLNGMLFET-EGEELRTVATDGHRLAVCSMPIGQPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGS-------NNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILS-NEKFRGVRLYVSENQLKITANNPEQEEAEEILD-VTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR 365
5 -94.0005x06_A mol:protein length:386 DNA polymerase III subunit beta  ali model follow..  17  15MKFTVEREHLLKPLQQVSGPLGGRPTL-PILGNLLLQVADGTLSLTGTDLEMEMVARVAL-VQPHEPGATTVPARKFFDICRGLPEGAIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEV-----EFTLPQATMKRLIEATQFSMAHQ-DVRYYLNGMLFET-EGEELRTVATDGHRLAVCSMPIGQPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGS-------NNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILS-NEKFRGVRLYVSENQLKITANNPEQEEAEEILD-VTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR 379
6 -92.4004tr8_A mol:protein length:383 DNA polymerase III subunit beta  ali model follow..  19  11MHFTIQREALLKPLQLVAGVVERRQTL-PVLSNVLLVVEGQQLSLTGTDLEVELVGRVVLE-DAAEPGEITVPARKLMDICKSLPNDVIDIRVEEQKLLVKAGRSRFTLSTLPANDFPTVEEGPGSL-----NFSIAQSKLRRLIDRTSFAMAQQ-DVRYYLNGMLLEVNGGT-LRSVATDGHRLAMCSLDAQQDRHQVIVPRKGILELARLLTEQDGEVGIVLGQ-------HHIRATTGEFTFTSKLVDGKFPDYERVLPRGGDKLVVGDRQQLREAFSRTAILS-NEKYRGIRLQLSNGLLKIQANNPEQEEAEEEVQ-VEYNGGNLEIGFNVSYLLDVLGVIGTEQVRFILSDSNSSALVHEADNDDSAYVVMPMR 376
7 -91.6002xur_A mol:protein length:373 DNA POLYMERASE III SUBUNIT BETA  ali model follow..  16  2MKFTVEREHLLKPLQQVSGPLGGRPTL-PILGNLLLQVADGTLSLTGTDLEMEMVARVAL-VQPHEPGATTVPARKFFDICRGLPEGAIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEV-----EFTLPQATMKRLIEATQFSMAHQ-DVRYYLNCMLFET-EGEELRTVATDGHRLAVCSMPIGQPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGS-------NNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILS-NEKFRGVRLYVSENQLKITANNPEQEEAEEILD-VTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMR 366
8 -91.5006ap4_A mol:protein length:388 DNA polymerase III subunit beta  ali model follow..  14  1MRLKIAKESLLNVLSHVVGAVERRHTL-NILSNVKIQTNAQALTITGSDLEVELVASTASEGACLEAGETTVPARKLMEICKSLPTAAIDLQITEDQCILKSGNSRFVLGTLPAEDYPLLTTENSQG----TQVQVTQRELKRLFEKTAFAMAVQ-DVRFYLTGTLLEIDENQ-LRAVTTDGHRLALCEILASSQLVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTSRDKEQGDITVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDVFKQSLQRVAILS-NEKLRGVFLNFNQDSLQLRANNPEQDEAIEDLA-IQYQSAPLEMSFNAQYLLDVLGVLDGDDVNMSMTEANQSVLVQDPAHPDQTYVVMPMR 381
9 -91.1002avt_A mol:protein length:378 DNA polymerase III beta subunit  ali model follow..  18  2IQFSINRTLFIHALNTTKRAISTKNAI-PILSSIKIEVTSTGVTLTGSNGQISIENTIPVSLLITSPGAILLEASFFINIISSLPDISINVKEEQHQVVLTSGKSEITLKGKDVDQYPRLQEVSTEN-----PLILKTKLLKSIIAETAFAASLQ-ESRPILTGVHIVLSNHKDFKAVATDSHRMSQRLITLDNADFMVVLPSKSLREFSAVFTDDIETVEVFFSP-------SQILFRSEHISFYTRLLEGNYPDTDRLLMTEFETEVVFNTQSLRHAMERAFLISNATQNGTVKLEITQNHISAHVNSPEVGKVNEDLDIVSQSGSDLTISFNPTYLIESLKAIKSETVKIHFLSPVRPFTLTPDEEESFIQLITPVR 376
10 -91.0001vpk_A mol:protein length:378 DNA polymerase III, beta subunit  ali model follow..  21  7MKVTVTTLELKDKITIASKALAKKSVK-PILAGFLFEVKDGNFYICATDLETGVKATVNA-AEISGEARFVVPGDVIQKMVKVLPDEITELSLEGDALVISSGSTVFRITTMPADEFPEITPAESGI-----TFEVDTSLLEEMVEKVIFAAAKD-EFMRNLNGVFWELHKNL-LRLVASDGFRLALAEEQIENEEASFLLSLKSMKEVQNVLDNTTEP------TITVRYDGRRVSLSTNDVETVMRVVDAEFPDYKRVIPETFKTKVVVSRKELRESLKRVMVIA-SKGSESVKFEIEENVMRLVSKSPDYGEVVDEVE-VQKEGEDLVIAFNPKFIEDVLKHIETEEIEMNFVDSTSPCQINPLDISGYLYIVMPIR 370
11 -90.1002awa_A mol:protein length:390 DNA polymerase III, beta chain  ali model follow..  19  8IHFSINKNLFLQALNTTKRAISSKNAI-PILSTVKIDVTNEGITLIGSNGQISIENFISQKLLITSLGSILLEASFFINVVSSLPDVTLDFKEEQNQIVLTSGKSEITLKGKDSEQYPRIQEISAST-----PLILETKLLKKIINETAFAASTQ-ESRPILTGVHFVLSQHKELKTVATDSHRLSQKKLTLEKDDFDVVIPSRSLREFSAVFTDDIETVEIFFAN-------NQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFNVVNLRQSMERARLLSSATQNGTVKLEIKDGVVSAHVHSPEVGKVNEEIDTDQVTGEDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLVPDTDEDFMQLITPVR 382
12 -88.9003p16_A mol:protein length:408 DNA polymerase III subunit beta  ali model follow..  15  13LTFRLLRESFADAVSWVAKNLPARPAV-PVLSGVLLTGSDNGLTISGFDYEVSAEAQVGAEIV--SPGSVLVSGRLLSDITRALPNKPVDVHVEGNRVALTCGNARFSLPTMPVEDYPTLPTLPEE------TGLLPAELFAEAISQVAIAAGRD-DTLPMLTGIRVEI-LGETVVLAATDRFRLAVRELKWSASEAAVLVPAKTLAEAAKAGIGGSD-VRLSLGTGPGVGKDGLLGISGNGKRSTTRLLDAEFPKFRQLLPTEHTAVATMDVAELIEAIKLVALVA--DRGAQVRMEFADGSVRLSAGADDVGRAEEDLV-VDYAGEPLTIAFNPTYLTDGLSSLRSERVSFGFTTAGKPALLRPVSGDDYVYLLMPVR 399
13 -88.5004s3i_A mol:protein length:384 DNA polymerase III subunit beta  ali model follow..  16  3MKISVSKNDLENALRYLQAFLDKKDAS-SIASHIHLEVIKEKLFLKASDSDIGLKSYIFTQS-SDKEGVGTINGKKFLDIISCLKDSNIILETKDDSLAIKQNKSSFKLPMFDADEFPEFPVIDPKV-----SIEVNAPFLVDAFKKIAPVIEQT-SHKRELAGILMQFDKHQTLSVVGTDTKRLSYTQLEKISEDISCILPKRALLEILKLFYE----------NFSFKSDGMLAVIENEMHTFFTKLIDGNYPDYQKILPKEYISSFTLGKEEFKESIKLCSSLSST-----IKLTLEKNNALFESLDSEHSETAKTSVEIE-IEKAFHLGVNAKFFLEALNALGTTQFVLRCNEPSSPFLIQESLDEKISTLMMPIT 375
14 -86.2006deg_A mol:protein length:381 Beta sliding clamp  ali model follow..  19  3MRITVDRSQFFKSLGRVHRVVERRNTV-PILSNVLIDAENGSVQLKATDLDLEVTESFTVNIE--KAGAITVPAYLLYDIVRKLPDGSIVLSVDENQMSIVSGCTHFQLQCLPKIDFPESLPGQFGC-----RFFLSASKLKHLLDCTQFAISTE-ETRYYLNGIYFHIVHDDKLRLVATDGHRLAQVDMEAPDGMPGVIIPRKAVGELQKLLSEEID------GDVCIELSETKIRFSLGSVVFTSKLVDGTFPDYQRVIPLGNDRKLIVNRQDFSSAVDRVSTIS-NDRGRAVKLTIEHGQLKLVVNNPDSGSAEDQLA-ATYTSEPLEIGFNSRYLLDIAGQLSSDEMVFMLSDAVAPALIRDNNNAEVLYVLMPVR 374
15 -86.1005ah2_A mol:protein length:401 DNA POLYMERASE III SUBUNIT BETA  ali model follow..  16  15LKFRVVREDFADAVAWVARSLPTRPTI-PVLAGVLLTGTDEGLTISGFDYEVSAEVKVSAEIA--SAGSVLVSGRLLSDITKALPAKPVEVSVEGTRVSLTCGSARFSLPTLAVEDYPALPALPEE------TGVIASDLFAEAIGQVAVAAGRD-DTLPMLTGIRVEI-SGESVVLAATDRFRLAVRELTWVTTEAAVLVPAKTLAEAAKAGTDGNQ-VHLALGSGASVGKDGLLGIRSEGKRSTTRLLDAEFPKFRQLLPAEHTAVATIGVAELTEAIKRVALVA--DRGAQIRMEFSDDTLKLSAGADDVGRAEEDLP-VDFAGEPLTIAFNPTYLTDGLGSLHSERVTFGFTTPSRPAVLRPAGEDDYVYLLMPVR 398
16 -84.5006d47_A mol:protein length:410 Beta sliding clamp  ali model follow..  16  15LKFRLVRESFADAVSWVAKNLPTRPAV-PVLSGVLLTGSDEGLTISGFDYEVSAEVRVPAEIA--SPGTVLVSGRLLSDITRALPNKPVDFYVDGNRVALTCGNARFSLPTMAVEDYPTLPTLPE------DTGTLPAELFSEAIGQVAIAAGRD-DTLPMLTGIRVEISGEK-VVLAATDRFRLAVRELTWNDIEAAVLVPAKTLGEAAKANTDGSE-VRLSLGAGMGVGKDGLLGISGDGKRSTTRLLDAEFPKFRQLLPAEHTAVASADVAELTEAIKLVALVA--DRGAQVRMEFADGMLRLSAGADDVGRAEEDIA-VEFAGQPLTIAFNPTYLIDGLASLHSERVSFGFTTPGKPALLRPASAEDYVYLLMPVR 401
17 -83.9005wce_A mol:protein length:379 DNA polymerase III subunit beta  ali model follow..  16  2MKLTIERAALLKALGHVQSVVERRNTI-PILSNILLSAEGDRLSFSATDLDMEIIDEGFAQID--VPGQITAPAHTLYEIVRKLPDGSLSFSGDDPRLVIQAGRSRFNLPVLPAGDFPVMSSDGLSS-----RIAVDTNELIRLIDKTRFAISTE-ETRYYLNGLYVHTVGETKLRAVATDGHRLALAEMPAPEGIPGVIVPRKTIAEARRLMESAGETVDLQVSP-------QKVRFEFGAAALTSKVIDGAFPDYMRVIPRDNAKILTLDNDLFAKAVDRVATIS-AEKSRSVKLAVEPGRITLTVRNMEAGQAVEEVE-VDYDGEPFEIGFNARYLLDVCGQIAGPQAEFRFADPASPTLVVDPVDPGVKYVLMPLR 372
18 -83.7003t0p_A mol:protein length:371 DNA polymerase III, beta subunit  ali model follow..  18  2MKLICSKANLLKGVNIVSKAVPTRTTM-AILECILIDASANEIKLMANDMELGIETIIDGTIE--ERGIIALDAKIFSEIVRKLPDNDVTIETDASKTVISCEKAKFNIIGKSGDDFSYIPYVERNE-----SIVLSQFTLKEVIRQTIFSIADN-DNNKLMTGELFEIEENK-LRVVSLDGHRISIRYIEMKNDSKKVVVPGKTLQEISKIIPGSADE------DVVIYITNNHIVFEFENTTVVSRLIEGEYFKIDQMLSSDYDTKVRINKRELLDCIDRATLLVKEGDKKPIIMNITDGNMELRI-NSFIGSMNEDID-IDKDGKDIMIGFNPKFFIDALRVIDEEEVNLYMVNPKAPCFIKD-DEGKFIYLILPVN 365
19 -83.6006dlk_A mol:protein length:387 Beta sliding clamp  ali model follow..  19  4LKLIVETKTLVQSLGFASSVVEKRNVI-PEYANIKLSAQDGNLELSSTNMDLYLSQKIAVQVV--SEGECTVSTKTLNDIVRKLPDSELTLTDGTTGLEIKGKNCKFNLFTLPVSSFPAMDSINPEA-----SFKISCTDFAKIIESTKFSISLD-ETRYNLNGVYLHIKDKE-FCSASTDGHRLSISWVTLEKKNFGVILPQKSAEEILKIVKDPKNI-----EDIEILLNSNKIKFICENTIMLSKLIDGTFPDYSTFIPESSSSKLVINRKMFADSIERIAIIT-VEKFRAVKLSLSRETLEISAVGEARGNAKEVINSEYNSDESLAIGFNPQYLEDVLKAVKSDLVELYFSDVSAPVLIKFPENPKDIFVVMPVK 380
20 -83.4005w7z_A mol:protein length:387 DNA polymerase III subunit beta  ali model follow..  20  4LKLIVETKTLVQSLGFASSVVEKRNVI-PEYANIKLSAKDGNLELSSTNMDLYLSQKIAVQVV--SEGECTVSTKTLNDIVRKLPDSELTLTDGTTGLEIKGKNCKFNLFTLPVSSFPAMDSINPEA-----SFKISCTDFAKIIESTKFSISLD-ETRYNLNGVYLHIKDKE-FCSASTDGHRLSISWVTLEKKNFGVILPQKSAEEILKIVKDPKNI-----EDIEILLSSNKIKFICENTSMLSKLIDGTFPDYSTFIPESSSSKLVINRKMFADSIERIAIIT-VEKFRAVKLSLSRETLEISAVGEARGNAKEVINSEYNSDESLAIGFNPQYLEDVLKAVKSDVVELYFSDVSAPVLIKFPENPKDIFVVMPVK 380
21 -82.7006man_A mol:protein length:387 Beta sliding clamp  ali model follow..  20  4LKVIVETKTLVQALGFASSVVEKRNII-SELANIKLLAKDGLLELSSTNMDLYLSQKIGVQVV--SEGELTVSTKTLNDIVKKLPDSELTLTDGTTGLEITGKNCRFNLFTLPVESFPVMDNINPEA-----SFKISCAEFAKIIESTKFSVSLD-ETRYNLNGIYLHVKDSE-FYAASTDGHRLSVSSVVLAEEDFGVILPQKSAEEILKIVKDSKNA-----ADIEILLSSNKIKFICENVIMLSKLIDGTFPDYSSFIPENSSSKLVINRKIFADTIERIAIIT-VEKFRAVKLSLSGEALEISAIGEARGNAKEVIN-SSKETENLDIGFNPQYLEDVLKAIKSDLVELYFSSVSAPVLIKFPESPKDIFVVMPVK 380
22 -81.5006DJK Entity 1(prereleased)  ali follow..  20  4LKLIVETKTLVQSLGFARSVVEKRNVI-PEYANIKLSAKDGNLELSSTNMDLYLSQKIAVQVL--SEGEITVSTQTLSDIVRKLPDSELTLTEDIMKLEIKGQNCQFNLFTLPVSSFPAMDSIKPEV-----SFKISCADFAKIIESTKFSISLD-ETRYNLNGIYLHIKDKE-FFAASTDGHRLSISWITLEEKNFGVILPQKSAEEILKIVKDLKNI-----EDIEILLSSNKIKFICENTILLSKLIDGTFPDYSAFIPKSSISKLVINRKIFADSIERIAIIT-VEKFRAIKLSLSRKTLEISAVGEARGNAKEIITAEYNCDESLVIGFNPQYLEDVLKAVKSNLVELYFSDASAPVLIKFPQNPKDIFVIMPVK 382
23 -81.5006d46_A mol:protein length:389 Beta sliding clamp  ali model follow..  20  4LKLIVETKTLVQSLGFARSVVEKRNVI-PEYANIKLSAKDGNLELSSTNMDLYLSQKIAVQVL--SEGEITVSTQTLSDIVRKLPDSELTLTEDIMKLEIKGQNCQFNLFTLPVSSFPAMDSIKPEV-----SFKISCADFAKIIESTKFSISLD-ETRYNLNGIYLHIKDKE-FFAASTDGHRLSISWITLEEKNFGVILPQKSAEEILKIVKDLKNI-----EDIEILLSSNKIKFICENTILLSKLIDGTFPDYSAFIPKSSISKLVINRKIFADSIERIAIIT-VEKFRAIKLSLSRKTLEISAVGEARGNAKEIITAEYNCDESLVIGFNPQYLEDVLKAVKSNLVELYFSDASAPVLIKFPQNPKDIFVIMPVK 382
24 -80.6004trt_A mol:protein length:368 DNA polymerase III subunit beta  ali model follow..  15  2MKANVTKKTLNEGLGLLERVIPSRSSN-PLLTALKVETSEGGLTLSGTNLEIDLSCFVPAEVQ--QPENFVVPAHLFAQIVRNLGGELVELELSGQELSVRSGGSDFKLQTGDIEAYPPLSFPAQA------DVSLDGGELSRAFSSVRYAASNE-AFQAVFRGIKLEH-HGESARVVASDGYRVAIRDFPASGDGKNLIIPARSVDELIRVLKDGEARFTY---------GDGMLTVTTDRVKMNLKLLDGDFPDYERVIPKDIKLQVTLPATALKEAVNRVAVLADKNANNRVEFLVSEGTLRLAA-EGDYGRAQDTLSVQGGTEQAMSLAFNARHVLDALGPIDGD-AELLFSGSTSPAIFRAGGGGGYMAVMVTLR 361
25 -15.2001b77_A mol:protein length:228 PROTEIN (SLIDING CLAMP)  ali model follow..  11  1.......................................................................................................................................................MKLSKDTIAILKNFAILLSQGKFIMTRAVNGTTYAEANISDEIDFDVALYDLNSFLSILSLVSDDAEISMHTDGNIKIADTRSTVYWPAADKSTIV------FPNKPIQFP-VASVITEIKAEDLQQLLRVSRGLQIDT----IAITNKDGKIVINGYNKVEDSGLTRPKSLTLTDYDGSNNFNFVINMANMKIQPGN-YKVMLWGAGDKVAAKFESSQVSYVIAM... 220
26 -14.3001rwz_A mol:protein length:245 DNA polymerase sliding clamp  ali model follow..  11  3....................................................................................................................................DVIMTGELLKTVTRAI----------VALVSEARIHFLEKG-LHSRAVDPANVAMVIVDIPKEEKTIGVDMDRIFDISKSISTKDLVELIVEDESTLKVKFGSVEYKVALIDPSAIRKEPRIPEL------ELPAKIVMDAGEFKKAIAAADKISDQ-----VIFRSDKEGFRIEAKG-DVDSIVFHMELIEFNGGEARSMFSVDYLKEFCKVAGGDLLTIHLGTN-YPVRLVVGGRAKVEYILAP.. 240
27 -11.7002io4_B mol:protein length:246 DNA polymerase sliding clamp C  ali model follow..  11  6...............................................................................................................................VIDAVSFSYILRTVGDFLSEANFIVTKE--------GIRVSGIDPSRVVFLDIFLPSSYFEGFEVSQEKEIIGFKLEDVNDILKRVLKDDTLILSSNESKLTLTFDGEFTRSFELPLIQVESTQPPSVNL------EFPFKAQLLTITFADIIDELSDLGEV-----LNIHSKENKLYFEVIGDKVELSTDNGTLLEASGADVSSSYGMEYVANTTKMRRSDSMELYFGSQ-IPLKLR-PQEGYGDFYIAP.. 243
28 -11.4006aig_A mol:protein length:263 DNA polymerase sliding clamp 1  ali model follow..  17....................................................................................................................................MFRYEAKVFKELVDSVS-KILDEGLFIITGEGLRLRGMDPARVALVDIPSSSFFDFYMAGDVERVELGVNMETLKGVVARAKKGDQLEVRVREDKVLFIVESVVLRRYLLPNLEVIVDVPEDIS------LEFDATATVIADVVKKTLRDVELVGDI-----VEFDAGEDYLSIRSVGPERRRVETRLTRESPAKEPATSRYDVGYLKRMLGVAKAESIELSFSTD-KPLKMV-PDGSRVTYLLAP.. 260
29 -11.2003k4x_A mol:protein length:798 Proliferating cell nuclear antigen  ali model follow..  13  408STLSLPSSEFSKIVRDLSQLSDS----------INIMITKETIKFVADGDIGSGSVIIKIKLEMDQPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEQFDLKSGFLQFFLA-------PKFNDEGSNSQASNSGALEAKFEEASLFKRIIDGFKD------CVQLVNFQCKEDG-IIAQAVDDSRVLLVSLEIGVHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLK-IEELQYDSTLSLPSSEFSKIVRDLSQLSDS-----INIMITKETIKFVADG-DIGSGSVIIKPFVDMDQPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLAPK. 793
30 -10.9003hi8_A mol:protein length:247 Proliferating cell nuclear antigen PcnA  ali model follow..  3....................................................................................................................................KAIVSAATLRDALDSV----------SVLVDECKIRLNEES-LSIRAVDPANVGMVDLTLDAAAFEIGVNLSRLEEVAGMAGAGD-LIHLTLDEE-----TRKLNIRIDGLSYTLALIDPDSIRQEPDIPDDLAANIVLEGTHLDRGIKAADMVSDH-----IRLRVDGAEETFHIEAEGDTDDLPPADLISIEAGAADSLFSLDYLKDMNKAIPDAEVTVELGEE-FPVKLHAEGMGTITYMLAP.. 242
31 -10.1003aix_A mol:protein length:246 DNA polymerase sliding clamp C  ali model follow..  10  5...............................................................................................................................VIDADAFSYIFRTLEEFIDEITLDFTSD--------GLKIRGIDPSRVTFIDILIPAGYFEEYNVEKEEKVGVKLEDFTDVLKTVTKNDSLYLETDENQNIKVTLDGVYERTFTFPSIVASEIETPNLNL------EFPFKAKALTVTFTDIIDEIEDIGGDS----ITFKAEGGKLYLSANSDTIELSTENGGLLESEGGDAESVYGLEYVVNTSKMRKSDTVEIAFGSQ-IPLKLR-PQGGYADFYIAP.. 243
32 -9.8402hii_A mol:protein length:257 PCNA1 (SSO0397)  ali model follow..  10  1...........................................................................................................................................MFKIVYPNAKDFFSFINSITNVTDSIILNFTEDG-IFSRHLTEDKVLMAIMRIPKDPTSVKLDVSSVKKILSKASSKKATIELTETDSGLKIIKSGAKSTIYIKAEKGQVEQLTEPKV------NLAVNFTTDESVLNVIAADVTLVGEE-----MRISTEEDKIKIEAGEEGKRYVAFLMKDKPLKDTSASSSYSAEMFKDAVKGLRSAPTMVSFGEN-LPMKID-VSGGHMIFWIAP.. 247
33 -9.8401ud9_A mol:protein length:245 DNA polymerase sliding clamp A  ali model follow..  12  1...................................................................................................................................AHIVYDDVRDLKAIIQALLKLVDEALFDIKPEGIQLVAIDKAHISLIKIELPKEMFKEYDVPEEFKFGFNTQYMSKLLKAAKRKEEIIIDADSPEVVKLTLSGALNRVFNVNNIEVLPPEVPEVN------LEFDIKATINASGLKNAIGEIAEVADT-----LLISGNEEKVVVKGEGENKVEVEFSKDTGSLANKESSSAYDVEYLNDIISLTKSDYVKVAFADQ-KPMQLE-EGGGKVTYLLAP.. 242
34 -9.7301ge8_A mol:protein length:249 PROLIFERATION CELL NUCLEAR ANTIGEN  ali model follow..  12  6..............................................................................................................................VFEGAKEFAQLIDTASKLIDEAAFKVTED--------GISMRAMDPSRVVLIDLNLPSSIFSKYEVVEPETIGVNLDHLKKILKRGKAKDTLILKKGEENFLEITIQGTATRTFRVPLIDVEEMEVDLPE------LPFTAKVVVLGEVLKDAVKDASLVSDS-----IKFIARENEFIMKAEGEKLTLEDEGLLDIEVQ-EETKSAYGVSYLSDMVKGLGADEVTIKF-GNEMPMQME-RDEGRLTFLLAP.. 245
35 -9.6502ix2_C mol:protein length:259 DNA POLYMERASE SLIDING CLAMP A  ali model follow..  10  19..............................................................................................................................VYDDVRVLKDIIQALARLVDEAVLKFKQD--------SVELVALDRAHISLISVNLPREMFKEYDVNDEFKFGFNTQYLMKILKVAKRKEAIEIASESPDSVIINIIGSTNREFNVRNLEVSEQEIPEINL------QFDISATISSDGFKSAISEVSTVTDN-----VVVEGHEDRILIKAEGESEVEVEFSKDTGGLQSKESKNSYSAEYLDDVLSLTKSDYVKISFGNQ-KPLQLF-EGGGKVTYLLAP.. 257
36 -9.6203lx1_A mol:protein length:255 DNA polymerase sliding clamp 1  ali model follow..  12  6..............................................................................................................................VFDGAKEFADLIATASNLIDEAAFKFTEE--------GISMRAMDPSRVVLIDLNLPESIFSKYEVEEPETIGINMDQFKKILKRGKAKDTLILRKGDENFLEITFEGTAKRTFRLPLIDVEELELELPE------LPFTAKVVLLGEVLKEGIKDASLVSDA-----IKFIAKENEFTMKAEGERLTLEDEGLLDLEVE-EETKSAYGIRYLSDMVKGIGADEVILRF-GNEMPLQME-RDEGRLTFLLAP.. 245
37 -9.6203aix_B mol:protein length:248 DNA polymerase sliding clamp B  ali model follow..  10  1...........................................................................................................................................MIKATYSSAKDFYSLLSGLLKVTDEIILNFTEDS-IFSRYLTDDKVLMVIFKIPDKPLGIKININDLKKILGKAKSKSATVTLEETEAGLKVTKTGTRSNIYIKGEKTSIDQLTEPKV------NLSVTFTTDGDVLKDIARDLSLVGEE-----VEISADENTVTLSTEEAGRTYKSLLKQDKPLKESPSKAVYSIEVLKDVFKVTSSQNVTVGF-GNNIPMKIE-DSGGQLIFWIAP.. 246
38 -9.6103lx2_A mol:protein length:259 DNA polymerase sliding clamp 2  ali model follow..  12  6..............................................................................................................................VFDSAREFESLIATLEKFFDEAVFQVNME--------GIQMRAIDPSRVVLVDLNLPEMLFSKYSVESEEAIAFDLKRFLKVLKLARSRDTLVLRKGGENFLEVGLLGDENTWFKLPLIDANTPEIEIPS------LPWTVKAVVLAGALKRAVKAAKLVSDS-----IYFMATPEKLTFKAEGNVLTMEDPGLLDLEHKMTKAKSAYGVAYLEDILRSLAADEVIIRFGFD-IPLLLK-RDAGEVSFLIAP.. 246
39 -9.5602hii_C mol:protein length:252 PCNA3 (SSO0405)  ali model follow..  10  5...............................................................................................................................YDDVRVLKDIIQALARLVDEAVLKFKQD--------SVELVALDRAHISLISVNLPREMFKEYDVNDEFKFGFNTQYLMKILKVAKRKEAIEIASESPDSVIINIIGSTNREFNVRNLEVSEQEIPEINL------QFDISATISSDGFKSAISEVSTVTDN-----VVVEGHEDRILIKAEGESEVEVEFSKDTGGLQSKESKNSYSAEYLDDVLSLTKSDYVKISFGNQ-KPLQLF-EGGGKVTYLLAP.. 242
40 -9.4206e49_A mol:protein length:272 Proliferating cell nuclear antigen  ali model follow..  13  6........................................................................................................................................QDPMLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDG-IIAQAVDDSRVLLVSLEIGVEPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLK-IEELQYDSTLSLPSSEFSKIVRDLSQLSDS-----INIMITKETIKFVADGFVDMEHPETSIKLEMD-QPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLAP.. 260
41 -9.3705a6d_A mol:protein length:249 DNA POLYMERASE SLIDING CLAMP  ali model follow..  12  6..............................................................................................................................VFDGAKEFADLIATASNLIDEAAFKITEE--------GVSMRAMDPSRVVLIDLNLPESIFSKYEVEEPETIGINMDHFKKILKRGKSKDTLILRKGDENFLEITFEGTAKRTFRLPLIDVEELELELPE------LPFTAKVVLLGEVLKEAIKDASLVSDS-----LKFIAKEDEFTMKAEGEKLTLEDEGLLDLEVE-EETRSAYGISYLADMVKGIGADEVTLRFGTE-MPLQMD-RDEGKLTFLLAP.. 245
42 -9.1601sxj_F mol:protein length:283 Proliferating cell nuclear antigen  ali model follow..  13  17........................................................................................................................................MASMLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDG-IIAQAVDDSRVLLVSLEIGVEPVTLGMDLTSLSKILRCGNNTD-TLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDS-----INIMITKETIKFVADGFVDMEHPETSIKLEMD-QPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLAP.. 271
43 -9.1104yhr_A mol:protein length:266 Proliferating cell nuclear antigen  ali model follow..  11  7..............................................................................................................................KFEEASLFKRIIDGFKDCVQLVNFQCKED--------GIIAQAVDDSRVLLVSLEIGVEAFQEYRCD-HPVTLGMDLTSLSKILRCGNNTD-TLTLIADNTPDSIILLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRDLSQLSDS-----INIMITKETIKFVADGFVDMEHPETSIKLEMD-QPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLAP.. 254
44 -9.1105jne_D mol:protein length:258 Proliferating cell nuclear antigen  ali model follow..  13  1...........................................................................................................................................MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDG-IIAQAVDDSRVLLVSLEIGVHPVTLGMDLTSLSDILREGNNTDTLTLIADNTPDSIILLFEDTKKDDIAEYSLKLMDIDADFLG-IEELQYDSTLSLPSSEFSKIVRDLSQLSDS-----INIMITCETIKFVADG-DIGSGSVIIKPFVDMDQPVDLTFGAKYLLDIIKGSSSDRVGIRLSSEAPALFQFDLKSGFLQFFLAP.. 252
45 -9.1003p91_A mol:protein length:265 Proliferating cell nuclear antigen  ali model follow..  13  10..............................................................................................................................KFKEAALFKRVVESLKSTIDKTNFDCSDA--------GIAVQCMDNSHVSLVSLLIETDAFDEFQCL-KPITLGINLTHLSKILKALDNDC-GLILDVKKVDDAVLSITSEGTNKTMKFGLNLVDIEAESVE-IPELQSDAIITLSSAEFLKITKDFSALGDD----SITIGCTKNEVTLTTKGSALENVDSNGLQIEHN-KDVTASFALKQISEFAKSAPADNVKLSLSGQAPLIMEFKGEACVLKFYLAP.. 255
46 -9.0205tup_A mol:protein length:259 Proliferating cell nuclear antigen  ali model follow..  4....................................................................................................................................EARLEQASLLKRVVDAIKDLVQDCNFDCNDSGIALQAMDNSHVALVSMLLKAEGFSPYRCD-RNIALGINLVSLTKVLRAAQNEDILTLKADDSPDAVNLMFESAETDRISEYDIKLMDIDQEHLA-IPETEYAATVEMPSAEFQRICRDLNALSES-----VVIEATKEGVKFSCQG-DIGSGSVTIRQHTSVSEPVALTFSLKYLVNFCKATSSSKVTLCLSQEVPLLVEYGLGSGHLRFYLAP.. 253

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.