current user: public

If you have questions about the server, please let us know.

Query: gi|108885077|ref|NP_072673.2| methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase (MG_013) [Mycoplasma genitalium G37], from M.genitalium

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MSFDGKLKAQSILETYKNFDWSKCKLVIIQANDDDSSDSFIKQKLIACNTVGAKSELIKLSNQITQAELIEKIISLNHDVNVTGIILQLPVYPHLDKNSLLEAINPLKDVDGLTTNHLAEIKPCIVEAIITLKELFNLEFNNQKIVVVGLGITGGKPIYEFLKTSGYKVQACDKDTPNTFELIKSADIVFTAIGKSHFFQAKNFKKGVILFDIGVSRNKQNKLCGDINPEGIEKKARWWTKTPGGVGPFTVLAIIKNLWILHEKNKRCLQSSILast
1 -103.000[H] COG0190 5,10-methylene-tetrahydrofolate dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase  ali follow..  28  5.IISGTELSKQIKANLADKIKRAPGLAVILVGADPASQIYVGNKRKSCEEVGILSKSYDLPETTTQNELLAIIDQLNADKNIDGILVQLPLPKQINAEAIIERIDPKKDVDGFHPYNVGRLRACTPYGVMKLLETTGIDLHGKHAVIVGASNIVGRPMSLELLLAGATVTVTHRFTKNLENHVRQADILVVAVGKPNLISGDWIKESAVVIDVGINRV-DGKLVGDVEFDKAAEKAAYITPVPGGVGPMTVAMLMSNTLYAYEHNK....... 282
2 -95.200[H] KOG0089 Methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase  ali follow..  30  32VVISGRKLAQQIKQEVRQEVNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMLPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDGATVTISHRYTEQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVHDPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEREV 333
3 -81.300[H] KOG4230 C1-tetrahydrofolate synthase  ali follow..  28  3LLLEGTSLARKVREELREQIYFNVSLKIIQVGGREDSNVYVRMKTRAANEAGISCEHVNFPEDITEYDLLLAIKGFNEDPTVHGIIVQLPLPAHINEQIITEAVAPEKDVDGFCETNLGKLTACTPKGIMCILKHYGINVQGKHAVVIGRSNIVGRPMSILLEKANATVTLCHSKTESIADIVRTADIVVAAIGIPHFVKADWLKKGVVAIDVGINSIPDARLTGDIDFENAKEVASAITPVPGSVGPMTVAMLLQNVVESAVRFRKMSRK.. 296
4 -12.300[R] COG5322 Predicted dehydrogenase  ali follow..  13  67.............................................................................QGAVCEGILHYMPLTAE--AQRVVDAVESLKDQ-GAQVVGLGGFTAAAYRNVLESMDRLGVEPADTEVAVVGYPGSIALVIAKLLAGHGCRLCLVHRGSNDIEHCYEHVQFYVAATSTGGLIDPYRLRPGSVVVDAALPR----------DVKPYRKDRNDILIIDGGL........................... 279
5 -9.390[E] COG0169 Shikimate 5-dehydrogenase  ali follow..  10.............................VFGNPINHSKSPFIHTLFARQTQQSMIYTAQ--CVPVDGFTEAAKHFFA-QGGRGCNVTVPFKEEAYRDRLTERARLAGAVNTLKKLDDGEILGDNTEGLVQDLLAQQVLLKGATILLIGAGGAARGVLKPLLDQQPASITVTNRKAQAFEQLKQSYDVIINSTGELPAIDPVIFSSRSVCYDMMYGKGYTVFN---------WARQHGCAQAIDGLG-----MLVGQAAESFM.......... 254
6 -7.830[H] COG0499 S-adenosylhomocysteine hydrolase  ali follow..  19  200..............................................................................EETTTGVLYHFAEEGVLPFPAMNVNDAVTKSK-------FDNKYGTRHSLIDGINRATDMLMGGKNVLVCGYGD-VGKGCAEAFDGQGARVKVTEASVVTVDEAIEDADIVITATGNKDIISFEKMKDHALLGNIGHFDNE...................................................... 350
7 -7.810[H] KOG1370 S-adenosylhomocysteine hydrolase  ali follow..  15  184...................................................................................................................................IKQATDVMIAGKVAVVAGYGD-KGKSCAQALRGFRASVIITKTEVTTMDEACQEGDVFVTTTGCVDIILGQQTKDDTIVCNTGYFDV-------EMDVKWLNKNTVEKVNVKLQVDPYRL...................... 311
8 -7.590[R] COG4007 Predicted dehydrogenase related to H2-forming N5,N10-methylenetetrahydromethanopterin dehydrogenase  ali follow..  11  1....................................................................................................................................MSTMKVAVYGLPEKYGGEAPYGGSRMAIEFAEAGHDVVLAEPATDNDAEAASEAEIAVLFTPFGKKTFENHLPEGAVIANTCTVSPVVLYYVLERELRRDRKDLGIASMHPAA............................ 150
9 -7.110[GQ] KOG2741 Dimeric dihydrodiol dehydrogenase  ali follow..  10  10....GLLSCTNKVRKLSRAINLSPNATISAI----ATTSSIEEAKSFAKSNNFP----------PNTKLHSSYESLLEDPDVD--AVYFPIPTRLHVEWATLAAIKGKHI----------------------LLDKPVALNVAEF-----DQIVEACEVNGVQFMDGTQWMHSPRTDKIKEFVNDLESF----GQIKSVYSCFLDGLGALGDAGWYTIQAILLVNNFKLPKTVTALSGSVLNDAGIVLSCGALF................... 230
10 -6.890[E] KOG3007 Mu-crystallin  ali follow..  12  158..............................................................................................................................................RSVRIWNHRFESAKSLASRASKELPSIQIDAVPIQNLENAVKCSDIISSATSKKPIIVGSWINPGTHIDLVGGFTIQISNVFVDTRKGALHEAGDLLTPIKEGL........................... 272

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35