current user: public

If you have questions about the server, please let us know.

Query: gi|108885077|ref|NP_072673.2| methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase (MG_013) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MSFDGKLKAQSILETYKNFDWSKCKLVIIQANDDDSSDSFIKQKLIACNTVGAKSELIKLSNQITQAELIEKIISLNHDVNVTGIILQLPVYPHLDKNSLLEAINPLKDVDGLTTNHLAEIKPCIVEAIITLKELFNLEFNNQKIVVVGLGITGGKPIYEFLKTSGYKVQACDKDTPNTFELIKSADIVFTAIGKSHFFQAKNFKKGVILFDIGVSRNKQNKLCGDINPEGIEKKARWWTKTPGGVGPFTVLAIIKNLWILHEKNKRCLQSSILast
1 -106.0003p2o_A mol:protein length:285 Bifunctional protein folD  ali model follow..  30  6.LLDGKALSAKIKEELKEKNGIESCLAVILVGDNPASQTYVKSKAKACEECGIKSLVYHLNENITQNELLALINTLNHDDSVHGILVQLPLPDHICKDLILESIISSKDVDGFHPINVGYFLPCTPLGVMKLLKAYEIDLEGKDAVIIGASNIVGRPMATMLLNAGATVSVCHIKTKDLSLYTRQADLIIVAAGCVNLLRSDMVKEGVIVVDVGINRLESGKIVGDVDFEEVSKKSSYITPVPGGVGPMTIAMLLENTVKSAKNRLN...... 285
2 -104.0004a5o_A mol:protein length:286 BIFUNCTIONAL PROTEIN FOLD  ali model follow..  30  7.LIDGKAIAANLRQQIAQRVLRVPGLAVILVGTDPASQVYVAHKRKDCEEVGFLSQAYDLPAETSQDDLLALIDRLNDDPAIDGILVQLPLPAHLDASLLLERIHPDKDVDGFHPYNIGRLRPCTPKGIMTLLASTGADLYGMDAVVVGASNIVGRPMALELLLGGCTVTVTHRFTRDLADHVSRADLVVVAAGKPGLVKGEWIKEGAIVIDVGINRQADGRLVGDVEYEVAAQRASWITPVPGGVGPMTRACLLENTLHAAEHLHD...... 286
3 -104.0005o22_A mol:protein length:289 Bifunctional protein FolD  ali model follow..  30  6.IIDGKTIAQQVRSEVAQKVLRAPGLAVVLVGSNPASQIYVASKRKACEEVGFVSRSYDLPETTSEAELLELIDTLNADNTIDGILVQLPLPAGIDNVKVLERIHPDKDVDGFHPYNVGRLRPCTPRGIVTLLERYNIDTFGLNAVVIGASNIVGRPMSMELLLAGCTTTVTHRFTKNLRHHVENADLLIVAVGKPGFIPGDWIKEGAIVIDVGINRLENGKVVGDVVFEDAAKRASYITPVPGGVGPMTVATLIENTLQACVEYHDPQDE.. 289
4 -103.0003l07_A mol:protein length:285 Bifunctional protein folD  ali model follow..  30  5ILIDGKSLSKDLKERLATQVAITPKLVAIIVGNDPASKTYVASKEKACAQVGIDSQVITLPEHTTESELLELIDQLNNDSSVHAILVQLPLPAHINKNNVIYSIKPEKDVDGFHPTNVGRLESCTPKGIMTMLREYGIKTEGAYAVVVGASNVVGKPVSQLLLNAKATVTTCHRFTTDLKSHTTKADILIVAVGKPNFITADMVKEGAVVIDVGINHV-DGKIVGDVDFAAVKDKVAAITPVPGGVGPMTITELLYNTFQCAQELNR...... 285
5 -103.0006ape_A mol:protein length:298 Bifunctional protein FolD  ali model follow..  31  9VLLDGQALAYSIEKDLKNKIHKRPKLAVILVGKDPASITYVNMKIKACERVGMDFDLKTLQENVTEAELLSLIKDYNTDQNISGVLVQLPLPRHIDSKMVLEAIDPSKDVDGFHPLNIGKLLPATPMGVMRLLKHYHIEIKGKDVAIIGASNIIGKPLSMLMLNAGASVSVCHILTKDISFYTQNADIVCVGVGKPDLIKASMLKKGAVVVDIGINHLNDGRIVGDVDFTNAQKVAGFITPVPKGVGPMTIVSLLENTLIAFEKQQR...... 289
6 -102.0001dia_A mol:protein length:306 METHYLENETETRAHYDROFOLATE DEHYDROGENASE/CYCLOHYDROLASE  ali model follow..  28  6.ILNGKEISAQIRARLKNQVGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSEINTEEVINAIAPEKDVDGLTSINAGRLIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDDKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLEKFKPG. 301
7 -102.0005nhs_A mol:protein length:296 Bifunctional protein FolD  ali model follow..  28  14.ILDGRRIAEDLLDELKTRVQPRPGLAVVLVGGDPASTVYVRNKRRAAEKVGIEAFDYDLPAGTGEAELLSLIDQLNADPKIHGILVQLPLPGIADASRLIHRIDPRKDVDGFHPQNVGHLRPCTPRGIVTLLAHTDQPVRGRNATIVGVSNHVGRPMALELLIAGCTVSCCHKFTPVLQTHVRDADILVVAVGRPGLIPGDWVKPGAVVIDVGINRLDDGRLVGDVGFEAAAQRASWITPVPGGVGPMTVATLMQNTIEAADAALR...... 295
8 -101.0004a26_A mol:protein length:300 PUTATIVE C-1-TETRAHYDROFOLATE SYNTHASE, CYTOPLASMIC  ali model follow..  28  8.IIDGKAIAAAIRSELKDKVGRVPGLASIIVGQRMDSKKYVQLKHKAAAEVGMASFNVELPEDISQEVLEVNVEKLNNDPNCHGIIVQLPLPKHLNENRAIEKIHPHKDADALLPVNVGLLTPCTAKGVIVLLKRCGIEMAGKRAVVLGRSNIVGAPVAALLMKENATVTIVHSGTSDMIDYLRTADIVIAAMGQPGYVKGEWIKEGAAVVDVGTTPVPDYRLVGDVCFEEAAARAAWISPVPGGVGPMTIAMLLENTLEAFKAALGV..... 299
9 -99.9005tc4_A mol:protein length:316 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial  ali model follow..  30  4VVISGRKLAQQIKQEVRQEVNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGATVTISHRYTEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVHDPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEREV 305
10 -99.8004b4u_A mol:protein length:303 BIFUNCTIONAL PROTEIN FOLD  ali model follow..  32  18LVLDGRALAKQIEENLLVRVGRTPILATILVGDDGASATYVRMKGNACRRVGMDSLKIELPQETTTEQLLAEIEKLNANPDVHGILLQHPVPAQIDERACFDAISLAKDVDGVTCLGFGRMGSATPAGIMTILKENNIEIAGKHAVVVGRSAILGKPMAMMLLQANATVTICHSRTQNLPELVKQADIIVGAVGKAELIQKDWIKQGAVVVDAGFHPR-DGGGVGDIQLQGIEEIASAYTPVPGGVGPMTITTLIRQTVEAAEKA........ 295
11 -99.3002c2x_A mol:protein length:281 METHYLENETETRAHYDROFOLATE DEHYDROGENASE-METHENYLTETRAHYDROFOLATE CYCLOHYDROLASE  ali model follow..  32  4IMLDGKATRDEIFGDLKQRVGRTPGLGTILVGDDPGSQAYVRGKHADCAKVGITSIRRDLPADISTATLNETIDELNANPDCTGYIVQLPLPKHLDENAALERVDPAKDADGLHPTNLGRLLPCTPRGIVHLLRRYDISIAGAHVVVIGRGVTVGRPLGLLLTRRNATVTLCHTGTRDLPALTRQADIVVAAVGVAHLLTADMVRPGAAVIDVGVSRT-DDGLVGDVHPD-VWELAGHVSPNPGGVGPLTRAFLLTNVVELAERR........ 281
12 -98.6004cjx_A mol:protein length:319 C-1-TETRAHYDROFOLATE SYNTHASE, CYTOPLASMIC, PUTATIVE  ali model follow..  26  20VVIDGRAVAKAIQKELTEEVGRRPGLSTIICGKRKDSQTYVRLKRKAAAACGFRNFSVELPANVTQEALEREVIRLNEEEACHSIVVQLPLPPHIDKVAALSKIKPEKDADCLLPVNVGQLVPCTASAVMELLRCSGVEICGKRVVVLGRGDIAGLPVATLLANEDATVTVVHSPLCDIADIVRASDIVVSAAGQPGLVRGEWIKLGAAVIDVGTTPVADPRLVGDVCFDVARKRAAYITPVPGGVGPVTVSMLLKNTLTMFKRSVR...... 311
13 -94.1003ngl_A mol:protein length:276 Bifunctional protein folD  ali model follow..  23  3.ILRGEEIAEKKAENLHGIIGLEPSLKLIQIGDNEAASIYARAKIRRGKKIGIAVDLEKYD-DISMKDLLKRIDDLAKDPQINGIMIENPLPKGFDYYEIVRNIPYYKDVDALSPYNQGLLVPATPRAVIDIMDYYG--YHENTVTIVNRSPVVGRPLSMMLLNRNYTVSVCHSKTKDIGSMTRSSKIVVVAVGRPGFLNREMVTPGSVVIDVGINYV-NDKVVGDANFEDLSEYVEAITPVPGGVGPITATNILENVVKAAEFQKN...... 274
14 -82.5001edz_A mol:protein length:320 5,10-METHYLENETETRAHYDROFOLATE DEHYDROGENASE  ali model follow..  19  7.TILASKVAETFNTEIINNVGQGPLLVGFLANNDPAAKMYATWTQKTSESMGFRYD---LRVIEDKDFLEEAIIQANGDDSVNGIMVYFPVFGNAQDQYLQQVVCKEKDVEGLNHVYYQNLLPCTPLAIVKILEFLKIRLYGKKCIVINRSEIVGRPLAALLANDGATVYSVDVNNDLLKKCSLDSDVVITGVPSENKFPTEYIKEGAVCINFAC---------TKNFSDDVKEKASLYVPMTGKV---TIAMLLRNMLRLVRNVELSKEK.. 320
15 -14.8004q39_A mol:protein length:260 PYLD, pyrrolysine synthase  ali model follow..  16  2............MALLTPDDLININMQLQKADSAVQEVTGLDIKGICKALYGTFSSSEKVPVTSGNGIIGNFSASLHAITQYFGFDSFVTDMPDV--SGYYEAVQNGAEI-NLKNGKMANNQPCTGIIYAEIASRY-LKADSKDVLVVGLGK-VGFPGAEHLVQKDFRVYGYDADETLLERAPKKFSIIFEATPCANTIPEAVLSENCVLSTPGIPCAISEELRDKYEVQLIAE------PLGIGTASMLYSVL................... 260
16 -13.6003d4o_A mol:protein length:293 Dipicolinate synthase subunit A  ali model follow..  17  141...............................................................................................................................TIMMAIQHTDFTIHGANVAVLGLGR-VGMSVARKFAALGAKVKVGARESSKAAQELRDVDVCINTIPA-LVVTANVLPSHTFVIDLASKP-------GGTDFRYAEKKALLVPGLPGIVAPKTAGRILADVLVKLLAEPS...... 293
17 -13.0002rir_A mol:protein length:300 Dipicolinate synthase, A chain  ali model follow..  17  7........................GLKIAVIGGDARQLEII----RKLTEQQADIYLVGFDQLDHGFTGAVKCNIDEIPFQQIDSII-LPVSATTGEGVVSTVFSNEEKLFERDDIAIYNSIPTVEGTIMLAIQHTDYTIHGSQVAVLGLGR-TGMTIARTFAALGANVKVGARSSDELKEHVKDIDICINTI--SMILNQTVLTPKTLILDLASRP-------GGTDFKYAEKKALLAPGLPGIVAPKTAGQILANVL.............. 287
18 -10.5003pgj_A mol:protein length:302 Shikimate dehydrogenase  ali model follow..  1..MSSGVDLGTENLYFQSNAMASQIDQYAVFGNPINHSKSPFIHTLFARQTQQSMIYTAQ--CVPVDGFTEAAKHFFA-QGGRGCNVTVPFKEEAYRDRLTERARLAGAVNTLKKLDDGEILGDNTEGLVQDLLAQQVLLKGATILLIGAGGAARGVLKPLLDQQPASITVTNRKAQAFEQLKQSYDVIINSTGELPAIDPVIFSSRSVCYDMMYGKGYTVFNQ--------WARQHGCAQAIDGLG-----MLVGQAAESFM.......... 272
19 -10.1003oj0_A mol:protein length:144 Glutamyl-tRNA reductase  ali model follow..  16  5.............................................................................................................................KVSIPSIVYDIVRKNGGNKILLVGNGML-ASEIAPYFSYPQYKVTVAGRNIDDIDSLIKNNDVIITATSSKTIVEERSLMPGKLFIDLG---------------------------NPPNIERGNNVITLDEIYEISKKNEMLREEKI 142
20 -9.9701p74_A mol:protein length:272 Shikimate 5-dehydrogenase  ali model follow..  11  6.............................VWGNPIAQSKSPLIQNKLAAQTHQTMEYIAK--LGDLDAFEQQLLAF-FEEGAKGCNITSPFKERAYQDEYSQRAKLAEACNTLKKLDDGKLYADNTIGLVTDLQRLNWLRPNQHVLILGAG--ATKGVLLPLLQAQQNIVLANRTFSKTKELAETYDLVINATGGTASVDAEILKLGSAFYDMQYAKGTDTPFIALCKSLGLTN-------VSDGFG-----MLVAQAAHSFH.......... 251
21 -9.7301nyt_A mol:protein length:271 Shikimate 5-dehydrogenase  ali model follow..  11  6.............................VFGNPIAHSKSPFIHQQFAQQLNIEHPYGRV--LAPINDFINTLNAFFS-AGGKGANVTVPFKEEAFADELTERAALAGAVNTLMRLEDGRLLGDNTVGLLSDLERLSFIRPGLRILLIGAG--ASRGVLLPLLSLDCAVTITNRTVSRAEELAKEFDLIINATGDIPAIPSSLIHPGIYCYDMFYQKGKTPFLA--------WCEQRGSKRNADGLG-----MLVAQAAHAFL.......... 250
22 -9.5805hm8_A mol:protein length:498 Adenosylhomocysteinase  ali model follow..  23  240..............................................................................................................DSVTKSKFDNTYGCRQSLLHGLFNGCIQMLAGKKIVVLGYGE-VGKGCAQGLSGVGARVIVTEIQVSVLEDVVSEADIFITATGNKDVITVEKMKENAYIANIG........................................................... 358
23 -9.0503u62_A mol:protein length:253 Shikimate dehydrogenase  ali model follow..  11  1.........................MKFCIIGYPVRHSISPRLYNEYFKRAGMNHSYGME--EIPPESFDTEIRRILEE--YDGFNATIP-----HKERVMRYVEPSEDAQRIKAVNCVFRGKGYNTDWVGVVKSLEGVEVKEPVVVVGAGGAARAVIYALLQMGVKDIWVVNRTIEQLDEVVKKAKSLFNTTGEELPVSDDSLKNLSLVYDV---------IYFDTPLVVKARKLGVKHIIKG------NLMFYYQAMENLK.......... 234

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.