current user: public

If you have questions about the server, please let us know.

Query: gi|108885075|ref|NP_072661.2| DNA polymerase III, beta subunit (MG_001) [Mycoplasma genitalium G37], from M.genitalium

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380
# E-value Template Links and tools%idFirst MKILINKSELNKILKKMNNVIISNNKIKPHHSYFLIEAKEKEINFYANNEYFSVKCNLNKNIDILEQGSLIVKGKIFNDLINGIKEEIITIQEKDQTLLVKTKKTSINLNTINVNEFPRIRFNEKNDLSEFNQFKINYSLLVKGIKKIFHSVSNNREISSKFNGVNFNGSNGKEIFLEASDTYKLSVFEIKQETEPFDFILESNLLSFINSFNPEEDKSIVFYYRKDNKDSFSTEMLISMDNFMISYTSVNEKFPEVNYFFEFEPETKIVVQKNELKDALQRIQTLAQNERTFLCDMQINSSELKIRAIVNNIGNSLEEISCLKFEGYKLNISFNPSSLLDHIESFESNEINFDFQGNSKYFLITSKSEPELKQILVPSRLast
1 0.000e+00UniRef50_A0A2E2V023 Beta sliding clamp n=5 Tax=cellular organisms TaxID=131567 RepID=A0A2E2V023_9GAMM  ali  21  1MIIKIEREKLIEPLKNIVG-VSEKKQTMPILGNVLLITKANKLRLVASDLEVEISTDV--DFDTTEAINTTLPSRKFLDILKSLPGDQVAIEIGDXKATIKSGKSRFVLATLPGSDFP------YQESXASYDCKVSAEVLDTLINQTAFSMAV-QDARHFLNGLFFEVTDS-RITVVATDGHRLSMSDLKNSAEKTSCIIPRKCIMEIKRILTSFKDNKEILVDFN---ITKSDIFIKIGQYIIKSKLIEGSYPDYNKVFPESLPHKLDVNKDELKLALQRMSILS-NEQFKGVKLSLSKSETKLSTNNPSQEEGEDSIS-CSYSGDEMEIGFNLTYLIEVIDVISSENVVLQLNNSDSGCLISSNNESALKYIIMPMR 368
2 0.000e+00UniRef50_A0A0G1LNP7 Beta sliding clamp n=2 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1LNP7_9BACT  ali  20  1MQFTILQENLLKATQEVLRFIPSKTPL-PILSCFLLEVKRGEISFSATDLQTGIKETVDGKV--MSTGATALPARVFVEYISSLPAGTIEVEEKDAELHITAGKASAVFQISSPKDFPQFPEKEGED------VVLPREAFLSIIEKGGLASGVD-ETRPVFSSLYIEGKDG-VLCGVSTDGYRLARKEVKIKGWKYGILLPTKAVREISRII----DRLHVESVGISLSARLGQVFFTAGDLFCSVRLIEASFPDYDTIIPKEFGVQIKFQREEFLSALKTALVF-GKESSGIIKLSIQKDSLLITASSNAVGKNETQVDIEKITGENAEIAFNGKYLQDLLSAVTGETVWFGMNEPLKPGMFKIEGEEGFVYIVMPFR 365
3 0.000e+00UniRef50_A0A1F5Z3S3 Beta sliding clamp n=1 Tax=Candidatus Gottesmanbacteria bacterium RIFCSPHIGHO2_01_FULL_42_12 TaxID=1798377 RepID=A0A1F5Z3S3_9BACT  ali  19  1MLIEVLQENLSSGLTLVSRVISGKIQM-PILGNVLLQTENGQLKLTGTNLDITLTTFIGAKI--IKEGGFTVPVRTLTEIITALPLGKVQLEQKDGQLIVKTGKFVAKINGIPASDWPTETRLESKEKP--TELKLDFKKFKEILGRTVIAVGTD-EARPALTGVLVK-SDGKTLTVVATDGFRLSLSTIEQKSDEFSVIIPAKALLEISRI----------EAKTISLKIIGTSAIFSLDDVTLSARLIAGNFPSYEKIIPNSPESNLSIEAIDLLKAVKLAGVFAR-ESANIIKFGIFNSNMVVKAQASQVGENENEIEIKTDKSEEFVIAFNYHYLLDLLNAVGDADLKFFYSTPLSAGLFKITGDTTFLHLIMPVR 364
4 0.000e+00UniRef50_A0A2E5S5L2 Beta sliding clamp n=5 Tax=Spirochaetes TaxID=203691 RepID=A0A2E5S5L2_9LEPT  ali  16  36MKFVVEKAGFQKAISRIEGIISARE-IRSVISSILIESDKDTITLTATDLDISMKTTLPAKIE--KAGAITAPAKKLSQIIKEFRFESVEIDSDEHKISIRDGAGKAKLMGAPSDEF-MLPSPIKDSHFK----QFPPALVNEMIRRTSYAIA-EEDARYVFNGLYME-SEGDQAVFVGTDGRRLARIARNFPESDKGVVVPVKAIRELTRLIGTVDE------GFVGYDSEEGRLYFKLGDVELITRLIDGNFPDYRQVIPRKLDHEVKLNRDALRLSLRQAAVLAAEP-SRQIRLEFSPGTLVVSSSTPDLGNVNDPMS-CEYQGEEVTIAYNSNYLLDVLGVLNSEDILLGFSTASAPTVIKDPDDAEFVAVVMPMK 405
5 0.000e+00UniRef50_G2Z0C8 Beta sliding clamp n=84 Tax=Bacteria TaxID=2 RepID=G2Z0C8_FLABF  ali  21  1MKFIVSSSYLLKQLQVLGSVINSSNTL-PILDNFLFEIEANKLTVSSSDLETKMSATL--QIDSDSQGSVAVPAKLLLEILKTFPEQPLTFSVDNNTIELSSNNGNYSVAYLPGEEYP------KSVVLEDPSITLPSHVLSTAVSKTIFAAGND-DLRPVMSGVFFQFSP-EGLTFVATDAHKLVKYARQDATEVADFIMPKKPLNILKNNLGAIDTEVKIEYNKSN-------ATFSFDNYVLTCRLIDGKYPNYETVIPKENPNKLMIDRSLFLSSVRRVSIFS-NKTTHQIKLKIAGSELNISAEDIDYSNKAEERLTCDYQGEDMQIGFNSRFLLEMLNSLQSDMILLEMSLPNRAGILTPEDGEAVTMLVMPV. 368
6 0.000e+00UniRef50_A0A2E2STA9 Beta sliding clamp n=5 Tax=Bacteria TaxID=2 RepID=A0A2E2STA9_9FLAO  ali  20  1MKFIVSSSKLLKQLQTISGVINSSNTL-PILDNILFEMMENKLTLTASDLETTMSTSLE--VEANEMGSAAIPAKLLLDTLKTFPEQPLTIDIEKKSVEISSDQGKYALAFHNGKEFPLAPNIEAASSAL-----IHSDIISTGINKTIFATGND-DLRPVMSGVFFKFSDTG-LTLVSTDAHKLVRYTRHDSEQNAEFILPKKPLNLLKGILASFNEEVKIEYNETNAKY-------SFGSIVLTCRLIDGKYPNYNAVIPQENPNKLTIDRISFLNSVKRVAIFS-NKTTHQIRLKIAGNEMHISAEDIDFSNKADERLSCQYKGSDMEIGFNSRFLMEMISNLETEQIHFEMSAPNRAGILLPEGNEDILMLVMPV. 369
7 0.000e+00UniRef50_G5F295 Beta sliding clamp n=25 Tax=Bacteria TaxID=2 RepID=G5F295_9ACTN  ali  21  1MKFSVSQSALAGALAVVSKGMAS-NSTLPILSGVYIKAEEGVLEFQTTNLTISIRHKIQANVE--EAGATVLSGKILSNIVKTLPDSAVSFEGAGHTVLISCEKSKFRLNTLEVGDFPEFP-----DLSPDRSIELPSGLLSQMVDKVYKVTSKDS-SRPILSGILLSVEE-NTIRLVATDSYRLAVCDSNTETSSVDAIVPGNTFHDVL-TLPSMTEEVMVGITD-------SQVVFSFGNTTYVSRKIDGTFPNYRQLLPPSCTTSVRIDVPQFAAALKRVSVIA--LANPSVRFDIDADGLKLSASSPDQGESTELLP-VEVEGEGMAIALNYHYVFDCVNAATGDSITLELQSAMQPGIFKSYSKINYLYLLMPVR 366
8 0.000e+00UniRef50_A0A1F8GYQ2 Beta sliding clamp n=1 Tax=Candidatus Yanofskybacteria bacterium RIFCSPLOWO2_01_FULL_49_25 TaxID=1802701 RepID=A0A1F8GYQ2_9BACT :  ali  17  1MNITINHNKFSQAIRTVERIV-GKTVSLPILSAVLLRADHGQLKLSATNLEMGVQAWVSAKVDT--EGSLAIPARVLSEFISTVTDEKVTLTTEKDILTLSSDHFKTQILGIKPDEFPIIPSV-----NEGATISIDSSVLCLVLGSVVDAAST-LESRPELAGVCMQF-NGKKLTCAATDSFRLSERSVPAEGSPKQIIIPRATAQEVFRLASNTSEPIRITASE-------TQISFKSADFELVSRLIDGHYPDYKRVIPEKLASSASVARTDLEQNVRMASIFTSSVA--DLRLSVDSAMLHVLAKNSDRGEMASHCPA-KLTGGSFDVTVNYHYILDGIKALNTERVVIGFSGPGTPLVMRGEGASDQVYVIMPLR 361
9 0.000e+00UniRef50_A0A2M7R7K8 Beta sliding clamp n=1 Tax=Candidatus Nealsonbacteria bacterium CG_4_10_14_0_8_um_filter_37_14 TaxID=1974684 RepID=A0A2M7R7K8_9BA  ali  18  1MKVTIIKENLRKGLAVIER-ICGKNFTLPILNNVLIKTEKNLLSLSGTDLELGIKYFTLAKIE--KEGQITVPAKLLFNLINFLSEEKIILETKNNILFVSGKNFNSQTKGLPFEDFPIIPQVKQEK----DFIEVKNSPFFEGISKVINFCSISQ-THPELAGIYFNF-QKEKLELVSTDSFRLTKKDLNKINKTYSFILPQKAVRELANILSEKEEQTKIYFEPNQIFFEFLSADFSFPQFYLTSRLIEGEYPNYQEIIPKTHKTQAILNKNEFLSQIKTASLFSGKINKIRIQIEPKQNLINLFSQNPETGEFNSSLPG-EIKGEKTEVSFNFKFLIDGLLNLTGRSIFFGLNGEDGPALLKSSEDPDYIYILMPIK 379
10 0.000e+00UniRef50_A0A2E2WWT8 Beta sliding clamp n=1 Tax=Rickettsiales bacterium TaxID=2026788 RepID=A0A2E2WWT8_9RICK  ali  21  1MQFKVKSNIFLKALSVVNGVVEKRNTI-PVLQNIKITAKNNNINLCASDMDLYASSNIDC--EITQEGCTTVPSQMLFDIVRKINDNQIEIKLEENNIKINCQNSKYNLPCINASEFPDIDNNDYE-----NSIEIEGAEFAKMIDKTKFAISND-ETRYYLNGLYLHNSNKNNICSVATDGHRLALSNIEYNNNDFGIIIPKKSVSEIRRII-DPNAKITIKFSRVKIEISSNQ-------NKLISKLIDGQFPDYNKILPQNNQKIAIINKREFYNSIDRVSSVA-NDKHKSIKLTVENNKIDLEVSTND-GSFAHEVLDIKYNGEKIITGFNSRYLMDIIAQIDHESLTMKFDNNMSPTLIES-DNINCQFVIMPIR 366
11 0.000e+00UniRef50_A0A0C1QIJ6 Beta sliding clamp n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0C1QIJ6_9RICK  ali  18  1MKIVIKKSNLQKALNHVQSIVEKRNAIA-MLANVKIEAKDSRLAFTTTDMDISITDLVEAEVD--QPYSTTIPVLTLYEIVKKIPEDDITFEASANQILVKFASSKFTLPCLPAEEFPNF-----ELGDTTHNFKISSGALKLLLTKTRHAIS-NEETRYYLNGIYLHSIESEGLRAVSTDGHRLARAEVALPEGAKNIIIPKKTVNELIKLVEDFDDDI-------NVGLSVNKAIFEIGNSKLITKLIDGKFPDYTRVIPTNNDKQLEISCKDLIKSIELVISVSSD-KTRAVKLDIEPSKVVLSASSEMNGNASTQMLAANYNLEPISIGFNSKYVLDSLNTMEGDTVRFLLSNSSGAVIALDSADDKSLYILMPM. 373
12 0.000e+00UniRef50_C0GI72 Beta sliding clamp n=2 Tax=Dethiobacter TaxID=427925 RepID=C0GI72_9FIRM  ali  16  1MRLTVPKALLAEHLQITAKAAPPKSTM-PVLEGILFQSDGQTMTLTATNLELGIRTSFP--VPDQEKGEVVLPAKA-VEIIRKLPGDTVSLTVNEENTEIKSGQSEFQLYGLSTEEYPAF--ADLSADSGQYACEIKAGEFRRALRQTLFAASQD-EGKPAFTGIMFTLKD-NTLTLSSSDTFRLATCRVQNQGADGVFLVPAKNLQEVIRILTNDEDSVQLAVAD-------NQLLITCKNIKLSSRLLDENFPNIDRVIPREFSGRATVDVADFLHAVERASLLS-EGVNHVVRLSIGEEGLVIRA-SSKFGKTQEHVP-VELSGEGLEISLNSRFILDMLKVHEGDQCILELTNANKPCILRDSLYQEYLYLVLPIK 366
13 0.000e+00UniRef50_A0A1V5UY24 Beta sliding clamp n=2 Tax=root TaxID=1 RepID=A0A1V5UY24_9BACT  ali  18  1MKVTILNERLSNALAVVGRGVASRPQL-PVLANVLIRSTAGGVEILSTDLEISFRIKVGAKV--REEGEVSVSGRVLSELVGTLPAGPVDLEVDKDSLVIETNGIRSMVAGMASGEYPSIPSFSGK-----CDIEIGVEELVEEIERVGVAVAKD-DARPVLMGVLWKF-EKDRIRLVATDGYRLGILRLSVEKEGLSLILPARALLELVRIVDKQEVKTVL----IKFEINKQQVIFKIGEIEIVSRLLAGDFPPFEQIMPESYSTRVLVSREELTEAVKRASIFAR-ESANIVKVKMGDNQLKVSANSPQLGSSETGID-VETEGEGVEMAFNSRYLLEYLGVVRADKVIIESEGSLKPGVFR-EEGEEWVHIIMPVR 366
14 0.000e+00UniRef50_D6Z5P2 Beta sliding clamp n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=D6Z5P2_DESAT  ali  15  5..FNVSRLDFLTALAALQNITGKKGTLA-VLANILLESDQEGLVMTATDLEVGIRCRIPA--EILSPGSVTLPARKLFELVKESEEKHLHLEEQENWVKISAESSDCRLSGISADEFPSFP-----PYREDNLVAIPTALMTDLIDKTIYSVAHEGENNFNLAGILLELDEGHFLRMVSSDGHRLSMMEGKVETDLSSILIPKKGIQEIRKLCDEEETVL--------LGLEEKQAVLKAGGYTLVVRLMSGDFPDYKGIIQVINKKHIGIDRRKMMHSLKRVNIF-TEDRYNAVNFIIENDKITLSSQNMDYGSAREEVPAG-YQGESMEIGFNGKYFYEALQVMDSEKVKAYINSEESPCLLQGDKDPGYLSVIMPMK 375
15 0.000e+00UniRef50_A0A1W9QDK0 Beta sliding clamp n=1 Tax=Sorangiineae bacterium NIC37A_2 TaxID=1970199 RepID=A0A1W9QDK0_9DELT  ali  16  1MHAAVSKKDLLRVLGRCQGVADKKSTM-PVLGNVLLRATPDSLDLSATDLVVAVSGSVPAKVE--KPGSIAVPAKDFFDRVRMMPEGQIGIEVDGSNITIRSLTSRYTLFGLPGDEFPRLPAPEGDGW-----VEIDVASMARLIATTYFSISSD-ETRMHLSSALFEL-EDNRARMVTTDGHRLSKMEVRAPEGKATMLIPLKGVLELKRLCDESDPEGKNEPARIRILQSGPNVFFEVGGFHFSVKLVDAQFPPYGQVIPAQSSVAVRAPRLSFSEALKAVSLAASD-RTGGVKLTLNKNQLRVESESPEAGEGFDEVP-VDYVGSPITIGLNARYLLEVLGAIVDDEVIIGITGELDPAVIRPRENQDYLAVVMPMR 384
16 0.000e+00UniRef50_A0A1F2ZM09 Beta sliding clamp n=1 Tax=Alphaproteobacteria bacterium RIFCSPLOWO2_01_FULL_40_26 TaxID=1797226 RepID=A0A1F2ZM09_9PROT  ali  20  1MQFEVAKQILLKAIANVNGAVEKKNTI-PVLQNIKIEAKNDKVILSATDMDILVTSSFEADMKNG--GATTVPAQMFFDIVRKIPDGAIMIKQEKSSLQIKAGKSKYNLPCIDASEFPNLSEGELGEEIEIETEK-----LTTMFDKTRFAISND-ETRYYLGGLYLQAIKKDELRTVATDGHRLALSLTPIIKTAFGVIIPKKSVAEIRRIIDGSQ-IVKIAVSRV-------KIKIISDQTTIVSKLIDGEFPDYDKVLPKNNNHIAVINRREFFDCVDRVSTVATD-KHKSLKLIIENGKMNLQVETNDGSFAYEEMD-LNYTGERIETGFNSRYLLDIIGQIDNDELLMRFKDSSSPALIE-AKDMNSVFVIMPVR 365
17 0.000e+00UniRef50_E6QUR5 DNA polymerase III, beta subunit n=2 Tax=mine drainage metagenome TaxID=410659 RepID=E6QUR5_9ZZZZ  ali  19  4..LEIKRNNFLHLIQTIIGIVEKRHT-QPILSNLLIEFKSNKLFILASDQEIQIQVHYALD-KTFTDFAITVAAKKLFDILRAIPEQDIVLESQDHQLQLRAKKTRFQLQTLPAIDFPVIETTQEAPTI----VHIKQKDLRKLIMQVQYGMAQ-QDIRYYLNGMFFVLADTK-ISAVSTDGHRLCWARLDTGDPPQELIIPRKTIGELVKLLADNDAEVEISI-------YTNQIKFSFNDLQLISKLINGKFPDYQRVIPSNHTNTMLVNRLLLLQAIQRVAILS-NEKFRGARFVLAQNELKIICNNNEQ-EEAQEELEVDYHGTPLDIGFNVTYILDALNQIDSETVQCHFGDANSSMLMTIPLNEDYKYVIMPMR 367
18 0.000e+00UniRef50_A0A0G0VHQ7 Beta sliding clamp n=4 Tax=Candidatus Magasanikbacteria TaxID=1752731 RepID=A0A0G0VHQ7_9BACT  ali  16  1MKFSCTQENLLQGLQVVSHA-AGKNISLPILNNVLIKIENKELKLVTTNLEMAISCRLRAKVD--EEGDFTVPCRLLTDYLSVSSPGRVDVEQKDSELLVQSASDKTTIKGNVAVDFPLVPQLERKKVYG-----LKVADFKEMAQKVIFAASKN-EARPELGGVLLNFNPDYKLVSAATDSYRLAEKEVKLSAETSKVIVPVRALQEILRIVSTYHEDLEEE-QPVEIVVSDSQILFSFGMVELVSRLIEGQYPDYRQIIPASSKTSISFNVAEWIKRIKAASLFSNVGI-NGIVLTFKAGKTTFVSTNGQLGNYTSE-ELCQIEGEDNHILLNYRYLLDGLMNLVAEEAVLKVISPNSPCVLSSKNSSGYLYIIMPIK 383
19 0.000e+00UniRef50_A0A2I0NA86 Beta sliding clamp n=1 Tax=Tenericutes bacterium HGW-Tenericutes-4 TaxID=2013847 RepID=A0A2I0NA86_9BACT  ali  19  2MKVFCQGLDLSDAILKVIKASSTR-TTNPILEGVKIIAEDNTITLIATDGELAIEKRIVADVKV--EGETVIPGKFFSEYVRKLATEQIELTLNENQLKIKYTDSEVFIQCMNVLEFPNIQKIESKE-----YFEIKKTDLKDIIQKTIFSVSL-EDTRPVLKGCLFEVSE-NKLTSVALDGYRLALAEKPIKSTTAKVIIPGRSLNEMSKLLDESSETVKVYMQK-------NYVMLEQDSTKITTRLLDGEFINYKQIIPNNFTSTVTVNRLQLEDALERASILARVSNDNSVKFNIKDNTLNLQARS-EIGNVDENLTIV-LNGNDLSISFDARFFKECLRVSSDEFLKLCFTTSINPCIVKPNEGNDYLFLILPLK 365
20 0.000e+00UniRef50_A0A0G0BJD4 Beta sliding clamp n=1 Tax=candidate division CPR3 bacterium GW2011_GWF2_35_18 TaxID=1618350 RepID=A0A0G0BJD4_9BACT  ali  20  1MKVQVLQDSLSKALSLASHVVSSK-PNLPILGNIYLEAEKDKLIISGTDLDVGIKLSIKA--EVSESGSIAVPSRLFVDFISSITSGKISLETEGLVLKVQSGIYSSSFNCLDGDEFPAFPEKGKE-----IEVDFESKTFKEALGKILFSASTDL-SRQVLTGVLFEF-QKKQVTLVTTDGFRLSSYLLVGDYDKINFIIPARGLQELIKIEEAEKKDVKITLSENK-----NQVIIENGVVEIALRLLEGKFPDYKKIIPEKFVSVLNVDRQEILKAVKVASIFARD-NANIVHFNLKDQTLSVAATAREMGEGS-SIIKCSVSGEDLVISFNARFLLEVMNVFTASELKLEFSGPLKPIRIIESGNENFFHVLMPVR 369
21 0.000e+00UniRef50_A0A2M7TMU9 Beta sliding clamp n=4 Tax=Candidatus Woesebacteria TaxID=1752722 RepID=A0A2M7TMU9_9BACT  ali  18  4MDLEVLQENLNKALSITSRFVSARSQL-PVLANILLAAGKTKLILSATNLETSASASLGAKI--VKEGELTIPAKNFFEIVSNLSQGTIHLSSEKESLKITGSGFTGRILGMNSSDFPKVPQVIKKE----ESIDLSKTEFLKALPQVSFAVSAD-EARPILTGILF-ILSKKSMSLVATDGFRLSKKTIPIEGKEIKTVIPKNILLEVSR---EGGESESVLLD---IKGKEKQVVFGLGNLILSSRVLEGAFPDFEKIIPKSSGVKVRTDKEELLRAVKLASVFARD-SANIVKIKIMKDSIKLSAESSQVGSQETIIDAKIITGPDLEISFNYKFLEDFLRAVEGEEVVMEFNNASSPGVFTDPKDPDFLHLIMPVK 383
22 0.000e+00UniRef50_A0A1Y1RY01 Beta sliding clamp n=2 Tax=Spirochaetes TaxID=203691 RepID=A0A1Y1RY01_9SPIO  ali  20  1MKFTCDKASILREVSVAQEIISSRNALS-ILSNVLIEVADNTLTLKATDLKVGFETQVP--VEVAVPGSTTIYCDKFLGILRSLPDGEIEFEQQDNRLIIRFKKIDFQLKSITSDKYPEI-----QDVSQDAYFQVPQNDLIEMINQTIFAIS-DDETRFFMNGVYFEKSDS-SLVMVATDGRRLSYIMKEVDGDFNGVIIPPKILNLVRKLASGQ--------GSISIAVTDKNIFMQFDNQKVSSNLIEGQFPNYRRVIPDSQEYRIVINRNELMDALRRVSLLV-EQKSRRVYLTLNENSLVLNSEESEIGVAREEI-TCEYSGPEATIALNYLYLTDPLKVIDNEEIAIEYTEANKAISIMSIPAGDYFHIVMPM. 364
23 0.000e+00UniRef50_A0A1F6RIF6 Beta sliding clamp n=1 Tax=Candidatus Melainabacteria bacterium RIFCSPHIGHO2_02_FULL_34_12 TaxID=1801607 RepID=A0A1F6RIF6_9BACT :  ali  17  1MDVEVKTEYLKKVVSCTSKATANKA-IQPILNNLLLSCTNGSLVVSATDLDLAIECKLPA--EVSKPGKVTLPAKKFDEIVSKIPGENINLSIDKNQLTIISDRSKFQINGTSPDEFPEI----IKKSELENVYTISQEELLQAISLTSFATSK-FETTSVLSGVNFEIS-GDEFEIGATDGSRLARYSKKVSKEQKSIVIPWRAVTELERLITNFKD----GNNEVSFYFMPGQVIFQNNDFSLSTRLIDGNFPAYDKLIPKEQPLKVEFLRSEFLSSLERVAILA-NERTNVIKLSLSKGTMQLSANSPDYGNATDEVD-VTYSGDDLDIAFNYRYMSEALRNLRIDKLVIQLEGSLSPIVLKPNENYNYTYLVMPV. 378
24 0.000e+00UniRef50_E4KR66 Beta sliding clamp n=11 Tax=Aerococcaceae TaxID=186827 RepID=E4KR66_9LACT  ali  20  1MKFTINRQKFTDVLNNVSRAIPGKTTI-PILTGIKIEVNPDGVTLIGSDADISIESFLSNQDEIKEQGSIVVGARLFNDIIRKLPTNEILLESDSNYLTITSGPAVFTLNGQDGAAYPHLPEIDFE-----NTVSLPTLAFKEMINHTIFSAS-NQESRPILTGLNLSIHPD-YISGVATDSHRLSRREIPVELNTTNVTIPKKTVTELVRIVEDDQ--------KLQMLVNEQQVIFILENLTIYSRLLEGNYPDTDRLIPSNHQTQLVVNANDFLAAIERASLMSHQSKNNIVQLSIKDQAVELSVSGNERGRASEDIQLKAVSGQDLLISFNPDYMRDALKSFNGIDIKIDFQTAVRPMLLSALDGSDLLQLLTPIR 380
25 0.000e+00UniRef50_A0A0G0CH26 Beta sliding clamp n=2 Tax=Candidatus Levybacteria TaxID=1752719 RepID=A0A0G0CH26_9BACT  ali  18  1MLVSFLSDNLVKKISFLNHAVSTRSQL-PILSNFLLVAENGKLTISATDLEMGIVSSISANVQ--KEGSVTVPAKNFSDLFSNILNQKITLETEENILKLNGEKIKATFQTMPAEDFPKLYDQKGAEI-----LSLEKNEIERFFTRTTFAAAVDT-TRPALSGVLLE-NQKTGLVFVATDSYRLTLQKTPLKELEKAIVVPARIIKEMS-FVKEEDDKVKFYVAK-----ESNQILILQGETIIVGRLMDANYPEYSKIIPTNQTTKTEIDREELLNAIRICSVFAR-ETANIVKFTVQKEKLIVSANSPAVGEDLVEVEA-ELTGEENEIAFNAKYLIDILSILSEELLVFEMTGPLNPGVFKIKDDNNFLHLIMPIR 365
26 0.000e+00UniRef50_A0A0S7XZZ9 Beta sliding clamp n=1 Tax=Coxiella sp. DG_40 TaxID=1703354 RepID=A0A0S7XZZ9_9COXI  ali  18  1MNFTIQREILLKPLQQITGVVEKRQTM-PILANTLLIIDNGQLSMTCTDLEIELVVNIALESSSQNFNKITIPARKLLDICRVLPENSVDFHQDGNNVIVRSNRNRFVLATIPADDFPNI---EWDTQNKVLEFTITQKKLNYLIKSIYFAMAQ-QDVRYYLNGLLLEVKNG-TLAAIAADGHRMAINSLSINDSTLHVIVPRKGIMELMRLLEDSNEEIAVTVS-------NNHIRIIKPGLTFTSKLIDSKYPDYEKTIPKNGGKKVIVNRNIFKQALTCVAILS-DGMFCGVTLQIQSGSMHIFTRGQKYEEAEEEIP-INYQGDSITIGFNINYLLDVLASVESEKIVMTFKDTSSSILLEQYEDKNLLHIIMPLR 374
27 0.000e+00UniRef50_A0A0S8IDB2 Beta sliding clamp n=1 Tax=bacterium SM23_31 TaxID=1703762 RepID=A0A0S8IDB2_9BACT  ali  18  1MKFSIPCSELKTGLQKVISVIPTK-TTLPILGHILFEARNGQLTLTTTDLEVTLKTQVQATIE--SEGSVTIPGRLIFDVVRELPDIPLNIVKDENNIVLTFSKNKYSFFGEDANNYPKLPAIDVK-----YEITFDKKKLKRYVEKTVFATSTD-ELRPALMGVLFQVGENDY-KAVSTDGHRLVKKSFKAQSPIEDVIVPVKALNLLLKNIEGDE--------DIKISFAANYIVFDLESASISATLIEGKYPDYDKVIPINEHKKLIIDREKFISSLRTISVLA-NKITQQIKINLEPDKIIITSEDMDLGEGIEIIEA-EYTGEQMEIGFNSNYLLDILTHLDSENVIFTFNTSVSATLITQEENEDILMLVMPIK 367
28 0.000e+00UniRef50_A0A2J0M3L7 Beta sliding clamp n=12 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2J0M3L7_9BACT  ali  21  1MKLICTQENLNKGLSIVSH-IANKNANLPILGNVLIKAENKTIKLSTTDLEMGINCIIRGKVK--EEGNFTVQAKLLKDYTSLLPKEQVDIELEKQNLSLKCKNFKTKIKGISEEDFPLIPKIEKEDGALCKT-----EKLKKAIQQVIFAVDLSG-TRPELSGVLFKFTQKKELILAATDSYRLAEKTITLEKEDKKAIVPX-----XXXXXXXXXXXXXXXXXXXXIYLSENQVLFSINGIEVISRLVDSEYPDYKQIIPIDFKTKVTLEVESIIKVVKSISLFCRQGI-NDIYFNLVSGEMMINAVSSQVGENTSRFP-VEFLGEENNIIFNWRYLLDGLSNIDSQSVILEIVDKNSPGILRPKDKKDYIYIIMPIR 381
29 0.000e+00UniRef50_A0A1Z9LE85 Chromosomal replication initiator protein DnaA n=1 Tax=Gammaproteobacteria bacterium TMED186 TaxID=1986743 RepID=A0A1Z9LE85_9GAMM  ali  19  450MDFYIQKQDIVKALSLTLGVVEKR-QTLPILSNVLIEVDESSMQLTATDLESQISTSSNI-ANYTSGGKTTAPAKKLSELCRLLPDDEIHISLDGDKLIVEAGTGKYNLKTLPSDGFPVF-----EDESDGQAIKIDSQKLKNLINKTSFAMG-NQDWRHYLNGLFITIEESDIL-AVASDAHRLAIASSDLDDNNTSGIIPRKSINEIAKLVGEVEGIVEINLSNNSIKTSTPTASF-------VSKLIEGKFPDYEQVIPSGDSSVLKVSTKQFSETLSRVSVLSSD-KYRGIRMVTSDKGVMISANNPDQEEGEEFFNTA-YEGENLDIAFNVNYFQEILSTIDDDECEIHFFGADKSCLITTPKNQQLKYVVMPL. 814
30 0.000e+00UniRef50_A0A1V5GI90 Beta sliding clamp n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1V5GI90_9BACT  ali  21  1MKFIASSSSLLKQLQHISGVINT-NTVLPILEDFLFEIEKNKLTVVATDLETVMR--IQLDIEAKDSGRVCIPAKILLDSLKNIPEQPLTFNIDKNFIEITSDNGKYKVMGENPDNFPKEPSAD-----DTTSFTMTASALVKAINETIFATSND-DLRPAMTGVFFEL-DKKYLQCVATDAHRLVRYKRTDVKCPKSFIVPRKPLNLVKSAIPSNEDEVTLSYND-------NHLFIKHGSTQMSCRLIDARFPDYKVVIPTDNPYRLTLNRADFQSALRRVSIFS-NKSTNQVALSITGSELQLAAQDVDFSNEGNERMNCQYNGEDLVIAFNARFLIEMLGATESNEVNVELSTPTKAGLIKPVDQED......... 356
31 0.000e+00UniRef50_A0A2N3G5J5 Beta sliding clamp n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=A0A2N3G5J5_9ACTN  ali  20  12MIITCEKNKLNSAVQAALRGISGKVTM-PILSGLLFTAENGRVAISSTDLEISVRAELDA--EISESGSTVVSGRLVGDILKNLPGGDAQIETDEKFLTIKSSGGEYRIREMMPEDFPRIPKWEGESFLKA-----PGGEFMVAVQQASKASSSD-EKRPVLTGMLVEKKTGESLKLVATDSYRLASKEIDVVGEWENCIVPVKTMNEVARLIGGIDAEIEI-------KMQEKQILFRLGELVVASRLIEGQFPNYSLLIPKGEKTRVTAPKEELAAALKRALIF-----GHKIRVGIYSDHLRVMTETPDKGDSKEDVPVETI-GEEMEIGFNGAYLLEGIIGAESENVDIRFDDPQKPALVKTENSEKYNYVLMPVR 374
32 0.000e+00UniRef50_A0A1C6A700 Beta sliding clamp n=40 Tax=Firmicutes TaxID=1239 RepID=A0A1C6A700_9FIRM  ali  16  1MKFSCEKALLSSAVTVASRAVAAKSSI-PAMEGILIEA-GAQLKLTGYNLETGIQATVPA--EIKEGGSLVLSARLLGEACRKMPDDVVVFSSQGYSVNIKCGMYEINILGTDAEEFPELPSVDQQ-----NSLVLSQPVLRSMIAQTLFAVS-DNESRPIHTGSLFDV-EGSRLTVVSVDGYRLALRREDVEEEAFSFVVPGSALNEVEKICSGEE--------KVTIIQGARHILFQTGDILLVCRRLEGEFLPYKNAIPRNNTIQVEVEAKALLSSIDRVSLIISEKLKSPLRCLFGDGVVDITTKTA-LGDTADRCP-ISGNGGGLEIGFNNKYLMDALKAAPADKLRMEFTSGVAPCVILPAEGEEFIYMVLPVR 364
33 0.000e+00UniRef50_A0A1F5ZUB1 Beta sliding clamp n=4 Tax=Candidatus Gottesmanbacteria TaxID=1752720 RepID=A0A1F5ZUB1_9BACT  ali  20  1MHFVVLKESFLKALGIVGRSIPTRAQL-PILSNILIKATDKELILSGTDLELGIVFTLPVKVE--EKGEITVPGKILSEFVGSVHGEKLEFIQEATQLKIISGKTKATFATSNPEDFPPFPEVTVFDR------RLPYSVIKTAIPRMVFAASTD-EARPILTGVRI-VATGDTFSLTSTDGYRLSIEKITIPKFSEDFIIPAVTLTEVSRIATE----MKVNEVGFTILKDKNQVVFSLPQVRIYSRLIDGEFPTIEKIIPQGFKTKVILKKDDFLQAVKTTSLFAR-GSANVVKVVVGKNTITLSANTPQVG-GDEEVLEANVQGEETEIAFNYRFLLDLLNNFPQGDVVFEISGNLSPGLFKSSESASFLHIIMPVR 366
34 0.000e+00UniRef50_A0A090D0V5 Beta sliding clamp n=1 Tax=Criblamydia sequanensis CRIB-18 TaxID=1437425 RepID=A0A090D0V5_9BACT  ali  21  1MKFIIATQELSYLLSKILNVVSPKATI-PILANILIEAQGNEICLSATDLTVGVRCKTEAKV--LKEGATTLPAKRFSQLIKELKSVNVEISTNENDVTILSDSSRFKLFGMNKSEFPQLP-----DLGNAKKISIQEKDLKEMLYRTSFAVSR-EDNRYVLTGVCLNVENGRA-TFVGTDGKRLSRTFLSLPADKGSYIIPLKAVEEIQKCLKDE--------GEASLYLMEDKIAVHSEDTMIVSKLLSGEYPDVDRVIPENPETVVTLDREELMTLLRQVSLFTAD-TSHSVRFSFTKGELKLTANTMDIGEGLVKMP-VNYHGAKLEIAFNPNYFMDILRHNKSHLVTMGITDSFNPGVIKEKKEESAVFVLMPMR 373
35 0.000e+00UniRef50_UPI00036587B3 DNA polymerase III subunit beta n=2 Tax=Verrucomicrobia TaxID=74201 RepID=UPI00036587B3  ali  16  1MRCEIVRSSFLDALGLAQSVAGGR-TTLPILNNVLLEADSGKLSLFASDLQTTLQLHIDA--EVKEAGRTTLPARRLFAIAKEVTTKEIALTSNEEESMVMAGSSSFRLFGLPAADYPTPPL-----LSDSPSFCISQADLVRLLRRTSYAMSSD-ETRYVLNGVLFCWKEEN-LTVVATDGKRLALMRSPVSGEEIQGIVPARAVTELLRILGEEERKVT-------AWVEPSRLLLQSGEILFSSKLVDGKYPNYRAAIPEGAPEKIYVSREAFLSGLRRVSIVAGEKMVAPIRLRFENNELELSCSSAEIGEAKEAIP-IRYGGKEIRAGFKAAFLIDPLRESPADEVVLQMGEASGPCVFQ--DEEAFLYVVMPLR 365
36 0.000e+00UniRef50_L8LU54 Beta sliding clamp n=1 Tax=Gloeocapsa sp. PCC 73106 TaxID=102232 RepID=L8LU54_9CHRO  ali  16  1MKIICSKNEFNSNLGLVSRIVPSRPT-HPILANVLLIADEKKLTLTSFDLSMSISTHFPA--EISHEGKITLPAKLLTDIVSRLPEGEIMMDLEDNPLTITSASGRFQIRSMGAEEYPELPVVEGEN------LNLPVSTLMQGFKSAAFAASPD-ETKQVLTGLHLQKTSTN-LEFAATDGHRLAVGVQELDETEFSMTIPVRAFRELERLLNNADENVELYLEE-------TQVAFEFSSFRLTSRKLEGTYPAYHKLIPEKFSRQVTVDRKLLLRGLELMAVLA-DQRSNLVKFTIDTKKVILQVEAPDLGNAKESLPA-EITGDHLDIGFNVKYLIDGLKAFNCTDIQIQLNEANQPVIFSPLGGNKITYLVMPV. 373
37 0.000e+00UniRef50_A0A257L946 Beta sliding clamp n=21 Tax=Bacteroidetes TaxID=976 RepID=A0A257L946_9BACT  ali  19  1MKFIVNSSVLLRHLSYIDGVVVSK-PIIPILNNFLFDIKDGVLTIHSTDLETTMSTSI--KVDAKEDVSIAIPSKTTLELLKTLSDQPLAFSINEEKVEIKYESGRFKLTAQKGDEFPKTPEVEG-----ASTFEIGAKILQKAINKSVFATSSD-ELRLNLTGVYLQLFKNN-ITFVATDANRLVRFTRNDPGTEEALILPKKALNLLKSCLPNDDTQVKVNFNRQN-------AFFQIGDVSLICRLIDEKYPDYRAVIPTENPNKLTIDRGEFLMAVKRVSI-TSNKTTHQIRLKLAGSDLTISAEDIDFENESQEKLTCSYVGEDMEIGFNSKYLLEMLNNMDAPQIVLELSQPNRAGVIVPANDEDVLMLIMPM. 368
38 0.000e+00UniRef50_A0A2E9JAI2 Beta sliding clamp n=12 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2E9JAI2_9ACTN  ali  18  1MKFKCEKEILEKTFSLAKKATPNRSGANPVLSGLFMELKKDKLVVLGSDLDLTIR--IELKVGGEQDGKAVIPGALLADISRVLDDGQISFVTKEDEIQITSGKSEFNLRTLPVDEFPKF------EEPGGNEATLDTQSLANAFEQVVKAASMD-DARPILTGVLL-AAEQEGLRLVATDSYRMAIRDIPGTEDEI-VLVPSRALDVVKRILNEGKE--------LTVVLGEKEAVFKIGNINIVTRLIEGEFPNYKGLIPEKNKNKLVINREETLAALQRVKLLARE--ATPVRLIMTDKKIELLAIEQDIGQATETIEG-NYSGEEITVAFNPDYLIDGLEVISTEEVTLETTDALKPAILKGLDEETFLYLLMPVR 362
39 0.000e+00UniRef50_UPI000984C4D1 DNA polymerase III subunit beta n=2 Tax=Marinicella TaxID=863253 RepID=UPI000984C4D1  ali  18  1MLFNIQRETLLAPLTQICGVVEKKGTL-PVLSNVLLKLDDDQLLLTTSDLDVEMRS--ECVVDAQSPGEVTVPAQKFLDICKALPDGSITFAYDSGQCLITSGDSRFSLSTLSAQEFPLI-----DDMESYQPVTMGAVDLQRMLKQTVFCMAV-QDVRYFLNGLLFEVLN-NKLRCVSADGHRLALSECDYVNENKQVLIPRKGVLELQKMIRDLDQEITINIG-------RNHVKIDIDNLTMTSKLIDGKFPDYESVIPLDMENNFIADREELRQALQRVAILS-NEQYKGVKFKITANKLEIIGHNPDQEQA-EDIINVRTDIENIETAFNVNYILDATQAINEKDIQFSFKEALSSCLIKHPDRADCRLVVMPLR 365
40 0.000e+00UniRef50_R6P7F6 Beta sliding clamp n=1 Tax=Eubacterium sp. CAG:274 TaxID=1262888 RepID=R6P7F6_9FIRM  ali  18  1MKLECSKKSLLNAINIVSKAVSTRSTL-PILNCILLTGDREGFRLLASDRELSIETD-NIESDLYEKGSVAIDAKMFADIIKALPTEMVTLTVDEKNVHIKSGKSEFTINGQPAEQFPEVPVVNKRE-----NIVLKSADIKNMIKQTIFSVATD-ESKPILTGELFKF-DENCFNAVAIDGFRVSWRKTVCEYDGTEMVVPSKTLNELARLLSDDENE------KATIYYSSSYILFEIKGCTIVSRLLDGEFLNYENLFVENSPVKLTANTHELLSAFERATIVSEDNKKTPVILTIKENNLNIRT-TTDRGLVNEDVP-ITLDGEELVITFNARYIIDILKVVEEEYVTMNFNTNKSPCIVTGVTNHDYKYLVLPI. 364
41 0.000e+00UniRef50_A0A2E3WAF4 Beta sliding clamp n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E3WAF4_9GAMM  ali  19  1MKLSISREALLDPLQLVTGVIERR-QTLPILSNLLLVADQDVLTITGTDQEVELTAT-ASDVQIGEPGELTVPARKLMDICKSLTGGTLKLDEESNRLSLVSGEFRSHLATLPVVXFPNV-----EAETGAAKIKVAATVLSSLLDKTSFAMAQ-QDVRLFFNGVLVE-QDENLIRVVATNGQRLAFAEIEDQGENGRFILPRKGVHELMRLVNEAGDE------EVMLQFSDNHLRAEVANAVLITKLIEGSYPDYTRAIPSGGDKILVGSRSDIREALNRTSILS-NEMYRNVRLQMNAGKLDIHAXNPLQEEADETVS-VEYDGEPLEIGFNVGYLLDVLSTMQGEELKIAXIXDSSACLLTDPGDSKTLYVVSPM. 365
42 0.000e+00UniRef50_A0A2H0Z9X0 Beta sliding clamp n=18 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A2H0Z9X0_9BACT  ali  21  4MKITSNKESLIKGIQVIQSAVTSKAGALPVLQNFLIETDENGLKLVSTDLEMAIKHFI--KVDIKNDGSVTIPMKKFVDVVQNLDKEEVNIFVDESKIAINSGKAKIKIGGLPKSDYPLIPDIEEKD-----SFKIKALDIMNMIEKTVFSSAADDE-RHFLNGLLWK-NEKGVFSIVATDGRRLAVKEGLKIKKDFKVIIPSKIMNELVKFI---KTNVKDEKEEMTVGLSTNQVGFKFGKTVFISRLIEGNFPAYEQIIPKTTEFKAEVNAEKLLAATKRAAI-CSNDRGGAVKYTLKKNVLIVNASSQTM-DFEDELD-IDFSGKEFQISYNPKFITDILKNVGSKKVTFEFTGPATPSIVKSAADAELLYIVMPLR 371
43 0.000e+00UniRef50_A0A0G0XWS2 Beta sliding clamp n=17 Tax=root TaxID=1 RepID=A0A0G0XWS2_9BACT  ali  19  1MKFKIPQADFSKALSIASRSILLKA-NLPILSNLLISVTKKEMTILSTNLETATKATTPCKTEV--EGKITLPGKTLSEFITQLPEGEILFEKLGEEAVVSTKGFKARIPTIAPEEFPAIPRIDK-----GVEIKLKVKVFAKCVSRVAFGAAQD-EGRPILTGVLCEFGKD-RLSMVATDGYRLSYQEIPVSEADIKVVVPARAISEVAKILEDENENLSIVISDNL-----NQVNFKVGNIEFTSRLIEGEFPNWQKIIPTSFTTKVKLSKVELAKLVKVASIFARD-SGSIIRLKLENSTLAVFANAAQVGSSDAQIET-QMAGKGGEIAFNFRYLLEVLSVMDDEVVNFEMIESLNPGRITGEDEDSFFHIIMPVR 378
44 0.000e+00UniRef50_A0A2P6JYK8 DnaA n=2 Tax=Nephila clavipes TaxID=6915 RepID=A0A2P6JYK8_NEPCL  ali  14  473.RLKIAKESLLNVLSHVVGAVERRHTLN-ILSNVKIQTTQQALTITGSDLEVELVASTTAEGACVEAGETTVPARKLVEICKSLPTAAIDLQTEDQRCILKSGNSRFVLGTLPAEDYPLL----TTENSQGTQVQVTQRELKRLFEKTAFAMAV-QDVRFYLTGTLLEI-DQNQLRTVTTDGHRLALCEVSTASAPIQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTPSRDKEQVRFTTKLIDGKFPDYRRVIPKGGDKHVFIAHDVFKQSLQRVAILS-NEKLRGVFLNFNQDSLQLRANNPEQDEAVEDL-AIQYQDAPLEMSFNAQYILDVLSVLDGDDVKMSMTEANQSVLVQDPAHPDQTYVVMPMR 852
45 0.000e+00UniRef50_A0A174QZN5 Beta sliding clamp n=29 Tax=Clostridiales TaxID=186802 RepID=A0A174QZN5_9FIRM  ali  19  1MKIICSKSNLLKSVNISLKAVPSK-TTMPILECILMDATTNQIKFTTNDMELGIETIVDGHIE--EKGMVALDAKIFYEIIRRLPDNDVTITTDSNFVTITCEKAKFTIPGKAGEDFAYLPVIEKDE-----SLTLSQFTLKEMIRQTIFSIAVNENNR-LMTGELFEIKD-NCLKIVSLDGHRISIRKMPLKKEDRKIVVPGKTLSEISKILSGEDDQVSIYFTK-------NHILFEFDQTMVVSRLIEGEYFRIDQMLSSDYDTKVSVNKKEFLDCIDRATLLVREGDKKPIVIEIKDNSMELKIDSA-MGSMNEEID-IEKDGKDILIGFNPKFLIDALKVIDDEVIHMYLMNPKAPCFIRD-DEENYTYLILPV. 363
46 0.000e+00UniRef50_A0A1G2ZFK8 Beta sliding clamp n=1 Tax=Planctomycetes bacterium RBG_16_43_13 TaxID=1801967 RepID=A0A1G2ZFK8_9BACT  ali  18  1MKIRCNRQRLSEAFQLAQIVVPQKSTI-PTLTNVKLTAKNSIVELTGTDLEVGLKYTISA-VDVKDEGSIIVSANRLAGILRENIDDEITIESDGNVANVVCSSSKYKVVCADPTDFPELPNFEK-----SKSISIATEDLGEMIKKTLFAVSTDL-VRYALTGILFEIK-GKEIRMVSSDGKRLALIKRKISGKDIKALIPPKTMTLLDRVLTEEDDMVGLNVEE-------SQIKLKTKSAMIFSRLVEGAFPDYEAVIPTDRNKKVELNTTQLLTTIRRATIM-TNEKSRAVQLRFNKDKLIVFTRTQDIGEANSDMQ-IDYKGEDLEIAFNPDYITDYLKVVSDEKIELHLKDKTTAGVFKA--GKDYTYVIMPL. 371
47 0.000e+00UniRef50_A0A1G1ZNW5 Beta sliding clamp n=2 Tax=Candidatus Harrisonbacteria TaxID=1817905 RepID=A0A1G1ZNW5_9BACT  ali  18  1MKLILLKTNLKEGLDAVSHA-TGENTHLPILKNILLKASSNRIELAGTNLELAISKYISGK--TIEEGGIAIPSGTLSSLISNLPDERINLETNSNTLVIKSDNYEARLQGMSPEEFPLIPQIKDKE----RYLKISGGILKEALVQVVNAT-QYSEWRQELNGVLFDFEES-RLVFVATDSFRLSKKIIAGSQFELKVIVPIKTIQELIRIIKDT-EIISIYFDE-------SQIMFISEETEVISRLIEGKFPDYEAIIPKTFETEAIIEKGNLMHALKLAGIFS--GKVNDVHLKIEEGMIEIYSSNTQLGDNKYLLAVKSNKGMP-EIIFNWRYFVDGLKAISEKDIYMGINGEDKPVIIRSVNDQSLVYLLMPIR 367
48 0.000e+00UniRef50_A0A2N0V0D5 Beta sliding clamp n=12 Tax=Clostridiales TaxID=186802 RepID=A0A2N0V0D5_9FIRM  ali  17  1MKISCSRTDLGLAISNVSRAVSTKASI-PALEGVLIKAYGSTLNISGYNLEIGITTDIEATIK--EEGEIVVSAKLFLDIVRQLPEEVVFIETDERMVTIACGNANYQIVGMSSVEYPDLPSFEQTDG-----IFLNAKVLREMIRQTVYAVSENTAM-PIYTGSLFEIENG-IFKIIAIDGYRMAIRSENIDSDSKNFVVPGKTQHEVLKLLIDDEETTEIIIG-------QRHIAFKIKNYKVISRLIEGTFIDYKSAIPKDTKTEVVINTRTIINAVERMSPINNDRMQSPVRCTFSDDEIKLSCISS-IGRA-DDVISVPIVGESVEIGFNNKYLLDALKNADTDEIKLILNGPLMGMIVKPVKSDSYLSVVVPMR 363
49 0.000e+00UniRef50_A0A1F7UP31 Beta sliding clamp n=1 Tax=Candidatus Uhrbacteria bacterium RIFCSPHIGHO2_12_FULL_60_25 TaxID=1802399 RepID=A0A1F7UP31_9BACT  ali  16  4....................ITGRSINLPVLGNVLLKTDGGNLKLSATNLEMAVSTTVRGKTD--SDGEYTVPAKLFLDFVSLLPQGKVELDLTDEGLTVRAEGQETVIRGLPATEFPLIPKLTK-----ARGVTFHVEDLKRAIGQTVFAVSTS-ESRPELSGIFFDGKSGKGKTLVATDSYRLAERVISPSGEETKLIVPSRTMLEIGRILSSYKDELGVP-ESVEWVTTENQLVVTFGQTELISRLIEGSFPDYHQIIPERFKTMAVLDRAEFQKAVRAAALFSRQGLY-DVHLEFLPSNGTVSVHSADQGTGKTSKVSGDVTGEPNKVTVNFKYLGDGLAAISSPKIKLSLNDAMSPMLVLPEGEEAYRYLVMPIR 361
50 0.000e+00UniRef50_A0A101V7Y5 Beta sliding clamp n=2 Tax=Desulfitibacter TaxID=293136 RepID=A0A101V7Y5_9FIRM  ali  22  1MKFSIDTGNLLQAAQIVSRAVASKTTI-PALTGIYLETNKNTLLLKATDLEIGIEHTVEANIE--EIGSMVVPAKYLIDILRKLPNTEITLTTEDNNLTINYNQSQLSLNTFPTEQFSFLPNI-----SNTHTITINNELFSNMIKKVSISFSHDI-TRPVLNGALFEVGDHK-LTLVSSDTYRLSLIETDLEEDLKPIIIPAKALMELGRLI-DKEESIKIIID-------NNQAQFENDSIKIRVRLIDGKFPAYQNVIPNEYSTKIIADTKELLLSIERATVISSDENFNTIKLEVNDNIIHIRSYSPNIGQLNDTLIA-DKEGEDINISFNGNYLIDILKIIDTDKVIIELNGNLSPGIIKPESNMNYLSLILPVR 372
51 0.000e+00UniRef50_A0A2E6M3I3 Beta sliding clamp n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E6M3I3_9GAMM  ali  17  1MRFAVQQSAILRVLQQVVNAVERK-QIMQILGNLLFDVQGNCLTLTGGDGEIEVSTQLMLD-TVYEEGKTTLPARKLFDVVKSLPENTVEFVKEASHCQVLAGSSRFALATRDAADYPKL---QDLNAPHVVTFE-SQKKLKRMLDRTSFSMGV-QDVRTFLNGLLLEFDEGTAV-AVATDGHRLSLNRQDVPDLKQQVILPRKAVSELIRLLGDGDSPARMSFGE-------SHLIVEVGTLTFTTKLINARFPDYQKVIPKNLETSCVIQVDFLKQALARSAIMS-NDKYKGVRFALEQSKLTLLARNQEQEESRDEMS-VDYSGDPLTVSFNISYMLDILNSVDDEWIRITFANLNSSALVEEVSANDSLYVVMPMK 368
52 0.000e+00UniRef50_R5GY44 Beta sliding clamp n=2 Tax=environmental samples TaxID=2231195 RepID=R5GY44_9FIRM  ali  13  1MKFSCAKEVILSAVQTTSKAAAGKSSI-PALEGVLMELEGNTLTVTGYDLEIGIKTSIE--VNGIESGNIVINARMAGDIIRKMPSGDIIFECGGNNIEISGRDTNFSIMCMSADDYPNVPQVNPE-----TSFTMPQKLLKSMIVQTKFAVAV-VDSKPALMGCKFEL-EDNVLSVAAVDGVRIALRQEPLTYNNMSFIVPAKTLEELTHILSDDNDKNVI------VSVDRNQISFTVDGYIMISRLLDGDFIPYKTYLKNTSDVYAEVNCREMTDMLERTMLIINEKNKNPIRCEIKDNYISMSCTTS-IGKVNDKI-AVKYNGEPIVVGFNAKYMLDAFKACDSDTVKMCVTSSVAPILILPMEGTSFTYLVLPMR 363
53 0.000e+00UniRef50_J9YWF2 Beta sliding clamp n=18 Tax=Alphaproteobacteria TaxID=28211 RepID=J9YWF2_9PROT  ali  21  1MKFNINQQDLQQALNYCQGVIEKRSTL-PILSNILLDANNSNLTITATDLDLIFIHQIK-NVEILEPGSTTTTSSIMYDIIRKFTSGKINLSLDESKLQVESEKSLFNLNCINASEFPL-----TDENFNQNEFSIKSKQLLKLLNKCKFSVSND-ETRHYLSGIYLEVEDKIYLTAAATDSHRMSISKVRLENEFEPIILPKKTIFQLCSLLDNYDGEVKVSNAK-------SKIKFELDNSILISKLIDGKFPNYIQVIPKNNQKKLELDLKLFLDSVDRVASVSLDKKD-GVKFNLSKDILNLSVNNTNSGDGKESLN-VSFDHE-LEISFNSRYLIDVASQLDGEKIEVYFNDTGSPALIKDPGDFDSIYVVMPMK 369
54 0.000e+00UniRef50_A0A0G0RGH0 Beta sliding clamp n=9 Tax=root TaxID=1 RepID=A0A0G0RGH0_9BACT  ali  18  1MKLQVLQENLEKAVSITTRFASTKAQL-PILGNILLSAKKNKIFISSTNLEISASVQIGAKVE--KEGEISIPAKVITDLVSNLPKETINLESEKEQLKVSTTGFSSTILGIDPTDFPKVP----NTLNNKNTIVFSKKEISDSLNKVIFATSVD-ETRPILTGALF-ILDKDSLSLVATDGFRLSKKVIPLKSEKKTVVIPKGVLGEINRGIFEADEIL------FDLEENEKQIIFGIEDTVLTSRLLEGEYPDFEKIIPKESNIKITLDKEEFLRAVKLASIFAR-ESANVVKIKILKDLIKVSAESSAAGSQETKVDAKVDKGEEFEIAFNYRYIEDFLYSVVGEEIKMEFLNSTSAGVFRDTGDSNYLHLIMPVK 369
55 0.000e+00UniRef50_A0A2E5F7S7 Beta sliding clamp n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5F7S7_9CHLR  ali  15  1MKLSCAQEELSRVLGLVGRAVPRR-TTLPSTQNVLMVSEGSSVRLSTTNLEIAITTWMECAVE--EDGACSVPAALLTELVNSIPPGEVHLSVNQENMHIESGRFEASVNCGDVNDFPPLPTVEETVAA-----RISADDFRTAISQVAFAAASD-ESRPVLTGIKTEIT-GQNFVLAAADGFRLAVHTGKLQTETIDVVIPARTLEEVARVAGDSQGEIELSVTP-----AKSQVLLRLPNVVIVGQLTQGQFPDYKQLIPKDSSCNATINLESVSRAARTAAILARD-SNGIVRLVFDNGTLQISSSADEVGENQEEIDA-QVIGEASKIAFSSRYLIDVLRNMPGTEVVIETSSPSSPGVFRPVADDSYVHVVMPM. 376
56 0.000e+00UniRef50_UPI0009B76083 DNA polymerase III subunit beta n=4 Tax=Rhizobiales TaxID=356 RepID=UPI0009B76083  ali  19  21MKLLIGRAELTRVLTNVSRVVEARNTI-PILSSLRLSAADGKLTVTGTDLDIVATDTAAADV--TEGGSLCVDAKLFGDIVKKV-GGDISISLEAEKLIVKSGRSRFSLATLPATDFPDL-----GGGTFTAEFELD---LASLFAPVSFAIS-NEETRHYLNGVFFSSADGQPSVAVATDGHRLARNFGPVLPTFAGIIVPRKTVSLLPK-------------GVARVSVSENKIRVISGDFVMTSKLIDGTFPDYQRVIPMQNANAVTVNRDDMLQAAERVVTVSS-EKTRAVKLSVAPGSISLSARS-EIGDAEDEV-AAEYSGEPLSIGFNSAYLRDMLAVLPSGKVTLQIADAGSPARVLGEAG-GWDGVLMPYR 370
57 0.000e+00UniRef50_A0A1V5XI70 Beta sliding clamp n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1V5XI70_9FIRM  ali  20  1MNFVCDRVAVTDAVGIVQKAVASRSTL-PVLEGILIKASEGRVVLTGNDLEIGIECVIAADVSA--PGKVVVNSNLFGTAVRKMTGDTITVKLPNNAVSIKCGNSEIKLNGINAEEFPEIPKFETE-----FDIVLSQREFKSLIRHTIFAVGTN-EAKLILTGCLLEAS-GNNVNMVAVDGFRLALKKVVTEESDVSLVIPAKTLRELNNIIVDRDDKIIIKCSQKN-------VRFEFDNVVFTSRLLEGDFIEYKKIIPTEFKTKITADLKSLIEAVDRASIIITNEINKPLIMKISGGEIRILCETG--AGAVDEVVPVEMTGADIEIGFNNKYLLEALKAAEGDRVNLDFIGPINPCLITPYEGDDFKFIVLPVR 370
58 0.000e+00UniRef50_A0A1V6IXA3 Beta sliding clamp n=1 Tax=Parcubacteria group bacterium ADurb.Bin016 TaxID=1852935 RepID=A0A1V6IXA3_9BACT  ali  18  1MQLTILQKNLHQGLNTISHIAE-KNLSIPILNNILIKAKNNIITLAATNLEIGITKQIRGKI--IKEGTTTVDAKIFSDYIALLPNEKIDIQLVNKQLKINCEKYNTVIKGQNSEDFPVIPQIDKK-----ISLTLSVSDLKIALNQLLFAI-NPTDSRLELTGILFDINDKN-INLVSTDSFRLAKKEINFDSNGLKIIVPLKTMQELARIINFPNDELTEDSDQIQIHIADNQILFVYQGVEMVSRLIEGHYPDYIQVIPTNFKTEIIIDRGEFLRAIKMASIFSANSNAVDLTINTDQQQIIVEAVSGQIGSHQAKL-AAKINGQDNSIRLNYRYLLDCLNVLSANQISFKIIDDVSACKITLPGSEEYQYIVVPLR 377
59 0.000e+00UniRef50_A0A1U7M635 Beta sliding clamp n=24 Tax=Firmicutes TaxID=1239 RepID=A0A1U7M635_TISCR  ali  21  1MKIKIKQRELSKHINIVQKSISSRTTMQ-ILDGILLEAKKDKLKLTGTDLELSIESFVDC--EIIEEGSIVVNSRIFGDIIKKLENDLVTITVDKTNINIKCENSEFNISGNSGEDYPDLPLV-----VERDSFNIPMDIFKTVIKKTVFATTAD-ETRPTLTGVLVEIEN-RFISFIALDGYRLAFKRLPINTDNTKMIIPGRSLNEINKILEEKEEDLNISVSP-------SHIIVNLGSTTIYSRLLEGPFFNYKDIIRKEHKTIVKVKXXXXXXXXXXXXXXXXXXXXXLVKLSLIDNTLNIKS-NTEVGNVFESIDA-QADGEDVNIAFNSRYIIEGIKAIDDEEIKLNFMGSLNPCIINGLEDEDYTYLVLPVR 362
60 0.000e+00UniRef50_D0KVU1 Beta sliding clamp n=8 Tax=Halothiobacillus TaxID=109262 RepID=D0KVU1_HALNC  ali  18  1MQFAVDRDRFSSAINQVIGGVEKRQTMQ-ILSNLLLEVADGRLTLVATDLEIQLRTSV--DVQMQAPGATTVNARKLADIVKSASDAKIALTQTDGWLEIDIGTGVFRLASIEAGSFPQM----TIDAATQSTVSITQKNLYALIDKTQFSMAQ-QDVRYFLNGLLLEVKPG-QMTAVATDGHRLAYAHLSDEENNRQVIVPRKMVSEMLKALDDSDDEVSLAFRD-------NQIELLIGENYLISKLIDGKYPDYSRVMPQSNSKILIVSKTELKQVLQRASILS-NERFSGAYFYLSPGRLMIESSNAEHESSKETMS-VGYDASDLKISFNISYLLNILAVIESEEVCMELEAPESSVLIKPPGDIDSKYVLMPMK 369
61 0.000e+00UniRef50_A0A2D8QTK9 Beta sliding clamp n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2D8QTK9_9GAMM  ali  16  1MNFTTDREKLLGPLQLACGVVERK-QTAPILSNLLLXVRENSLTIVGCDXEVEISLVIS-DIDXESGGAITVPARKLMDICRSLTDSPLTAKRDGNRVQIDSGRFTSSLASLPPDQFPSI-----EPAKATFSXEMLTKQLRWLLKRTSFAMAQ-QDVRYFFNGTLFEISAG-RVHVVATNGQRLATCYLEVGTDHDQFIVPRKAIAEIARLIASLDDEVTXRLD-----FTSNHMTVDVPGARLVTKLIDATYPDYSRAIPLDGDKVMLVDRQTLKDALSRTAILS-NELYRNVRLILLQDRLDMHTNNPQQEEAEETL-IVSYSGESVEIGFNVSYLIEALSAMAGSQVRMTFSDSSSACLLEDVDEKECLYVISPM. 366
62 0.000e+00UniRef50_A0A1V4MND6 Beta sliding clamp n=1 Tax=delta proteobacterium ML8_D TaxID=1775672 RepID=A0A1V4MND6_9DELT  ali  19  3.KFSVKKNDFLNPLSKIQTIIDKKTSMT-IINNVLIYTDENYLFVEATDLEISYKSKIPCLV--TEQGAITINARKFYEIVKEFPSEEIFFEEKDTWLKIGAEKAEYKIGGIAPDDFPKF-----RHVSEENAVDLESSIIREMIEKTIFSSSYD-DRKYSLSGIYFEEKHDDEIRMVSSDGHRLSLMEKYITEKEEGVIIPKKGAQEIRKIIEGHERIV--------WGFDNNFCFVKCNNDHLVVRLVEGKFPDYRNIIPKSRDRYLTFNRLEVFNALKRISIFSSDTTFRGVKATVTPELIEIESLYKEIGEAKETIS-IDYSGEPFEIAFNAKYLMDALSVMDSDRVELTANNSESPCLLTGKEDIGFLGLIMPM. 372
63 0.000e+00UniRef50_A0A162V5V8 Beta sliding clamp n=8 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=A0A162V5V8_9GAMM  ali  17  1MELIVQREQLLQPLQALIGVTE-KGQTLPVLANVKLQVKEEEIILTTTNLEIELSCALPYH--STATGGTTIPAKKLLDILKALPHGDIHMILEPTKVEIKAGRSKFSLACLPLEEFPVLDHIDFN-----NTLTLPKDRFRSLLQNVAYAMAT-ADVRYFLNGMLLDVQDS-LITAVATDGHRLACSRYPFEDATHQFIVPRKAVEELLKLIENEAAPLHLQLSD-------NHLRVELGSMMFTTKLIEGKFPDYKRVIPPIGEKIIMADRSEMIDSLMRTSILSQD-KFRGIRMNISHCLIKLVAHNPEQ-EVAEEEVEVNYQGADFMIAFNAAYITDIFKNIEGDMVQMSFTENNSSCLIKNPEDDNVDHVVMPMR 365
64 0.000e+00UniRef50_A0A1B1Y9S3 Beta sliding clamp n=4 Tax=Ruminiclostridium TaxID=1508657 RepID=A0A1B1Y9S3_CLOSR  ali  19  1MNFSCNKQDLLEAITTVQKAVMSKATL-PILEGIYIEA-GDSLKLVGNCFDMGIEYYVNADIK--EKGSIVLNSKMFSDIIRGLPDSEVFIHEKENVVVIECSNSYFEIKGLSPEGYPMLPEIEEKD-----KITVQQSALKDMIRKTIYAISNDEKNK-ILTGSLMEASDGE-ITMVSLDGYRLAIAKTFIKEVSFKAIIPGKNLGEIYKVLEQSDEKVKITLS-------TNQALFEFENCRIISKLIDGEYMNYRSFIPEKFETQVEVNVKEFTKGIERASVIMSEENKYPVKLIIEGDSMLITS-STKFGISKEQIE-VSTNGSNMTIGFNPRFLLDSFRVIEDEKVEIYFSSPVGPCVVKPIESDKFTFMILPVR 362
65 0.000e+00UniRef50_A0A0S4NEY9 Beta sliding clamp n=3 Tax=Candidatus Kryptobacter tengchongensis TaxID=1643429 RepID=A0A0S4NEY9_9BACT  ali  20  1MRFLISSDRLKSALAKVSAVVPSK-TTLPILQDILFELKGNILYLTATDLEISVRITID-PVDGEEDGAVAIPEDKLTSVIKALPEGLLKFEVDSDRVLITTNKGEYKMSAEPADSFPAIP--ESIDKTMGFGVTISGEILKEIIEDTVFATSK-EELRPATMGVLFQFRE-NEFVAVATDGYRLVKITRKGKADSSGVIVPAKTLQIIAKSIEDEDT--------CEISINEKHIQFSTENITIISRLIDEKYPNYESVIPYENNKELVVERDLFLSTVRRVAIFA-NSTTNQIKFALNPGYIEVSAEDIDFGGSAKETLNCTYNGEPMEIAFNAKFITDILGHLDSDRVLFKFGSPTRAAIVQPAEDREVLMLVMPMR 378
66 0.000e+00UniRef50_A0A0G4B0S5 Beta sliding clamp n=5 Tax=unclassified Saccharibacteria TaxID=1895827 RepID=A0A0G4B0S5_9BACT  ali  16  1MELTVTQENLTRALTAVGRVASTKTQL-PILSNILLRTDGTRLLIAATNLEIAATQLIGAKI--AKPGSITIPAKLVAEFVASLPKGNVELLVKNDHLHIKAGTYSSVINGIASDDFPELPVIDEKK---SIQYSISTDEFKQAVSQTILVASNDS-TRPVLTGVYWHSFEGN-LYLAATDGYRLTEKRLVETKSDVSAIIPASSLQEVLRSITDDATEVELLFDE-------TQVRFRLGEAEITSRLIDGNFPDYRQLIPASSESVIKIDKAEFVRITKIASLFARDGGSVTVTANAEAGTLAIHSIASQLGENTSE-SAADVSADG-QVTLNSRYLADALSVTSGDKVVFRFSGRLAPCVLSDKKDNDYQHIIMPLK 365
67 0.000e+00UniRef50_A0A2D6L7L9 Beta sliding clamp n=1 Tax=Parcubacteria group bacterium TaxID=2026774 RepID=A0A2D6L7L9_9BACT  ali  15  1MKFSCTKENLLKAL-TCTGYVSGKQVNLPILQNVLISMKNTETKIVSTNLEIAVSAQLRAKVET--DGEFTVPARVFLEYMSNVPGDRVDIELHDSGLGVQMGHSKTVLKGMEATEFPLIPGIEGDVV-----FELDAKVLLNALHQVLFAASKS-DVRLELSGVLFHCNPKQNLVLAATDSFRLAEKKITFKSEEKRVIVPSRTVAELVRIINVSSKEI----DSVTMRVSDHQIVFVCGGVQITSRLTEGNYPNYEHIIPKESNVEMSALKDDVVKQVKGASLFTTKGIG-AVRMKFAENKINITSTNAQTGEHAGSVVA-EGKGDEVEMYLNHRYILDGLGVIDNERVVFSAQSTDAPLVMRPQMDKDYLYMIMPIK 373
68 0.000e+00UniRef50_A0A1V4MCG8 Beta sliding clamp n=1 Tax=delta proteobacterium MLS_D TaxID=1775673 RepID=A0A1V4MCG8_9DELT  ali  16  1MDFSVDRNVFQEAVQRTLGIVERKTTI-PILSNILIRADSTSIRIVATDREIGLVADYEAQVS--EKGDITVNARKLYEMIREMEGEQIHFTTSNNQAFLAAEKAEYRIPGIPADDFPDVRREDTIP-----CFTIPARLLKGIIKKVFYAASTD-ETRPSLNGIFFK-KEGTICEMVATDGHRLSLVAQALPEEKEGVIIPRKGLGEVRKMVDDGEGVVEMGVADHVMVVRKDTSMLRLG-------LIDAVYPDYRRVVPKDRGASVLIEKHRFLQSLRRMGVMST-ELFSGVIISLDKGIMKLNSTNPDVGEANEEVP-VDYNDGSISAGFNVRYLIEAVDSMEGETISFEMRSDGGPGVMRVKGTDDHLCIIMPIK 368
69 0.000e+00UniRef50_K1MFW9 Beta sliding clamp n=4 Tax=Facklamia TaxID=66831 RepID=K1MFW9_9LACT  ali  18  1MKFTINRSKLIQELSNVQRAIPGKTSME-ILLGIKLNLTSNGLYLLGSDSEISIESFIDAHLKIEETGSVVLPARLLNDIVKKLASDEVKIEVETDYVTISAANAEFKIIGINAEDFPHLPTIE-----EQSQIILPAAQLKKVIDQTIFSAS-NQELKPSLTGLYLAI-DKDQLTAVATDSHRLSQRKLLLENQHLSMILPKKTVKELARVVPD--------YADIKMTIASHQVVFQFENITVYSRLIDGTYPDASRLIPTEFNTEVVLNAQYFSGAMDRASLMSHEGKNNIVQLSIEDQHVELKVLGAEIGNVTEEIEYQELVGENIKISFNPDYMNEALKSFGDQTICLQLISPVRTMLLKPEKDSKLLQLLTPIR 378
70 0.000e+00UniRef50_A0A0A2W3F8 DNA gyrase subunit B n=45 Tax=root TaxID=1 RepID=A0A0A2W3F8_BEABA  ali  18  425MKFTVEREHLLKPLQQVA---------------------EGALSLTGTDLEMEMVARV-ALVQPHEPGATTVPARKFFDICRGLPEGEIAVQLEGDRMLVRSGRSRFSLSTLPAADFPNL-----DDWQSEVEFTLPQATMKRLIEATQFSMAH-QDVRYYLNGMLFE-TEGEDLRTVATDGHRLAVCSMPVPLPNHSVIVPRKGVIELMRMLDGGETPLRVQIGSNN-------IRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLDAGCDLLKQAFARAAILS-NEKFRGVRLFVSENQLKITANNPEQEEA-EEILDVSYDGTEMEIGFNVSYVLDVLNALKCENVRILLTDSVSSVQIEDAAN........... 758
71 0.000e+00UniRef50_A0A1V6HUJ1 Beta sliding clamp n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1V6HUJ1_9BACT  ali  16  1MEIRLKRSEFLTELAPMQGIVERRTTI-PVLSHLLLTVRGDRLYLAATDLDVSLTSWVGG--EVAREGAIAVQAKKFLEIVRAAATEEVQLVQEEERLAISFGTARFRIHGLPATDFPTLATV-----APRTEVEIPLPRFRRFVSKVLFAVS-SEEARFQLSGALVHLKDGK-VEMVATDGHRLALIEGAVSGGEDSVLVPRKALQELLR-FEGEEQLV--------FRRGEHHLAFVSGRRELVCRILEGTFPDYERVIAKQNDKKVVVDRRGLAEMVQRIALITGD-RARGVRLAFAPGEITVSAANPDLGEASETL-ACEYEGEALRIGLNPDYLGQFLAALETEKVLFELKDENSQCLGSPIGGEDYLCVIMPMR 364
72 0.000e+00UniRef50_A0A2H0N088 Beta sliding clamp n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0N088_9BACT  ali  19  1MEIIILSKNFKKGLSLTEK-IPGKTLTLPVLNNVLIDTSGNFLKLSATDLEIGIQWWGLCKVE--KEGKIAVPVKFLYQLINSFPDEKINIKEKNKTLFIEGQNYKTQIKGVSAEDFPIIPSFLKEKF-----IEIDNKKIKQGLLDVINMASLSQ-IRPEISGIYFSFL-KNQVKFVATDSFRLAEKTLNFSSEEVNFILPQKTARELINILDETQKNIKIYFSE-------SQILFETPEINLISRQIEGEYPSYQDIIPKEYKTKIILNREEFIRQIKVASLFS--GKINEVKLKINPKTIEIFSQDPDFGESKSNLPA-QIEGEKIETSFNWRFILDGLLNMKSSEVSFDLQDNNGPGVLKPIGDPTYLYIVMPIK 378
73 0.000e+00UniRef50_B8FM62 Beta sliding clamp n=3 Tax=Desulfatibacillum TaxID=218207 RepID=B8FM62_DESAA  ali  18  1MQFSISKEIFLDGITKVQG-IAGRKTTFPITANVLISAQGSTITLVATDLEIGFKGHYPATVE--EEGTITIPGKKLFEIVREFPHGAIDVDLENGWVQIFKDKVQYKIVGMDPNDFPKLPEVEGMEL-----FELDSLVFADMIEKTNLSMS-SEEKRPHLIGVYLEKEEKNGLRMVSTDGNRLARVDIPDEGGAKGVILPKKVMTEILR--------VSEGGGKISLGVQKNYFVIQKEAETIIGRLVEGEYPDYNLVIPNDLETFFEIEKQPFVSILKRMSILCS-ERYRAVRFKVDPQRLEVSVNNPELGDSNEEMP-IAFNGGAFEAAFNPRFFVDALNPMKSDMIKVNILDSSKPCILEGSEDPRYLSVIMPMR 375
74 0.000e+00UniRef50_A0A2E8WNN0 Beta sliding clamp n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2E8WNN0_9GAMM  ali  17  1MKFDVEKSALIEPLQRVVNVLERR-QTLPILSHVLIECSESGIVLVGTDQEIELSARIPIDVVVSGVGAITVPGRKLLDIVRHLPEGVISCEAEADRFILRSQRFESQLTTLPASEFPWI----DLAVIADDPIKSSGKALKTLLSKTMFAMAQ-QDVRYFFNGMLFEFEAG-LLRCVATNGQRLAISETSLEGSTAGAILPRKGVIELARLLDSDAEEVRLQFTDQ-------HVQAEFGLDRFVSKLIDAEYPDYTKAIPASSDQSFSCSRNDLKDALVRTAVLS-NEVYKNVRLSLSAGQLEIFTNNPQQEQAIEQIS-VDYTKEPLEIGFNIHFLIEALSVMSGDSVRVELSSPSSPCKLEDPDDSSARFIISPM. 367
75 0.000e+00UniRef50_A0A0G0PU18 Beta sliding clamp n=2 Tax=unclassified Microgenomates group TaxID=1794839 RepID=A0A0G0PU18_9BACT  ali  18  1MKVSILQTHLLSTLTRVGKIISSKAQL-PILQNFLLEAKEGSFTVTGTNTETSIVSRSNAKIE--KEGGLCVPAKLLIEFITSLPEGVVEMSSKEGALEIISNGFEATIPGVSKEEFPPLPKHDKIKGA-----EIPREKFLRALEPVLFAAATD-EGRPILTGIKIQKVDKEAL-FVATDGYRLSLKRVDLNEENINITIPARTLTEVVHIGLEDEDNKTITL----KTIDASQLGFFFRETEIYTRILDGEYPNFEKILPKKHTTKIILDKEKFLQAVKSTSIFAR-GNANIIRFIIAEGDMIISANTPQVGQNRVVLEGEVEG-ERGEIAFNSRFVLDFLSHFQEEKLQFEMTGSLNPGVFRSTTDDSYLHIIMPVR 365
76 0.000e+00UniRef50_K1LIK1 Beta sliding clamp n=4 Tax=Aerococcaceae TaxID=186827 RepID=K1LIK1_9LACT  ali  22  1MKFTIKRTAFMNQLNNVSRAISSKSTI-PILLGIKMTATEEGITLVGSDTELSIEGFLPIKDEIESTGSVVVTSRYFLEVIRKLPADTVTVEVNDQAVNIQSGQSHFTLNGIDGNQYPLLPEIISEE-----SIQLPTELFKELIAQTIISTS-NQETRPILTGVNITLK-GKQLTGVATDSHRLSQRTIEIELEIESMTIPKKTLNELSRIVEDEDHIKLIISDE--------QLIFALKNLTIYSRILEGNYPDTDRLIPTEHATRIVVNADTFYHAIDRASIMSNQGKNNVVRLEIEDQRVELSVYGSQLGSSNEAIETQTVTGESLQISFNPDYMKDALKTFNGTDIQMDFQSNVRPILLTAVEDENLIQLLTPIR 378
77 0.000e+00UniRef50_A0A2M6WLF6 Beta sliding clamp n=7 Tax=Candidatus Falkowbacteria TaxID=1752728 RepID=A0A2M6WLF6_9BACT  ali  16  1MKFSCTQENLKIGLLNIVH-VAGKNINLPILSNVLIDVSDSVIKLIATDLEIGVTAAIRGKVEAV--GKTTVNAKLITDYVNLLPNKRVDIELEDDGLKIECDNFKTKIKGEDPGDYPIIPLINK-----TNCFSFSFDGFKKTIAGVLFAAATD-ETRVELSGVYFEFGETE-LTLAATDSYRLVERKIKYKNKEKKLIIPSKTLMEAVRMSDAIDVAEEKSDKEIKVYVSENQVLFAYDEVELVSRIIEGQYPDYKQIIPEENKTVVKLDRRELAQAVKASSLFSKT-NVNDVELKYANGKVVVSSLNAQSGQSTAEVFA-EGSGKDNGVVLNYKYLLDGLNNFESERVILEIADANTPVLLKIENQADYLYIIMPIK 382
78 0.000e+00UniRef50_A0A2E3LZG2 Beta sliding clamp n=2 Tax=Parachlamydiales TaxID=1963360 RepID=A0A2E3LZG2_9BACT  ali  20  1MKFVISKAELVKLIGTIQNVVAQKAPI-PILSNFLLEAANGEIILTATDLTVGIRCFAPAKIE--QEGATTLPAKRVFQLVRELTAANIEVSTGSNEITIRAGSSVFRLHGMSRSEFPALPDLEG-----STKFKISQEKLREVLFRTSFAVSR-EDNRYVLTGVLMQVANGGA-TFVGTDGKRLSKSALSVSSFTADYVIPLKAVDEIFKGLTEE--------GEATVYLMSDKIAVESDDTIVITKLLSGDYPDFNRVIPEDSDVRVDLHREELASLLRQIALFTVD-NNHSVRFTFQDSELFLTANNMEVGDGKVSMP-VNYHGPKLDIAFNPTFFLDILRHSKCETVAIGITDSYNPGVVTDNSAEDSLFVIMPMR 364
79 0.000e+00UniRef50_UPI000C07BAD7 DNA polymerase III subunit beta n=1 Tax=Neglecta sp. Marseille-P3890 TaxID=2014781 RepID=UPI000C07BAD7  ali  17  1MKFTVNKKEITDAVLNIQRAVSTKTSI-PVLEGILIKTGELSVEMSAYDLELGIKTVIAAT--GIQEGTTVLSAKLFSEIVRKSPAEIITVEVDEKHMTIVSGHSNFSIIGFLPEEFPELPKLEDSTI-----FNLPSKMLKSMIRQTSFAIAES-DAKPIHQGGLFNIQDG-RLDMVAVDGYRLAKRSELIDKDELSFVIPGKTLREVNSLLKDEDDLIEIAAGK-------RHVLFKIGNYTVTSSLLEGDFLNYKATIPTETGIEVIVNTRKVIESVERVSLLITDRLKSPLRCTFEDDSIKLLCTTA-MGRASDQIEA-SIQGENIEIGFNSRYLLDALKNTECDEIKIQLNTALSPMKIVPKEGDSFLFLVLPVK 363
80 0.000e+00UniRef50_H3NQU1 Beta sliding clamp n=3 Tax=Helcococcus TaxID=31983 RepID=H3NQU1_9FIRM  ali  18  1MKIKINKSDLDKHISIAQKAISNKSSIQ-ILEGIVFTAYDNKLKLSSTDLELSIETQVDC--EVLEEGSIVIKSSIIGNIVKKMPNDIITMTANDEMVNIQSQNSVFDIACQSAMDYPPLPDVEDEPI-----LTIENEDLNLAVRETIFATSND-ETRLALTGILFEFNNDN-ISFVGLDGYRLAIKKYNYSNEETSVIVPKRAFNELIKILDEKTTEIILI---------KGHIAFINGSTKMYSRLIDKKYIDYSKIINGEYKTSVRVNRNDLINSLDRALLLTTGASASLTKLTFEDGEISINSNS-EFGRLDEKLYGKQ-EGDNIQIAFNTRYLLDGLKVIEDDEVLLHLNTPLSPMSIYPIHDDNYLYLVLPVR 361
81 0.000e+00UniRef50_A0A2V2EPX7 DNA polymerase III subunit beta n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2V2EPX7_9FIRM  ali  19  12MKIICEGIELSDAVLKVAKACSTK-TTNPILECVKITAENDSITLIATDGEIAIQRKIKADV--LEEGAICVPGKFFSDFIKKLENEQITLATEDGRVIITYADSESSMQLLNADDFPAI-----DANIGEKKVELLTKDLKELIAKTTFCCAQD-DSRPVLKGVLVQTQEG-RICFTALDGYRMAVCRKNILGGDIKIICPGRTLNEIGRMLGADEDRIEIFVQK-------NMLMVSIDDTVLTSRLYEGEFVNVSNIVPKEFTSEIVVEKEALDESVERAAVLARTDKNSIVTFDIREGSMGVSSNTM-IGRVNESVK-IMLEGKDVQIALNCKYVSECLNAATDETVRIGFNGAVAPCVLTPAEGDSYLYLILPVR 374
82 0.000e+00UniRef50_A0A0N8KPT9 Beta sliding clamp n=4 Tax=Cyanobacteria TaxID=1117 RepID=A0A0N8KPT9_9CYAN  ali  15  1MKLVCTQGELNTHLSLTIHAVPSRPT-HPVLANVRLDAEQQQIRLTAFDLSLGIRTSFPAQVE--SSGDVALPAKLLNDIVSRLPDGELTLAQDDDQTTLTSLSGTYKVQGMSVEEFPELPAIE-----DGKVIQLDSESLLEGLRGTLFATSSD-ETKQVLTGVHLAVRADG-IEFAATDGHRLAVVEMNLEEGEFEVTVPAQALRELERTIGK-----RAAATPLTLSIDEGQAVFEVEDRRLTSRTLDGAYPAYRQLIPRQFDNQANLDRRALLSALERIAVIA-DRKNNIVKFSFDSGQVTLGVDAADVGSGSECLPA-QISGDSLEIAFNVKYVMESLRNLQSTEIQLQLNSATSPVILTPLGGTKMIHLVMPV. 378
83 0.000e+00UniRef50_A0A2G6JC24 Beta sliding clamp n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2G6JC24_9PROT  ali  15  4MELKLDRNAFLSALYKTQGVVDRKSTTN-VLSHVLLETLGGRARLLGTDYDVTIEAELPAEVIV--EGTACINGKSLFDVVKNADDNEVLLQLDNHWVEVHAGRSQFKLAGIGASDFPELATPD-----DVVWLDVPAATFSDLVDKTSFSMS-DDETRMNLNGVHLNIEPGSKLTMVSTDGHRLSKVDLEAEGQTLSAIIHKKGVQEVRRLLDGDAQVIDVGFGKGV-------ILFRAAGTTFTVRQIEDSYPDYGRVIPASSPVRVPIPRDRLIRAIRRNAVLTSS-KTYIIKFELSAGKVAVTTSNPDYGEGRDEVD-VPYDGDGMVIGFNYNYLLDVLGAIRGDHAVFEFNDEFSPTVITSPTEPGAIFVVMPMR 377
84 0.000e+00UniRef50_A0A1H3PU56 Beta sliding clamp n=2 Tax=Tindallia TaxID=69894 RepID=A0A1H3PU56_9CLOT  ali  18  1MRFTIDQKDLMKSLSTVQKGVSSK-TTLPVLKGVFVEASENYLKLVTTDLEIGIEHFVSAEVE--EDGIFVADAKLLSSYIRKLPSRPVTFTVDENQLTISCDHISFTLHLLEKEEFPELPIVMAE-----NSFTIPQELFKSMVHQTVFCASQD-ETKPSLLGLRVELKDQN-LRLIGVDGFRLAYRNSPVESDEEGFTIPVKAMNELIQITGDTPSPMQIAFTD-------KQIVFSLDNTKMISRRIEKAFIEYENILPNEHETRMVLRKDALQSAVDRASLLGSEGKSSLMKWNLENGELMMFSHT-QTGQMKEKV-TVEQEGDNMEIAFNARYLMDALRVIEEEEIAIHIINHRSPALIKPVEGDHYLHLVLPVR 363
85 0.000e+00UniRef50_A0A2A5E765 Beta sliding clamp n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A2A5E765_9BACT  ali  16  1MKISIARQDLQDAVNKVKSVVSSKSAL-PILSHILMEASDNTLKLSATDLKVSIESTVDCDV--AESGSMTISSQRLSSIIPELPDENVVLELQDGSVNLTCGKIHTKLYSMSPDEFPPVRNFDDIE-----PLVLPKKILADIFNKTSFAICTDQ-ARYNLTGLLLEIKNG-TLTAVATDGRRMSLYSQKVGGVDIKVIIPGKMIHELERLLDDE--------GDVDVLITENQAGFQFDSIRLVTALIEGTFPNYEMVVPQKHDKEAIINTKQFMEAMRRTRTM-TNDKFNSVRIELTSGQMKLLVTTPEVGEYTEELS-VEYDGDDLEIAFNPDFVYDVLRHIDTEATGLVLKDAMSPGIIKPSGDDNYTNVVMPIR 367
86 0.000e+00UniRef50_V1CNY6 Beta sliding clamp n=1 Tax=Eubacterium brachy ATCC 33089 TaxID=1321814 RepID=V1CNY6_9FIRM  ali  21  1MKFYCNQQELNRALNIVSKAITVRTTI-PVLKGILIIAEDNHLILRASDLDMSIETKIDAVVE--ENGNVVANSKLFVEIIRKLPNGNIYMEVGENNVNIKTDSSEFQIVGQSGENFPVMNIVEEN----ANKLSIEKEILKNMIRRTNFSASID-ESKGVLVGELIEI-NQNDIRMISVDGFRISVYKEDMKNENLNIIIHAKTLSEVLKLLSESDID-----EDVELIIGSKEALILLDKTKVSIRLMEGEFIKYKDILPKDCNTRMKVDRKFLMQSIERASLMAKEGKNNLIKCTIDGNLLTINSRSDE-GSVKEEL-IVKKEGDNIEIGFNSKYILDVLKVLDDEEISIEFKNSLAPCSIKPVKGDNYEYLILPVR 366
87 0.000e+00UniRef50_UPI0009313F31 DNA polymerase III subunit beta n=1 Tax=Rappaport israeli TaxID=1839807 RepID=UPI0009313F31  ali  20  1MKFSIVKESLLTALSDFNDIISRKTTT-PIISHIYIHATNGQLQLRATDTEVSLEGTIKA--EVRDEGATTVPGAKLLDVVRNLPNAYVVCELKGEHFHINAQDSHFRLSTLPAEDFPV-----AEEIAFTHSVALNSDTLNELMQKVKFSIAV-QDVRYYFNGLYLDIHQGKNINAVSTDGHRLSCASAELTTQELGILIPRKGVDELGKLLARVDQSITLNLGE-------RQLQLAIENYRLTTKLIDGQFPNYESVMPNAQPNPIIINRQGFLHALQRAKVLLVD-RHDGVKLNFNGHKLFIAARNHDNESVDEVMEIINPENMKLEISLNINYLIDVIKIIEGETIQLHFQDSESPCLITSQSDESVRYVIMPMR 368
88 0.000e+00UniRef50_A0A1G1V568 Beta sliding clamp n=2 Tax=Candidatus Blackburnbacteria TaxID=1817898 RepID=A0A1G1V568_9BACT  ali  18  1MKLSVLQEDLLKSVALASKFTSSKAQL-PILGNILLRAKEGKLQLAATNLETGISTKLPAKIE--KEGEITVPAKIILELISHFRPGQVLLEEEKGQLKVSSQNAKASVSGLSTKEFPNVP-----NSLNKKSFSLKKETISVLSKEVCFAAA-SMDTRPVLSGVYIKI--GNNPVAVATDGFRLSYKDLKSENERTSFLLPATIIQELGKSLNPQSEDINVELNDK-----EGQIIFESEEAVLTARLIEGQFPDYQKVLPKGWSVKTEISKDELLQGVKAASVFAK-EAGSVIKLSFKKDGLSISSESNLYGSEEISIDS-RVEGEELTIAFNYKFVLDFLNSITGDSVLIQTQSATSPTLFQNTKDDSYKHIIMPVR 369
89 0.000e+00UniRef50_A0A1J0LJB5 Beta sliding clamp n=83 Tax=Bacteria TaxID=2 RepID=A0A1J0LJB5_9FLAO  ali  20  1MKFIVSSSELLKQLQLLSGVINSNNTL-PILDNFLFDLQDSELTITASDLETTVSSKI--TVNSESNGKICVPAKLLTDTIKTFPEQPLTIRTEENLFEIVSEQGNYSFGLERGDEFPMAPELESP-----STVKLQGNVLAEAIGKTLFATGND-ELRPVMTGVFFQLGTDKCI-FVATDAHKLVKYTRDDIKETAEFIMPKKPLNLIKNILGNKDTEITIEYNEVN-------AKFIFEGTTLVCRLIDGKYPNYEAVIPKENPNTLTINRSAFLSSIKRVSIFS-NKTTYQIKLKLAGNQLQLSAEDIDFSNKADERLTCDYNGGDLMIGFNSKFLSEMLSNLNSEDITLEMSEPNRAGIIKPEEGEEVLMLVMPV. 369
90 0.000e+00UniRef50_A0A2V2RPU4 DNA polymerase III subunit beta n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V2RPU4_9BACT  ali  17  1MKFKINRDHFVAGLQKVQNIVGNRVDM-PILNNVLIKVEPDHICLTTTNINLGIRCHIKTE-PNNQVGSITLPVKKLLTIVRALPNLAVDLEASDSQAKITSGGARFKIMGMSETDFPPLPTI-----ADLEGYVVTQNELLKMLKSVSYAQSTD-ENRHMLNGVYFSFKEGK-LTLVATDGKRLGLATKELPESEKSFILPAKTAAELERLLG-QEKNVTISFN-------NKQAVFDIENIYLVSKVVDSIYPNYKQVIPSETVHRVKIDRELLLECLSRAALV-TNEKSNSVKLKISNNLLEITASSPELGESQESM-AINSENANVELAFNPQFLIDPLKSLYNDEVFFEFKDELSPGLFKTL--DSFLCVIMPLR 375
91 0.000e+00UniRef50_A0A2S6Q471 Beta sliding clamp n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2S6Q471_9PROT  ali  19  1MKFSVSRDSLLKMLDPMNSVIEKRNSV-PVLSNVKIELKDGKLKATATDNDITLEGVIDATVEV--EGTTTVNAAKLNEIVKKLSEGSVTVDMNADRMTITSGKARFNVACISAESFPPV-----QGVSSDCSFEVEAEGFRKILTRSLFASSKD-DSRQYLNGIYMHAAKGDALCFVATDGHRLSKSVMPLPNNMPGVILPRKAVDKLV--------SVSRDVPAIKVEVAESKAQFIAGDLVLTTRLIDSTFPDYNRVIPQTNEAEMVISKQALLQVVDRVAILS-NEKSRSVKFEVASNLLKVEAHNTDSEEAKEEIE-VAYNGEEVVIGFNAQYLADLGKLMENEEIKFQFKTSGAPVLLQDPKDVSSLYVLMPMR 373
92 0.000e+00UniRef50_A0A1I6E2A1 Beta sliding clamp n=2 Tax=Desulfotomaculum TaxID=1562 RepID=A0A1I6E2A1_9FIRM  ali  21  1MHFSVHREDLNSVVQVVQKAVSLRNPM-PILSCLHMESTSGTLTVTATDLEFGIRCTIP--VNTVIEGSAALPAKYMANFINRLPEVELNVQCDTNTTVFSYGDSEVVLHGYPAEEFPPFPA-----LPEKQALKINQRIFKKMLKQVLFAVAT-EEHRPVFTGVNIRIDTGGTISMVATDTRRLAVCEEKLEENFINIIVPGKTLNELYKLIDAVDDTFDLYLTD-------NKIFFAFENICLMSRLIAGQYPDYRIVIPNEYVCEVRAPVSALLDAAERASLLVNNRR-NVFNINFQPGNLLIYFYT-ETGRIREEITA-DFSGDQLDVGFNVRFFIDLLRSLDTSEVIIKLSGSENPALFKPIDDDNYFAILVP.. 364
93 0.000e+00UniRef50_K6H2P5 Beta sliding clamp n=9 Tax=Bacteria TaxID=2 RepID=K6H2P5_9GAMM  ali  17  1MEITVKKEDIVSALNTTLGVVEKR-QTLPILANVLFEVDESSFKLTATDLESEVSISGPL-VGVESAGKTTTSAKKLNELCRLIPDGEISLSLAGEKLNIKTTNGKYSLSTLPSADFPIF-----DIDSGDTPLVVPAKDLRELIRSTSFAMG-NQDWRHYLNGLYLTINDGE-ITAVTTDAHRLAVANTSIQSDSFSGIIPRKSINEMAKFLSDHDGDSELKINEASLELV-------VGNLVFKSKLIDGKFPDYQQVIPSGESSVLEINVKDFSETLSRVSVLSS-EKYKGIRLITSSDGVRISANNPEQEEAEEFFPTP-YNGDDLDIAFNVTYLQEIMSHMQTDTCHINFFGSDKSCLLTPPGSDTPKYVVMPL. 363
94 0.000e+00UniRef50_B5YGU0 Beta sliding clamp n=7 Tax=Thermodesulfovibrio TaxID=28261 RepID=B5YGU0_THEYD  ali  19  1MHLKLKKQKIQESLSKIQNIVEKKS-IMPVLNHFLMDVTENAVFILATDLETAVKQPLEA--EVLEIGKACIPARKFYEIVKEL-DEDIEIMLLEQWIKIQSGRSNFRLASLDPSEFPVWPQI-----GDATQINLSRDFLLTAIEKTIYA-SGEADARYVLNGLLFQIKEPAEFNVVGTDGHRLAHFKATVEEGEKKVILSKKSLNELRKFLSDTET--------VSIHIGKTHVMCEIDGINFLTRMIEGNYPDYETVIPRHNDKIAIVDKNSLIASLKRVSVLSR-ERQNAVKTEWDKDLLIISSSDPEIGEARDEL-TVDYQGEPFIIGFNARYLIEALERITSDKAKITMSEPDKAVYITDGEAASFVYVVMPLR 367
95 0.000e+00UniRef50_A0A2D7XBV1 Beta sliding clamp n=1 Tax=Pusillimonas sp. TaxID=1979962 RepID=A0A2D7XBV1_9BURK  ali  18  1MKFTVSRSALNRAIKNIAGVVEKKNTM-PILAHAKLEV-GDKLKITGSSMDIEATATVEC--EVAQAGEITVPVYTLADIVNKLPNGDVKVSLEDSKLKVSSGRSRFTLPTLPVGDFPSM------NMESDVYFDIPAATFGYMLQKSEFCAS-DDETRYYLNGVCLDFKDDAT-YSVATDGHKMAKIAGVKTVDHAQIIIPSKTVMQVLKLLDGCE--------IVTVSLSDNLIGFNFGDAAVLSRLIDGKFPDYGRVIPEGNDKKMSVNVADMLGAIERVGSIA-DSKTRAVKCTIADGTMTIEAKSSEFGEASEVIDVADF---DLIIGFNGRYMSDILKSLECEAVDMSFSTESGPIRI---EDEDQLYIVMPLR 354
96 0.000e+00UniRef50_U2JFS1 Beta sliding clamp n=1 Tax=Peptostreptococcaceae bacterium oral taxon 113 str. W5053 TaxID=1321784 RepID=U2JFS1_9FIRM  ali  22  1MKLSIQQKNLLKHINIAQRAIGT-HTTLPVLEGIYLIAKDNTLELIATDLKISIHSKVDALVK--EEGEIIVNSNLFGNIIRKLPDEIVELEANDNLLQIKCAYSSFSIHLYEEDEYPSIFNEENGDM-----VTISSGSLKDSISQTVFATSQ-ELTKPILTGVLMN-QKSKKIDFVALDGYRIAIKTLMMEKEEKQVIIPAKALQELNRILPEEGDTL--------IKILKGSVVFEFEGTRLFTRLLDGNFIQYETVIESVFSTYFSVNRKSLEESIERAALLSREERTNLIKLDLNSGRLTITS-NTEIGHVTEIVDGKQ-EGENLIIAFNARYLMEGIKAMRESEIKMKFSGPLRACIIEENENPDFIYVVLPVK 362
97 0.000e+00UniRef50_A0A1G4F519 Beta sliding clamp n=6 Tax=Rhizobiales TaxID=356 RepID=A0A1G4F519_9RHIZ  ali  16  5..FSIERGALLPALAAVNRAVEKRNTI-PILGNVLLAVENGELCVTGTNLDIEVKSV------AKQEGPFTVQSGLLHDAVSKFADGSVTFEGDETHVNIKSGRSRFRLQVLPATDFPEMSAGE-----FTHEFALPGNVLARVLSTVAFAIST-EETRYYLNGVFMH-NDGEHLAFVATDGHRLALMKLDAPAGSAGIIVPRRTVALLQHFAKGDEDIV--------LKISDRKIRIMLDGTAITSKLIDGTYPEYQRVIPANNDKAYTIDREELAGAINRVSTVSS-ERGRAVKFSFGPSELKMEVTNPDSGQAEDSIVISEGHDDEVTIGFNHKYCLDVLGAVSAKEMRFELSDPGAPCKVSPIGAEDGLFVIMPMR 373
98 0.000e+00UniRef50_A0A212L823 Beta sliding clamp n=1 Tax=uncultured Pleomorphomonas sp. TaxID=442121 RepID=A0A212L823_9RHIZ  ali  15  8.RISLSRDAMVSALGLLTRTIERRNTLA-ILANVLVDVKGGLCRLTASDLDIWATTSIALSDALAPDAATTLPAQMLSDIVRKLPSGEMDLSWGDKEAQIASGRARYRLNTLPPTDYPSLSEPDW-----LATFSVGAKALRTLFEKVSFAMS-NEEVRYYLNGAFLHTVVDDHLVAVATDGHRLSKVTMPAPGKMPGVIVPRKAVGEIVRLLDGRDGDIEVSVSDA-------KLSVTAGPTRLLTKLIEGSFPDYARVIPQGGSRAAVIDADALSAAADRVSTVSG-ERGKAVRLSFAGTSLKLEVKNPDAGDAEEEVQA-EFEGEPLEIGFNARYLAEALRAVAADTIRIQLGDPGSPAVMTSAASADHLVVVMPMR 378
99 0.000e+00UniRef50_A0A2H0WAE6 Beta sliding clamp n=1 Tax=Candidatus Beckwithbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_34_10 TaxID=1974495 RepID=A0A2H0WA  ali  18  1MKASILQENLQKGLNLTSRAINSR-VNLPILGNILISTKEAKIKLTATNLEISINVFLPAKKE--RSGQFTIPAKDITEFVSSLPTGRVDLEEKKEKLELVSGSYRAIFNGMSAAEFPQVPSVDGKKEDVLKKTKIDTKSFIKAVNYVNFAAAQD-ENRPVLTGVRLSFEESN-LQLVATDGYRLSLKKIKLEKDFPTLIIPARALGEVVRIITSNDSNGEDEKLVLSITKDKTQVIFSYADTEVIARLIEDKYPDFSKIIPDKGENMAIIDREEFYKAIKAASIFARK-SANIVKFTFFNNNMTIEANAPEIGENEIKI-GIRYKGDKEQIAFNYRFIQDFLSNFDQESLSLEISGPLKPGLFKGEKDNSFLHVIMPVR 376
100 0.000e+00UniRef50_A0A2A5FIK5 Beta sliding clamp n=2 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2A5FIK5_9PROT  ali  20  1MKLIISQSLLLKQVQRCQSIVEKKNT-KPILCNICFKALPNQLEVIGTDLQMAISAIQEA--EVLEEGAITVSAQKAFEIIKELSDKPVELHLQDDFLMIKSGRSRFRLVTMPCTDFPGMPHNETD-----MRFEIEQKVLSKMIQSTAFAMSHD-ETRKYLTGGLFETQANVGFRMISTDTHRLNLIQIVMESQDIHTIVPSKTVIEMKKIAEEQGGLIEIGLSK-------RQVRLQCGGYTLISKVIDGTFPPYQDVIPTGHPYEVNVNCKNLDKALRRCMIVA-NEITHDLCIQFTQEGLHISAHNNEQEQSEEFVEA---KGSEVEIGFNGRYLRDVLNVLGSEEISINYRDELSSILLSPVGQDGEKYIVMPMR 365
101 0.000e+00UniRef50_A0A2E9WM43 Beta sliding clamp n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E9WM43_9PLAN  ali  14  2..............QTLRGAVSAK-TTLPILENVLLDCRSDRIEMSATDLEVGIRTIAYGDVE--EPGILTIPARKLAEVTRELPEEDVTFTVDGSQVLIECADVTYLMFGLPADDFPRIPEL------GEGYITLDAAVVGQMIDSVRTAVST-ESARYSLNGVYIDVSP-EWLRMVATDSRRLAIANLDAPGSRRSAILPTRAAEGVLRAFVDTKE--------VRLALMENQAVFSDGEITLTGRLIDGEFPAYERIIPRHNPIHVVAGREEFLTAVRRVSLFS-DPRTLSVRLDIADHSITLSAHSEDFGEAREAIDAVVP--ERITLGFNAKYLTDALSSMDSEQVRMELKEPLDATVFRPVDGDDYAHLIMPMR 349
102 0.000e+00UniRef50_R7KLZ0 Beta sliding clamp n=1 Tax=Sutterella sp. CAG:521 TaxID=1262977 RepID=R7KLZ0_9BURK  ali  20  4..IKSPREAFATPVQAVSGIVGKQRQTLPILSNILISKVGTRVDFTATDLDIEIKTFADIGAEGP-DISVTVDAAKLQSLISALNHGEVTLSQSDPTVELKQGKSTFKLNTLPADEFPNRP-----EAQFTQSFAIPANQIRHLLQLVHFSMAQ-QDIRYFLNGMLLSV-EGDVIRVVTTDGHRLAYCEGKLESQNIQCIVPRRTVMEMLRLIPDSDESITIAISEAE-------IRITWGNITLSSKLVEGKFPDYNRVIPVNNTNIFVIKRDVLLGALKRTAILA-NAKLRGVKWELKNNTLTIQSTNSDQEEAKDVLD-IEYNGIDIEIGFNLLYLQDVLNNLRSEEVQFALHSNTGAMLVTMPDNSSFKYVVMPMR 371
103 0.000e+00UniRef50_A0A1G0HI20 Beta sliding clamp n=1 Tax=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_41_15 TaxID=1798282 RepID=A0A1G0HI20_9GAMM  ali  19  1MKIQIDRDTLLQPLQTVIGVISVKPSL-PILSNVLVNIKPQKLTITGTDTEVELVGH-AITPLPDTDVLLTLPGKKLADVLRTLPENPIELYQQKERITLTSGKSRFTLSTLPAEDFPSF-----DKNSCQYSFDIPQNKLKNLLTQTQFAMAQ-QDVRYYLNGILLEFNPD-HIKAVATDGHRLAYACIEFNTQRSQIIVPRKAATELIRLLQLTEDTVRLDIGTHFIDVTGS-------GFNFTSKLVEGRFPDYNRVIPKNNQTKILINREFMQNILHRVAIVSGE----SVRLAFKPNMLHAYAETKT--ENAEDDLIIEFSGEPFNIAFNTHYLLDAINNIQSEEIEMCLAGPDASALITEPGKLDVQYVVMPLR 362
104 0.000e+00UniRef50_A0A098EGW2 Beta sliding clamp n=32 Tax=Anaplasmataceae TaxID=942 RepID=A0A098EGW2_ANAPH  ali  18  11..FSISREDLLQALNYVSSVIERRNSIA-VLSCVRIEAKGSVIEFTSTDLDISIEACVQANV--ATEGVAVASAQLLYDIVRKLSGEDVRFKLNDGKLLVACGNARFYLHVISPEKFPDI-----EGSSLDCGFDIPATSLAELLNKTKFSMSV-EESRYNLRGVYFHV-DDEMLCCVATDGHRLSLAKISKPEGLHSVIIPRKTVNEVLKIIGHGGGDAAQMVS---VGISNRKICFRYKGYFMVSKVLDGTFPDYAAIIPTECGNSVSIDASVLQSAVDRVSVVVFD-KVKAIKLSFTEGKLVLSSASSDQGDASEELS-VDYEGDEVVIGLNARYLMEVLGSIKG-VCEIVFSDGSAAVLVK--DGEYGMHIIMPMR 374
105 0.000e+00UniRef50_D6GSV8 Beta sliding clamp n=1 Tax=Filifactor alocis (strain ATCC 35896 / D40 B5) TaxID=546269 RepID=D6GSV8_FILAD  ali  22  2MKFTVNQREFSDALAIASKAIISKTPLD-ILKGFYLEAYENELTITGNNLEIGIRTSIDAAVET--EGKSVIDAKILSDIIRKLPNEEVTVSIKDGNVLLQCQKLKFTIKEMLDNGFPTVDELEEAVYQN-----IHPAILEEMIKKTHFAVTTD-ETKPVFMGELVEL-EDNQMNVIALDGFRLAYKKCELKSSSRSMIIPGKTMVEIMRLCQTMEEDVKIGIED-------RHASFLFGRTLVNTQLIQGEFSKYEEIIPKEFSTKIKVNRQKFIDALDRATLVS---KNYLVKLRIQNDELLITAHDNEVG-NLEEILDVELEGKNLEIAFNIRFFLDSLKVMEDEYIYMNFNTNVSPCIIKPEFETDYTYLVLPVR 362
106 0.000e+00UniRef50_A0A2N6AKS5 Beta sliding clamp n=1 Tax=Ignavibacteria bacterium TaxID=2053306 RepID=A0A2N6AKS5_9BACT  ali  19  1MKFTAVSSDLHKALSKIISVVPSKSTL-PVLENILFELTGNDLRLTASDLEISMAVSM--QVEGEADGKVAVPAKKLNETLRALTTRDMTFTADDNRITLKTDQGEYKMAGESASNFP-----EAEAVQEEFSLQLDPDLLRGIIARTVYAVSTD-DLRPSMMGVLFQWK-GEEFFAVATDGHRLVRIKEANTEGNRDVIIPAKALNIVSKSLGD---------GEVNVVFGRTNVRFTFGEMSLLSRIIDERYPNYESVIPLDNDKQLTVSRLALISAVQRCSIFS-NAITNQIRFSVSKEELRVSAEDVDFGEAREAVPGAFSADDDLEIGFNARYVNEALQHLSSEEVDFYFSAPTRAGLIQPKEQKDILMLVMPLR 372
107 0.000e+00UniRef50_A0A1I1BQC6 Beta sliding clamp n=1 Tax=Rhizobium sp. NFR07 TaxID=1566262 RepID=A0A1I1BQC6_9RHIZ  ali  18  1MQLNISRTELARVVGAVGKVVEARNTI-PILSNILLEAEGGTLKVTATDLDIQATASAEADVQ--KAGTTTVSAKLLGEIVRKASAADISISLVDNRLEVKSGRSKFKLETLPASDFPDI----LGKGTFDAEFDID---LAGLFAPVAFAIST-EETRYYLGGVYFHVVDGKAV-AVATDGHRLARNRGPVVPEFAGVIVGRKTVGLLPK-------------GEVTVSVSQEKIRIQHADISLTANLIDGTFPDYQRVIPRDNDKIITVNRDEMMKAAERVVTVSS-EKGRSVKLSIAPGSIALAARS-DAGEAEDEV-AAEYSGEPFYVGFNSQYVRDLFNVLPAGEVTMALSDGGGAAVITG-GLAGWDGVLMPVR 351
108 0.000e+00UniRef50_A0A1V6EJA1 Beta sliding clamp n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A1V6EJA1_9FIRM  ali  22  1MNFTCTRKKLQDAVNSVSKAISN-NPIMPVLGNISIKAKDSQIIFRGYDLEIGIEHIEDAFIK--EEGEILVNARLFSDIVRSLGEEEVEIFTEDSKLVIISGNAVFNIRWLDPAAFPKLPYVEKD-----NKVTIKTEYLKNMIRNTLFSVSTN-EQRLILTGALFE-SEENSFKMVTLDSFRMSMRKEYINKEEFNFVIPGKTLNELLKLITNDDEDIKIYYEK-------TQVLFEFGNCKFISKLLQGDYFNYKAIIPKDFATKIEISVNEFRNIIERNMLVSDDGRKAPLILEISEN--ILTANTQEVGNVTEKC-HIKKEGKDIRIGFNARYLLDAIKSIDEDKVRISFMGETSACIITPLNSDEFLYLILPVR 364
109 0.000e+00UniRef50_W4LNF6 Uncharacterized protein (Fragment) n=2 Tax=Candidatus Entotheonella TaxID=93171 RepID=W4LNF6_9BACT  ali  16  1...............................................................................ILRELPAGEVTLSVEQGWARITAGKAAFKVPCLPAEEYPALPPVDEGDFSA-----ISFDTLEEMIRHTTFATSHD-ETRYTLSGVLV-VSDGQDVTMVATDGHRLAHVKREMPGKELRVIIPRKALEEVDRFASDSDSK------EISLAPLENHLVFQRGQATLVTRLIEGQFPDYEGVIPKDFSRRALVEHDHLLRALRRVSLLS-NEKTRPVKIEFDKERLTLRSNTPEMGEAVEEIPA-EYDGEPMDMGFNARYLLEALAVMSSEQVAIELNDPLSPGVLRCHGDEDYFYVVMPMR 289
110 0.000e+00UniRef50_A0A2M6R916 Beta sliding clamp n=1 Tax=Candidatus Berkelbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_43_14 TaxID=1974515 RepID=A0A2M6R916  ali  15  1MHISCMQENLAKGVSAVSRIVGVRSTL-PILSNMLLSTDKGRLKIAGTDLEIALVVFIGAKVE--KEGSITVPARLLADFVSSNQDKTINLLVENTQITAKSDHVTAHLHGLDAEDFPLIPDVTSDE-----SYQIKPSDLKEVINQVVFATALD-ETRPVLTGVLCVIH-GSTLTLVATDSYRLAERTIPLMKKDVSCIIPARTLSEVGRLL-------ELSLESVTLTIAQTQVSFSFGNCTLISRILEGTYPDYEQIIPKKATTTAQVSIGALQSALKLASSFSRD-ISHNIRIVFIPDSTTISATSANMGD-TSNTVEGTTTGETLEIACNAKFILDILAVMPGDSVTIKCAGKVSPLMLIPSSRVDYRTLVMPLK 365
111 0.000e+00UniRef50_K2CXM6 DNA polymerase III, beta subunit n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2CXM6_9ZZZZ  ali  15  1MKFSCTQENLKHGLLIVSR-VASKNANLPILQNILLKASDGVVTLAATNLEIGVQVRVRGKID--EPGVFTLPAQLFTNYVSLLSTERIDCVLTGKEVHISANGQTTVVKGEEATDFPILPDIEQ-----TNSYRIAKGDFELALQQTSIAAAVD-ESRPEIAGVCLK-TKGGTMTLAATDSYRLAERTTTLLNGDGEVIIPQRSAQELLRLLQST------IAEEVTFYVNDNQFACRFADVEFVSRLVEGKFPDYEQIIPRSGQTTAHLSKEEFMKAVKGAALFSKTGV-NDINLTFSDQTVQIQAANVQLGQNTTTQPA-KVEGGEVTITFNYRYVLDGVQNMAGAEVKCLLNSTMSPALFQSASDDQFAYVIMPIK 366
112 0.000e+00UniRef50_A0A2S0KPL0 Beta sliding clamp n=1 Tax=Fastidiosipila sanguinis TaxID=236753 RepID=A0A2S0KPL0_9FIRM  ali  17  1MKIVCSKSQLDMAINHVQKAVSVRSTLS-LLDSILFVAKDNEVHLTGYDLETGIEVRFEADV--IQEGEILLNAKMIAEIVKKLPDETISISSDSQTTIISSGNSQFNVKGLDASDYPQLPEIDANE-----KLTIPQSMFKEMISQTIFAVSTD-ESRPAFNGALLN-SNSNVVELVAIDGFRLAVRVEELDYDDVKILIPGKALKNIQSILGDN--------GDLELYTTQNHIKVNVGEVTLISRLIQQDFMDYHKILPNTYSTRIEINTKDFYHAVERADLILPNQDRRPMSLKFTGSQIMNVTATTNVGNMEDGVELNYFDGDELEIDFNQRYFLDALKVINDENVTVEFNGPVGPCIIQPVEGNYFTYLILPLR 366
113 0.000e+00UniRef50_A0A0G1WX46 Beta sliding clamp n=4 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G1WX46_9BACT  ali  18  3....CTKKNLIAGLQTTSRVIGG-VTSLPILNNLLLKTDQGRLRISGTNLEMAVNTWVAGKVE--EEGEITIPAKLLSEYVYNLAADKVNLVSEKLTLKVEGEKTETHIKGLPAEEFPLIP-----DTGEKIFVRLDGGGLKKGLSEVSFAAAYS-EAQPEISGILFRFS-GKTLELAATDRYRLAETRVGLEAEEKALIIPARAVGEIGRILGE---------GVVEVYLREGQVCFKNSDREIITRLIEGQYPDYKQIIPAKFTTRAEFDRHALGQAIKAVSLFATD--SNNIEFELLPGKLIIAAASAQVGDSKIQVPG-EIVGEKNKIIFNYRYLLDCLNTLSDERVVLQATNETTPVAMTPKGRDNFLYIVMPIK 360
114 0.000e+00UniRef50_A0A0G1CDU8 Beta sliding clamp n=2 Tax=Candidatus Giovannonibacteria TaxID=1752738 RepID=A0A0G1CDU8_9BACT  ali  18  1MKLTCDKNEFQELIILAERN-SSKNPSLPILSAILLKAEKNKLTIISTNLEVGFEAYLP--VKITKDGEAAVSGRVLLSLLSSMPEEPILLEKLENTLKISSKNSSTTIKCLPHEEFPILPKI-----SDGDYFLIKSTILAKSLASTVIAAAITN-TKPELASILISAQQKTPVIFAATDSFRLAEQRTNIQTKPFNLLLPQKTAVEVMRIFQDLEEDVAMRFNK-------NQISFSSKYLCLISRLIDGKFPDYQGIIPKQFSTQAVLDKNSILGSLKAASVFSSKLSDVGIKAEPKDNIIEIKASSSETGEHKSQISA-KISGDAIQATFNFRYLIDAVSHLRDDKIFLGFNGPDKAILVRPEKDTAHLHLIMPMR 363
115 0.000e+00UniRef50_A0A1Q6S3H5 Beta sliding clamp n=12 Tax=root TaxID=1 RepID=A0A1Q6S3H5_9FIRM  ali  14  3.RFSCEKALLQSAVNTTSRAVAAKSSI-PALEGILLE-GGDTLTLSGYNMQTGIRTIVDAQVQ--SPGRIVLSARLFGEMIRKMPDDVIVFAADENSVHLTCGDASFEILGLSADDYPELPEVD-----DQFSVDIRQGTLKAMINQTSFAVSTN-ESRPVHTGSLFEVGDQD-LTVVSVDGFRLSLRREPLEGGAFKFVAPGSALNEVEKICEDSDEKVTIIQGK-------RHLLFEAGATQLICRRLEGEFLDYKNAIPRNNPIRLTVDTKTMLGSLDRVSVVISEKLKSPVRCVFENGRVLLSAKTG-AGEAKD-ICPLDGDGNGLEIGFNNRYLMDALRYAPADSVSLELNTSISPAVIVPADEESFLYMVLPVR 366
116 0.000e+00UniRef50_A0A1V5J9R8 Beta sliding clamp n=5 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5J9R8_9DELT  ali  18  1MQININRSILLDGIQKTLGIVEKK-TTLPILNNILLKTGKNKLKIIATDREISLISDYEADIK--ESGEITIAAKKLYEMIREIQGEIVNIVCSNNITKISCQRAMYKIPGLPAEDFP-----DVTDERNIQFYNVKGSVMKDLISKTSFAMAMD-EMRKNLNGVLLEFSDGNILKMVATDGHRLALTKEPLLDTGKGIIIPRKGLMEIKKLV-DEEENVKIGLSK-------NMFVVKTENTVLKVSLVDADYPDYKRVIPTEKGVSIVLDKESFLHALKRMNVVSS-ERYGGVILSFSEGKLTLNSTNLDVGEATEEID-VSYSGEEVDVGFNVNYLIDAISVIDREKILMEVGLGIKPSVIKQTEGDDYLCIVMPLK 368
117 0.000e+00UniRef50_A4F5N3 Beta sliding clamp n=68 Tax=Bacteria TaxID=2 RepID=A4F5N3_SACEN  ali  17  1MKIRVERDGLADAVAWVARSLPSRPPV-PVLGGVLLDASSGELTISGFDYEVSAQVTIDASIDST--GRTLVSGRLLADITKALPNRPVEITVDGSRVTITCGSSRFSLPTMPVEDYPELPAMPDHAG------SVPGDLFSEAVSQVAVAAGKD-DTLPMLTGVRMEI-NADRLTMVATDRFRLAMREFTWEPEDTSVLVPAKTLSDSAKTLGTGGNKVEISLAS-----GDGLLGLSGNSRRSTTRLLDAEFPKYRQLLPSESAVTAVVDVAPLVEAIKRVSLVA--ERGTQVRLEFSDAGLRLTAGGDDEGSAEEELP-VELVGEALTIAFNPAYLLDGLGALKSDRAQMLFTTSNRPAVLKPVGEDGYLYLLMPVR 371
118 0.000e+00UniRef50_H1XV75 Beta sliding clamp n=1 Tax=Caldithrix abyssi DSM 13497 TaxID=880073 RepID=H1XV75_9BACT  ali  18  1MEFTIERSEFLAALQRVINVVPTK-TTKEILYNVLLIAEDNQLKIIATDLDITQISWARASVS--EEGAVAVLGKLLLDILREMPEIEIKFHVEENRVQMETSMGHYKLLGEPRTEFPSVPMVDKE-----NSISLPNDKMKKMIERTIFACST-EPARPALTGVLCQIFEEEY-RMVATDGHRLVRKNFQNPGFTKQYIVPTKALNFVARNLPEE--------GQHQLFISNDHILFELPNTKIYSRLITDPYPDYERVIPDYFQKEMIINREDLIHSVKRVSLFA-NPMTYQIRLQINPDNVTIMAQDIDFGEASETIP-CRFDYEPLLIAYNANYLLDLLRHMDAEQIRVMVEDADGPGLLFPEEDEDILMLIMPVR 368
119 0.000e+00UniRef50_A0A1F4XLA2 Beta sliding clamp n=1 Tax=Candidatus Abawacabacteria bacterium RBG_16_42_10 TaxID=1817814 RepID=A0A1F4XLA2_9BACT  ali  20  1MKFVCSQENLTQALDIVTRAIPTRSTL-PVLGNVLIKAEEKKVILSTTNLELAIVTSFDCNPE--EIGSITIPAKLFSSYCNLLKVEQVTVEQLPNTLQVKSGQDETVFKGIDAQEFPLIPQVEEK-----IEFTLPFESILDGLEKTVFASASD-ETRPVLAGVLFWQKDG-ILKLVATDSYRLAEKTIKLATEEIKIIVPSRTVLELQRILSKKQEEVKVIVG-------QNQVKFIIDNVTVISRLIEGNFPPYEKIIPESFSSDITIEREEFIRAVKRVSLFSQAG-THNLHLEMDGGDLTVSGETQEVGK-DTSILKGKMNGEGKKITFSAQFLLAALEHIPEENITLNVNSDTSPGLLKGKE-EGYINIIMP.. 362
120 0.000e+00UniRef50_A0A2H0Y2D4 Beta sliding clamp n=1 Tax=Candidatus Peregrinibacteria bacterium CG08_land_8_20_14_0_20_41_10 TaxID=1974783 RepID=A0A2H0Y2D4_9BA  ali  22  2MKVTCSQKELENALNIVGCAIGSNNTL-PVLDNVLLKAEGKKLYLAATDLEIAIECYIDVTVKN--EGIITIPAKLFSNYISFLKEESIDLSLEAGVLSIKSKSSHTKIKGIAATEFPLIPKIEKE-----KTIEVPANLLIEGINKTIFACSTNI-ARPVLAGVSFK-TEGKKLILATTDSYRLSESQIGLDKEEITCIIPAKTMVEVGKVFPKNKEMIIIQLSS-------NQIVFNQDGIILTSRLIEGQFPDYRPIIPKGIKTKAILNREELIRAFKRVNLFAKENNYN-VKLEINPGELNITTESTEIGEEKAMVQAV-VEGEEKTVALNSQYFIDVLINLDKEEVELQIESKLTPAIVISKGEKDYLHLIMPLK 367
121 0.000e+00UniRef50_A0A291QRI3 Beta sliding clamp n=8 Tax=root TaxID=1 RepID=A0A291QRI3_9BACT  ali  22  1MKFIVSSSTLLKQLQQISGVINS-NTVLPILEDFLFSIEKNELTVVATDLETVMKVKLE--VEAKENGRICIPAKILMDSLKNLPDQPLTFNIDLNSVEITSDNGKYKVMGENPENFPKEPAAE-----DATSFTMTATGLITAINKCIFAVSND-DLRPAMTGVYFELAP-TSLTFVATDAHRLVKYVKTDVQQSDSFIVPKKPLNLLKAAIPDNDTEIRIAYSK-------NHFFVTHDNAQMICRLIDARFPDYKVVIPKENPYRLVVNKTDFQNALKRVGVFA-NKSTNQVALSITGSELQLSAQDVDFSEGNERMS-CQYSGEDMQIAFNAKFLIEMLHAAEGDEISMELSTPTKAGIIKPSENEDLLILVMPL. 368
122 0.000e+00UniRef50_D5H4G9 Beta sliding clamp n=57 Tax=Bacteria TaxID=2 RepID=D5H4G9_SALRM  ali  14  46MKFTASSADLLEALNTVKGAVPSKSTM-PILECILFERDGDTLRLSATDLEISIIQTVP--VQFEKNGTIAVPAQRLIDTLRALPDLPIEFAADSDEIRMDTDQGHYKMVGHDGSDYPELPELE-----EQHEINVEGGLLGRSIDKTAFAVSQDA-LRPAMMGVYFQVSEEET-SVVATDGHRLVKLTLPEADTSADFIVPEKATKLAGRIVEDDE--------ICTVRVDDSHVSFEFGESRVLARLIDETYPNYQSVIPDGNDRNLVVNREDMLNAVKRVGLYSSS-MTNQIRLDITADTVTISAEDVERSSEAEETIHCDYDNEPMEIGFNSEYLTEVLSNVECDEVVFELSSPNRAGIVLPADDEDILMLIMPV. 416
123 0.000e+00UniRef50_A0A179D6Q8 Beta sliding clamp n=1 Tax=Thermosulfurimonas dismutans TaxID=999894 RepID=A0A179D6Q8_9BACT  ali  17  1MKAIVDKERLLKVLSRIQAVADKKSSMA-ILSTVLVEGREEKLTFSATDLEIGYRGTLVSDIEG--EGAFCLPARKFYEIVKSFPKENVVIETDGEGVVVRDEDLAYRLAVFPAEDFPSLPEISGEAM-----IDIPGETLEEMIEKTIFAAST-EEARYALSGIFVTREGDDKLRMVATDGHRLSLIDREVPGVESGVIVPRKAAQEMKRIAADE--------MVVRIGVRENHFLLASSEGMLMARFIEGQFPDYRAVIPQESGRVVVFDRAKLSEALKRVTLLST-EKYKVVRFEFSPGEVVLIGTGGELGEARERL-TVAYEGEPFTINFNARYLLEVFNVMASEEVELDIGSERTPCRITGSKDEGFMALVMPM. 368
124 0.000e+00UniRef50_A0A1V5VFG5 Beta sliding clamp n=1 Tax=bacterium ADurb.Bin236 TaxID=1866925 RepID=A0A1V5VFG5_9BACT  ali  17  1MKFFCSRDKLIKNLQIAQRAVDAKSQAA-VLRNVLMDASGGKLNLVGYDHRMGIRTSIDCQIDT--EGSITVPCALLIDILGVMQEEQVYFTLEDSSMKVECGRSKYNLSCISADDFPPFPKIEGKD-----TFEMEAGVLETGIRQTIFATNPD-DHRAFMGGVLLNL-EKNEIKFVSTDGHRLAMRKFDVPGPTQKVIIPTRTLNELLRILPDAGEE------KVKVTVDVKSISFTLDGVFVTSRLVEAEYPKFEKVIPTRAEGQCRINRTRMIGSVRGASIMARSKENRLIEINVTDDSIKFTSSTQDVGSASEELEVVK-KGKDIRVAFNSKYILDFLGAVEEDEVVFDYTEELDPGLFH-TDMPGYTYVLMPIK 366
125 0.000e+00UniRef50_F4XUM5 Beta sliding clamp n=4 Tax=Moorea TaxID=1155738 RepID=F4XUM5_9CYAN  ali  16  1MKLVCSQSDLNTNLSLVSRVVPSRPT-HPVLGNVLLEAKNQRVLLTAFDLSVGIQTSFNADVETG--GEITLPAKLLNDIVSRLPSGEITLEDDGTIVTLTSATGRYQVRGMSSEEFPELPEVNT-----SVAVHIPVEVLKAGLQGSLFATSSD-ETKQVLTGVHLTVQSDK-LEFAATDGHRLAVVETNRTIEELEFTLPARALRELERIVSKAEAQDIIAI-----QFEPGQIVCQGGEQLLTSRTLEGQYPSYHQLLPKHFERQLILDRRQLLSAVERIAVLA-DQKNNIVKFNIDNQRLHLSVEAKDLGSGRESME-VEISGDSLEIAFNVKYLIDGLKALSTSEIKMQMNEANSPVIFMPLGGLKMTYLIMPV. 389
126 0.000e+00UniRef50_A0A2M9S2I0 Beta sliding clamp n=7 Tax=Rhizobiales TaxID=356 RepID=A0A2M9S2I0_9RHIZ  ali  16  16..FAIERGALLPALAAVNRAVEKRNTI-PILGNVLLKVEDGHLCVTGTNLDIEVQAV------AKQEGPFTVQSGLLHDAVKKFADGMVEFEGDQTHVNIKSGRSRFRLQVLPASDFPEMAVDD-----FTHEFSIAGSTLARVLATVGFAIST-EETRYYLNGVFMH-RDGEHLAFVATDGHRLALMKLDAPAGSPGIIIPRRTVALLQH-FAEGDEDIVLKLSERKMRIVLP------DGTAITSKLIDGTYPDYQRVIPTSNDKSYTVDRTGLADAINRVSTVSS-ERGRAVKFSFGQSELKMEVNNPDSGQAEDSIVISEGHDDEVTIGFNHKYCLDVLGAVSAKEMRFELSDPGAPCKVSPAEDDDVLFVIMPMR 384
127 0.000e+00UniRef50_A0A1G1C9T1 Beta sliding clamp n=1 Tax=Microgenomates group bacterium RIFCSPHIGHO2_01_FULL_45_11 TaxID=1817749 RepID=A0A1G1C9T1_9BACT  ali  17  1MKVILLPENFKKAISYGERFVATKPQI-PVLGNLLFQAKEGQFFVAATNLETGIKFRIGAKIEG--EGAVTVPARVISELVASLPTEKVFLSVEGEELSIKCGRFTATIQGLTGAEFPVFPKKDK-----GLTLEVPTTFFQEVVERVGFAASSD-ESRPVLTGILFNWQ--RRVRAVATDGYRLSLMEADLGEGEVKTLLPARSLSEVERVLSDLGEQTI----RLTWSLEQRQMFWTTGDLEVVVRALEGDFPDYQGIIPGEGETIVEIDRNELLQAVKLAAVFARD-SANIVKWRFTKEGLEISARSSQVGTNITTVGVDYHKGNSGTIAFNSRYLLECLSRFREERVRFEMTEALRPGVFTGVKSKEFKHIIMPVR 371
128 0.000e+00UniRef50_A0A101E9X8 Beta sliding clamp n=1 Tax=Clostridia bacterium 41_269 TaxID=1635275 RepID=A0A101E9X8_9FIRM  ali  19  1MHIICQQRDLQNAVNSVYRAVASQSTI-PILTGILLQASKEKIYLEGTDMELRIKYGLSTQVK--EEGKAVIPARYFVDLVKRLPDEEIELENDGKRLFMKYGDSIVKLNLFEVEEFP-----EDEKEPVEYNLAVDPLLFSESIKQVSIAVAKD-ESRPIFTGIHLELSEEKFLTMATTDSHRLTLKKVKLNKDLSEVVVPSRALNEAARLMGEAQEEIKIGFTE-------TKACFKCGDVVVQSQLIDGQFPSFRDVIPESYKTLVEVEIGSLYDSLSRASLVSYGEGKGIVRINIKDNSMSIFSFSNDVGEVMEFLPLLKKEGEDLEIAFDARYLLEVLRVLNSETARIEFTGPLSPAVIKPSEGDSYLYLVLPVR 374
129 0.000e+00UniRef50_A0A2N5KQ29 Beta sliding clamp n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A2N5KQ29_9ACTN  ali  18  1MRAVCNTEMFGKKLALVSRGVSARSTIQ-LLGGILLEADAGELRLSATDMEISIQTTSPA--EVGEEGRVVVPARIFNDVVRSLPGGEISLVHDEGVVRLSSRENEYQIRAYAAEDFPNLPSFD-----ERSAFKMSAEVIVETVEKVSKSYSRD-ETRPVLTGILVSFEES-RVKMVTTDSYRLSIKETELATNERQAIIPARAMQEVSRISSASGEE------GVEVILSENQALFRIGDVLFGTRLIEGNFPEYRRLLPNVFEREISVDREELIGTLRRVNLFAQRQTPVPVSLAFTEGAVEVSVRNGEVGEAREKLPSNAAGEEEFRISFNPTYLIDGVTAVDSEKVRFKLNESLKPGLIVPEDEPDFLYLIMPMR 377
130 0.000e+00UniRef50_A0A077DAM5 Beta sliding clamp n=1 Tax=Basilea psittacipulmonis DSM 24701 TaxID=1072685 RepID=A0A077DAM5_9BURK  ali  19  4..LKTSKESILKPLQTVAGIIENRSA-KPILVNVLIEKKGGQLSFLATDESVQIKTH--AQILGDSEMATTVAARKLLDILRALPDGDVSLEEEGGMIVVKSGRSRYTLQTLPSMDYPVVKQPENWTL----SFAMPQRILCKLLNQVHYAMA-EKDIRYYLNGVLLEFK-GNVLTAVATDGHRMAKSVAVVEGADHSIIIPRKAIHELQRLLDESDELVTVGLTD-------SQISLSFGDVEIVSKLVEGKFPDYSRVIDTTYEISIHINREELLGALRRSTVLADKKDQKGVKLHFENNMLRLQAHNSEQEESMEEV-AIHYEGVPIDTAFKSSYLQDVLAMAKSEEVVWTCQSSGSSSVITIPQDDTFRYVVMPMR 372
131 0.000e+00UniRef50_A0A2M8PXX0 Beta sliding clamp n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8PXX0_9CHLR  ali  17  1MQVSVLQEHLAKGLDTIARAVANRPSI-PILSNVLIATEDGRLKLCATNLELAITARLGAQVDA--NGETTVPARLLTDLVKSLPSQQIDLRLEGNKLKLHCNGSHWELPTTRASDFPNIP-----ELPERPSAVVPADVLSKLIDQVVFSAAK-EDNRPVLMGVLTRF-EGPRASMIAADGYRMAMRRAELNNEALTLLIPATSLSEVARIIRSEDGDVHIAV-----MSGRNQAIFHHKNVDIVSQLIDGKFPEVEQLIPKQAATSTRLDLPDFLAVCKRAEIFARD-ANGITRFKISSGEVLVSAQASSGGGGSERLPA-EVTGKDIDIAFNVRYLIEVLSVLETKRFVLETNNANAPGVVRPVTDPSFVYLVMPM. 371
132 0.000e+00UniRef50_UPI0008343944 DNA polymerase III subunit beta n=1 Tax=Christensenella timonensis TaxID=1816678 RepID=UPI0008343944  ali  17  1MQFTCTKTNLLTAIGTVNRAASKMQKT--ILECILFSCSEDGITLKATDIALSIKTEMEAQVE--KTGDAAIPARLLYEIINRFPDSDVSFSINENSVEISCLNSKVVLQQMNPDEFPVFPVLEQNE-----QIKIPQNILKSMINQTIFAAAINED-KPILTGLFFDIGKD-SLTIVALDGYRMAVRKQQAISDEKNCVIPARTLREVSRIIDDTEENIKISIS-------GNMALFEANHTQIFTRLLEGEYINYRNLLPKDCATSVKVETGMLKDSIERASILAREGSNNVVKFEIREKNLDITSNS-EMGNIDEKIPVIT-EGNDLKIAFNAKYVLDVLKCVEEPEILMQYNTGVSPCIVKQENSDIYEYLILPV. 361
133 0.000e+00UniRef50_A0A2E5IZH5 Beta sliding clamp n=33 Tax=root TaxID=1 RepID=A0A2E5IZH5_9BACT  ali  18  1MKFTCTKENLIKGLQITSG-IASKPSNLPILSHIHINATDSGVELVSTNLEIAIKSYIRAKVEN--PGTFAIPAKTFLDYISLLHEEQVHIELEGAQLIVSTSTSSTKIKGCSADDYPVIPEIE-----ETHAYTIVAEELKKAFTQVVFSVAKN-EIRPELSGVYCSFENNPGLILASTDSYRLTEKKVSVDGDDFTCIVPGKTIGEFIRILG-VTLSKTGAESNVRLWASENQIAMRYGDFEITSRLIAGSYPDYTQIIPTDFESTAAVPGTVLINAIKAASIFTTTGV-NAVMFDIDSGLLRVSSVSTQTGEHTTSVDAIVVGGTN-AILLNHKYVLDGLQHIGADDIEFKMNGPDAPCVFKGKERDDYVYIVMPIR 374
134 0.000e+00UniRef50_A0A2M7SK60 Beta sliding clamp n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M7SK60_9DELT  ali  20  1MEIIIKRDDLLKVLLKTQGIVEKRNVMS-ILENVLIDAKTDRMDYAATNLEVGIYG--NCEVQTIKEGGVVLLAKKTLEIVRELPEEKVSLKLKEGSIEIVCGKAVFNLIGMDPKEFPSLPTHEDVNL-----FPVDIDKIREMIKKTIFAASLD-EKRHNLNGVFFE-KTGKTIRMVATDGHRLSMMEKEDIEMEKGIIFPRKGLNELKRILEEDKDSKKVYIG-----IKDNNCVFKIERLSMVMRLLEGEFPDYRSLIPKDNDKRFVINKSRFINSLRRVSLIS-EERLKPVKFYISTGKIGLRASNADYGEAYDEME-LDYRGPDLMIAFNAGYFVEALNVLDGEEVLIELKDALSPTVLKSSNSSHISII-MPMR 372
135 0.000e+00UniRef50_A0A1I3MVS1 Beta sliding clamp n=2 Tax=Ruminococcaceae TaxID=541000 RepID=A0A1I3MVS1_9FIRM  ali  17  1MKIKCEKNMLCEAAAVVSRAVSSHSSI-PTLEGILLRCSAAGMELFGYDLDTGISTRIDAQIS--EPGEIVLPAKVFLDIAKRLDDEFITISTGEKCLTIKGGKTEFTILGMPADDFPEFPTI-----GDVTDFELPQATLKSMIDQTIFAVSQS-DAKPVHTGSLFELEEG-SLSVVSVDGYRLAVRRERVAGGELRFVVPGRALGEVSRVLDEESDD------PAGMQISKKHIIFHIGDYQIFSRLLEGEFLDYHAAIPSGESLTVRINTRALIDAVERVSLLISDRIKSPLRVKFYEGGVDLSCSTA-LGRANDTISAA-IEGKALEMGFNNRYLLDALRAAGCDEVLLQINSPLSPMKVVPTAGDSFVFLVLPVR 364
136 0.000e+00UniRef50_A0A163WSN3 Beta sliding clamp n=3 Tax=FCB group TaxID=1783270 RepID=A0A163WSN3_9BACT  ali  15  3.KLLVSQAELLKGLNAVAAAVPPR-TNLPALTNILVEAGHDQLKLAATDLDTTITTS--VAATVTTPGAVAIPGRKLHEIVRELPEADVHISGTGNRISINCGESSFIIAGSARDSYPELPS-----KVDASSTTIPLPVLSSAIRRTSFAVAR-EDYRPALNGELWKLGP-EGLEMVATDGHRLARIHLEDVTSFFEAIVAPKALGLLARMAEE---------GDVSVSFQGTQMSFEFGTTTIFSRTIEGPYPPYEKVIPHDNDKTLTISREDLNSALRRMRIIA-NPATHQVKLSLESGNILVQAENADAGEAKEKLEG-EYSGEAVQVGFNADFLMEILKNMTGDRIVMKLKNSSSAVVLTPEQGVSHLSLLMPVR 365
137 0.000e+00UniRef50_A0A2H0TIN5 Beta sliding clamp n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0TIN5_9BACT  ali  17  1MKITILKEKLKEGINIVER-IAQKSLTLPILNNVLLKGEKTFISLITTNLEIGLQWWSLAKIE--KEGEIIIPARLFSSFINFLPEGPLEIETDGSFLNIKSGEYRSRIKGFSPEEFPLLPQVGQEE-----KVELDSQVFCQALSQV-FDIASPSLARPEISGIFFHF-QKEQIKIVATDSFRLGEKKIFSQTKEYSFILPQLTAREIVNVFSEKEGDLRIYFSPNQVLFESMLSETDHPQIHLISRLIEGDFPDYQAIVPKKYETQIVLSKNEFLNQIKSASLFS--GKISEVKLNISKGKVEIFSQNPDLGEYQSALSG-KIKGKALSVSFNHRFLIDGLLKIKSPEVIFELTSEEEPAVLKPVGDEGYLYVVMPIK 372
138 0.000e+00UniRef50_A0A0G1Q5C1 Beta sliding clamp n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1Q5C1_9BACT  ali  15  1MRFSCTQENLVQGLSMVSR-IASRAGNLPILSNIYLKTTATGLELRATNLEIGLTCMVRGKVE--EVGEFTVPARLFSEYIALLPKDKVDLVLAGSELQVVCGKNKTKIKGMPAVDFPVIPQVENGEGGE---VSLPA--LMEALEQVLFTISPN-EGRPEISGALI-VLDGSHLTVAGTDSYRLAEKALITSGTDKSAILPLRALQELVRVCGSLKEE----AATAKIIMSSNQFALSVPTVEFVSRLIEGQYPDYKAIIPTRFGIKAKISRAELASALKAAGLFSKTGVYVAVSFNPEKNEVEIASLNSQTGEHASVLPA-EVQGVGTKIAFNWKYLLDGVQALRGENIIIKATDSASPTMLTEEDGTDYFYIVMPIK 369
139 0.000e+00UniRef50_A0A0S8IZM2 Beta sliding clamp n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A0S8IZM2_9BACT  ali  17  1MKLKCGRATLYEAVQFAGALASTKMA-KPILQNVKMVGEKKQLDVLATDLEVGIRFRLE-NVEIARPGALAVSANRLLGILRESPDEQMDIEVQEHKCTLRGADSTFEMLGDDPADFPEVP-----EMMESAQMEVERSDFIEMVDKTVFAAA-SESTRYALNGVCFIFA-ANHVEMVATDGRRLAYIRRKAKGDTGSIIVPPKTLQHVRRILTEEDKSVGMKVDENR-------VLFQTSRALVSSVLVEGHFPPYKEVIPKDSDKKATVKREAFLGAIRRAALLTTEE-ARSVRMDFTKDLVVLTSEAPEAGKAEVKL-GLDYEGEKISIAFNPTFLTDVLRVISSDEVVLEMKDASRPAVVH--DGADYTYVVMPI. 362
140 0.000e+00UniRef50_A0A2M6W349 Beta sliding clamp n=12 Tax=root TaxID=1 RepID=A0A2M6W349_9BACT  ali  19  1MKIICTRENLANALSLIGG-VAGKNINLPILNNVLIKADSQKVDLVATNLELAITTQLRAKIE--EPGSFTVPAKTLFDFINLLSTETVELSVKENELEVASGKSATKIKGTPADEFPVVPSV-----SEGKGYVVDSHIFKRSIEQVSQSSSKN-DIRPELAGVFLNFDSKKSLVMAATDSYRLAEKTLNIEDQDTKTILPLRAAQEISRVLGQKEKNVRIVIND-------NQIVMRNDDVELVSRLVDGKYPDYQQIIPQNFNTEVEFDISQLVKEVKAASLFTTTGV-NAVDFVIDKDTTLISSASAQAGEHQSELS-VQVKGERNSILLNHRYVLEGLSNIDGQNCVLKIINGDSPCLLTSSEDKSFLYIIMPIR 373
141 0.000e+00UniRef50_A0A2E0L7U5 Beta sliding clamp n=2 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E0L7U5_9CHLR  ali  18  1MRVSVRQENLAKGLSIVGRAVENRPTL-PVLSNVLLNAEDARLKLAAMDMSLGITCWIGAKVD--EPGAITLPKNTLADLVNNLSPERVDLTLDKQTVNVRCGTTVSNIKGIDSSEFPLLPE------DGGGDVIVSGRTLKDMINQTVFATAK-EDNRPILTGIYTEL-NGNTLTMAAADGYRLAVRTSEIEAESFSMVIPGRALAEVARIISEEDDEIGI-----TLPGDRDMVLFHLKNVLVSSQLLEGRFPDFGGVIPKNYITQTVVYTSDLLRACKRAAIFARDSAGSQILIKPEPGEVVIAGRSNERGDNTGMVDA-SVEGEGLDVSLNVEYLIDVLNVIPDERVILQSNGATSPSVLRPENRDDFIHVIMPM. 375
142 0.000e+00UniRef50_A0A2E7UPF5 Beta sliding clamp n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E7UPF5_9DELT  ali  15  31MELYIERDQLIRGLARVQGVVERR-TTNPVLSHVLLSARGDSLQMTATDSALTLVADYPATVENA--GELSVDAQRLFQIARTLTDSTVHLSLSKNRLHIRCGKAEFNVVGSSPDDYPPVPTRD-----ERARLVVVGGDLRRLIEETLSSISAD-DNRYGLNGGHLEQQGDSRLRLVTTDGSRLSWSEAPFEGNFGRMLVPRKALGEVRKLVDLDESEWTVSFGQRS-------AAFSTEGLTLMLRLIDGEFPDYRQVLPSAAKRRVRVQRGPFTAALKRVSIMASD-RNHSVRFAFDEDRLVMTAHNVDAGDVREELPA-DLEGTPLFTGFNVRYFQDILAATRGDEMVLELGEPLDPCLVRIPDRDDCMFVVMPMR 400
143 0.000e+00UniRef50_R5E3X8 Beta sliding clamp n=4 Tax=Proteobacteria TaxID=1224 RepID=R5E3X8_9BURK  ali  17  30.....KKENIFKPIQAVSGVVQRKQPL-PVLSNILFVQKGKQVTLVANDLDLQILTV--AEIEENSEMSTTISARKLTDILATLPDNPLSFSKKGDHVVLSSGKSKFELQTISAEEFPVITEVDLE-----HAFTMSCLRFKYLLNMVSFACAVNN-VRYFLNGVYI-CAENNKVRGVATDGHRLALCDVEAEKKKLDAILPRKTVKELVRLIPDSQDPIEVYISE-------RQIKFKFVGIEILSKLVEGRYPDYQRVIPEHNEKEFRVGRQELLSSLQRVATLTAD-KLMGVRWNLTPGHLNVAANNADMEEAEDEIS-VEYSGSPIEIGFNVAYLIEVLNVLKNDSVRISLGEQKNPALIRMPDNDNFKFVVMPMK 390
144 0.000e+00UniRef50_A0A1F9HP84 Beta sliding clamp n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_02_FULL_46_8 TaxID=1797879 RepID=A0A1F9HP84_9DELT  ali  17  1MRFSVLKENLYNGLSVVSS-ITSKNLTLPILQNVKMVAGQGSVEFSTTNLEIGIRYKVRGKVD--EPGEMTVPARVFLEIVNTLPNERVDCRSEENTLHAECANSKTALRGVAAEEFPVIPT-----LSDGIEISCEAKECVDALEQILFSVASD-ESRPEIHGVYAN-AEKETLTLASTDGFRLSERQVSLVGGDRQIIIPSRTLQELERLVGHGGEN-----GAVQWVIGENQLLLRYGNGEIVSRVIEGKYPDYRQVIPSAHKTTVTVATKELLQLVRGAGLFCRSGM-NDVRFSPEQKELRVRAANTQIGEYDAAVSA-QVAGEENDIALNYRFFLDGLAALKSDLVVLEMTEKNNPIVLKAAEGKKYLHLIMPIK 370
145 0.000e+00UniRef50_W7KRE9 Beta sliding clamp n=4 Tax=Bacillus TaxID=55087 RepID=W7KRE9_BACFI  ali  19  1MKFEIQKEVLIHAVGVVIKAISPKVSV-PILSGLKITATSKEIIFVGSNNDISIQKTVPLKAKVHEEGSVVLNAKFLNELVRKVPKDDITFTVEKNNVTIKSGKSVFSLNGFPAEEYPKLPEIEGEAD-----FTLSAGDLNSIVKQTAFAAATS-ELRPILTGINLNLKDG--LKAIVTDSHRLAIKELKLAGEDRNVTIPAKALIELSKVFEDQEEQVEVILKD-------TQALFKSHNLLFYSRLLDGNFPQVSKLLPTTFNTTLKVDRKGLSAALNRCALI--ESKNKVVVLEVKDKQAVLTVSSPEVGQIEEYLEDFEIEGKDIKIAFSYKFTQDALSAFEDEKVQFQFVEALRPFIIKGEKCDSVTQLVLPVR 369
146 0.000e+00UniRef50_A0A1V5PLP0 Beta sliding clamp n=1 Tax=bacterium ADurb.Bin363 TaxID=1866927 RepID=A0A1V5PLP0_9BACT  ali  20  1MKVICQQEKLNFGIQTVSKAISSK-VIEPIYGNIKLETSNNNMRLIATSGDISIEILIGVD-SVEKEGSITVPSRELGNLIGSFNSGKVEIESDDKLITITSKGCHYQLNGLPSDQFPSMQKTISEDL-----ITINQETLKNMIKETFFAIAPPDEVRAVLKGSLFEI-EGENLTVVSADGRRMAKKTGKLPGKNFEIVVPKKTLNELIRILSEGSEE------EVNIFISDSQIDFHIDNIRILSSIIQGKFPNYRQVIPTHCEQSLRINKENLYKALKRASFIAQDESPNLVKFKVHGSQIIITANTQDVGQAYEEVDLEEPA-QSLDIAFNAKYLIDALSSMATTEIIFELSNPVNPGIIKPAQREDYLYVIMPVR 370
147 0.000e+00UniRef50_A0A0M0G4E6 Beta sliding clamp n=6 Tax=Bacillus TaxID=55087 RepID=A0A0M0G4E6_9BACI  ali  14  1MKITIMSEVFHQALGDVVRAVSTRTPM-PVLTGVHLVATDEGLTLVGSDSDLIITRELPAELDVEQPGAIVLPARYLAEIVKKL-SGPIHLQLDDTTADIRCGEIKTKLKGSPSDDYPKLPVMEESE-----TLQLDASRWMEMLKQTVFAVSKS-EAKPVLTGVHISMGEG-RLKSVATDSHRLAYRETMIDQHDRSCIVPYQAIGELIKLWDGKTDAVEVAMNE-------HHIHCRLGETSLYSRLIDGKYPNVSGLIPEGSETLVKMETKQLLKGVDRACLFAGEWKNHNVYITIHDGRMKLSSAATQLGNIEESQRIMEIEGEEMKMTLDGKYLMEALRSVKEETVTLQFGGIMKPVVIRPEGNATHLQLISPVR 370
148 0.000e+00UniRef50_UPI00048DBA85 DNA polymerase III subunit beta n=1 Tax=Proteocatella sphenisci TaxID=181070 RepID=UPI00048DBA85  ali  23  1MKFSIEQKQFQNALSIALKGISSKN-IMEILKGIYIEAEDDHITLTSNNLEIGVKTRVQA--EVSESGIAIIEGKILSDIVRKLPDEKITISVNDNNVKISTSKTKFNIKSMINNQFPQVEEFENDRYE-----KIDMKLFSDMVRKTHFAASQD-ETKGVLTGSLIEI-DSNSISMVSIDGFRLAIKRIPTNYNEKKVVVPVKTLQEVTKLSSNENCDLRILFEERN-------VSFVIDNTIINSRVLEGEFLNYKQIIPKEFMTKIKINNHEFISSLERAMLVS---NNNLVKLVISDDTVVVSAKNSEIGNLEEDIP-VNQQGKDLEIAFNIKYFLDCLKNLDEEYIYMNFNTNLSPCVINPESDEDYTYLLLPVR 362
149 0.000e+00UniRef50_A0A0G1KJ71 Beta sliding clamp n=5 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1KJ71_9BACT  ali  21  1MKFTCTQENLHKGLAAVQG-ISGNTTALPILKNILIEAKDGAINLKATDLEVGITSIVRGKVD--KEGSITVEAKLLSSFVSLLPRDKVEVQSDGKNVTVLGGAHKTKINGLSSDDFPVIPGIQKDKEC-----VISLPIFKKALSQILPAVSFD-DTRPELHGVYVSI-NDKTITLVGTDSYRLAEKKAPLVDPTAQFILPLKTAKEFLRSLEATEEKVILYHSE-------NQALIVYGSNEIVSRLVDGNYPNYQQIIPTSHTIKCIINREEFINAVRISGLFASVGSNN-VTLTIVSGKMKIASRTI-IGEEQTELPHIEGEGE-LTIAFDYRYLLDGLTAIDAPEIALLASSPSAPVLLKPNEGEEFIYIVMPIR 368
150 0.000e+00UniRef50_A0A2E8NK79 Beta sliding clamp n=3 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8NK79_9GAMM  ali  21  1MKIVVDRDLLIDSLQLISNVVERR-QTLPVLSNMRLIVKDGQLEMVGTDLEIELQASL--TVNAESDGEITVPAKKISDIWRSLPSEPIVMEQVGDRLKIKSGGSSYSLSTIAVSEFP-----ESLGDIEGESIEINSEKFRRSVEEVAFAMAQ-QDVRYFLNGMLIEIGQGK-IKLVATDGXRLALTEMDVXASSQKAIIPRKGVLELLKILDGSE--------KFSLQISDKLITVRSGNYQXTSKLVEGQFPDYNKVVPQGGGTEXTIEXQSLREALQRASILS-NEKYRGIXLLVDKGSLKIQANNPEQ-EEAEEVLEISYDGGXLEIGFNVSYILDVLGAISGSEAKLTLSDGNSSALIEGLDDSNSLYVVMPMR 367
151 0.000e+00UniRef50_A0A101HV57 Beta sliding clamp n=1 Tax=Microgenomates bacterium 39_6 TaxID=1641391 RepID=A0A101HV57_9BACT  ali  22  1MKVTLLQENLNKGLSIATHFVSSHPQL-PILTNIALKTEKNRLKISATNLETGVNYYCGAKID--SEGGVAVLSKTFSDFVSSLPAEKVVLTEKKENLKIVCGNFTANLPTNSISDFPKIPTKTNK------KVSFPYQKFIKALEKVVFAASND-DARPVLSGVNFKFKNNFCL-LSATDGYRLSFKKIKLEKKDLNFVIPATILTELARSKPEDD----LSKLELGLASEEKQAVFFLPNLEFSSRLLEGTYPNINKVIPQNKETTVIVDREEFLGAIRTASIFAR-ESANTIKLIIADNKINIFANAPSLGENISQIEA-QIKGKDQKIAFNFRFLVDLLTNLDSDQVVIELQESEKPVVFKSPKDKDFLHIIMPVK 365
152 0.000e+00UniRef50_A9B4J2 Beta sliding clamp n=3 Tax=Herpetosiphon TaxID=64 RepID=A9B4J2_HERA2  ali  17  1MRLACLQENLKRGLALAGHAVAGRSSL-PVLANILLATESGRLKLAGNNLEIGITALVGAKVD--EDGAITIPAKLLSDLVGNLPNDTVELEVDPQTLTVTCRGTKANIKGIDADEFPAMAVPGNEPVLAY----LPPELLRKVVSQVEVAAAANTNPNPILQGVLIRLS-GTQATFAAIDGYRLAVRTIELPEPDTELVIPSRAMAELGRTLGDSETPIAMSITSN-----GGQVIFHSDTVDFVSRVIDGKFPDYERFVPSNTSTRSVISTAEFSRAVKRIALFSQ-AAGNIVTLTMEPGRLLLNANAAEIGESVEAISAL-IDGDDGKLALNVRYLQEALGAIDTDQVALETQTPNSPGVFRPIGGDEYLHLVMPMR 379
153 0.000e+00UniRef50_A0A1Y4H0J3 Beta sliding clamp n=1 Tax=Anaerofilum sp. An201 TaxID=1965588 RepID=A0A1Y4H0J3_9FIRM  ali  13  1MKIICDRSLLADALAGVSRAISGRGAL-PVLEGIHLKAEGFSVTLTGYDTEIAIITTIEANV--IEPGEAVIPAKLFGDLVRRMAADEVEVTTANGTAHIRGGSAEFDIAALSVDDYPALPTPGADP-----ALELPAGVLTEMIGRTVYAVSQD-DKKPVHTGELFSIQSDK-LTVVALDGFRLAITEQPVEAKEIDIVIPAKTLTEVCRLLGDPEETVKIS-------ANRHYVVFAASGYTVISRLLEGAFLDYKKVIPEGHRTRVQVEVKPFVETVERASLIITERLKNPLRVTFGDG-LTVRCQTT-LGKVQDQLPA-HVEGEAVEIGFNNRYLLDALRNSGCDNVVMELSGPLSPVKVLPADSDGFCFLVLPVR 368
154 0.000e+00UniRef50_A0A1M4Y5W6 Beta sliding clamp n=1 Tax=Kaistia soli DSM 19436 TaxID=1122133 RepID=A0A1M4Y5W6_9RHIZ  ali  17  1MQISLPRSALFAALGQVKAVVEKRNTI-PILSNVLLRAEKDSFTVVATDLDIEIKVRIEG-VTPEKAGATTVEAHLLFDIVRKFSDKVISLATDGQKLRVAAERSEFHLQMLPESDYPSITVAPMPDGWL-----LPAATLARIIAKTEFAIS-SEETRYYLCGIYWHVRDGPMLCAVATDGHRLAKVEITAPEGMPGVIVPTKTVSRLREMAKGFEGDITFEVSD-------TKIRATAGGTVLTSKLIDATYPDYARVMPRGNDRLLTADRPSLAAALDRVSTLSSD-KGRAVVLELEAGTARLAVNNADHGTAEETLD-VTYEAEPLRIGFNSRYLADVLDCIACDQVQIRLGDAGNPALITNPLDPSVELVIMPMR 372
155 0.000e+00UniRef50_A0A1F7R643 Beta sliding clamp n=1 Tax=Candidatus Saccharibacteria bacterium RIFCSPLOWO2_01_FULL_49_22 TaxID=1802147 RepID=A0A1F7R643_9BACT :  ali  15  1MKLQVTQENLSRALNTVGRVASTRATL-PILANVLIKTDKNRVSVSASNLDIAITHRIGGKVE--KNGAITVPARLTQDFVSNLPDSVLKLDLNKHKLSIVTDKYQSVVNGMPADDFPVMPAI-----SGGTKWRLPATEFKKALSQVVVAASND-DARPVLTGVYF-YSRGGEVIAVATDSYRLAENKLGKASKSINFLVPAGAINDVLRIISDSDKEVVITHDDQ-------QVSFEIGDVSLVARLVEGNYPDYRKLMPAKFAVTAKMKRSDFANITKVSSLFARESAGVTIKVDKAEKAVSINAIASQLGENTAAASA-EVTGNG-EVTLNSRYLIEALGAIYGDEVEFCFNGKLEPCILRSPHEPGYTHLIMPLR 362
156 0.000e+00UniRef50_A0A2H0BJR3 Beta sliding clamp n=28 Tax=Microgenomates group TaxID=1794810 RepID=A0A2H0BJR3_9BACT  ali  20  4MKLTVLQENLAKSLATTSRFTATRAQL-PVLENILFSADKTKLRLSATNLETSAVVNLGAQIK--EEGEITIPAKTIAEIILNLPAGPLELESDKEHLKIKAQGFSAKVLGMNSADFPKIPQ----AVEPTDCLVLPKEELLDALAQVLFAVSVD-ESRPILTGVLFLFSKGG-LSLVATDGFRLSQKKINFKGKFQKLVLPKNPLVE------XXXXXXXXXXXXXXXXXXXXXAVFGLGETVLSSRVLEGKFPDYEKIIPKSSSLKVRADKEELLRAVKLASVFARD-SANIVKSKVEKETLNLSAESSQVGNQEASVEA-KVDGDGFEISFNYRFLEEFLRVVKGEEAQMEFTNSSAPGVFTDPKDPNFLHLIMPVK 372
157 0.000e+00UniRef50_A0A0G1M3P6 Beta sliding clamp n=5 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1M3P6_9BACT  ali  20  1MHATVLQPDLNKGLGIVSRVVATRGQL-PVLANVLIEASKEGLTLAATNLEIGLRVRVGGKV--TEPGAVTIPGKNLGELVGSLPGESLDLQTEGEKLKIKTGKSAGMLTGIAASEFPAF----AKATAGQAPIKIKKELLLEIASQVAYAAAAD-ESRPVLTGVKFWVV-GSELMVVATDGFRLSRKQIPLKSQIPNVILPARTILELARV-AEEEEIIMETVKEN------NQVIFSCGDVQLVSRVLEGNFPDVDKIIPQSFKTEAIIDREKLAAALRVAGIFAR-ENSNIVKFMVHGSQFIVKAQAAQTGENESEIE-IEKEGEDGEIAFNYKFVQDFLGSVREERIRLKINDNLSPGVWMGEKDKSLIHLIMPVR 363
158 0.000e+00UniRef50_A0A2D6YSP2 Beta sliding clamp n=7 Tax=Planctomycetes TaxID=203682 RepID=A0A2D6YSP2_9BACT  ali  18  52MKLVCSRDALAEALXIAGSVVISRTP-APVLLCLKLEAKDGLLHISATDTEIGLLLGV-AEVDVREEGVALIPADKLNQIVRASSDDSLSIEVSKNIATITGRDSKFKVFGFDPGEFPGVPTFEDE-----HEFEIGAGTLRRLIGRTVFATAV-ENSRYAINGVLIE-RTGRHLRLVATDGRRLAVARVTGAEEDLTSIVPTKALNVLNRLINDPDEPVRV-------LRDRNQILFQVGSGVLSSNLVEGSFPPFEDVIPKDQDKKVNFKTVELASAVRRAALL-TNEESKGVRLAFAEDGLTLSSRAPEMGEAEIKVGSEAYAGDPIEIGFNPSYLTEGLKHADSEMILIELKAPNKPGVIKV--GSDFTYVVMPV. 418
159 0.000e+00UniRef50_A0A1V2YHB0 Beta sliding clamp n=11 Tax=Firmicutes TaxID=1239 RepID=A0A1V2YHB0_9FIRM  ali  20  1MKIYCNQKALMSCINTVIKASSTR-TSLPILECILINANSNYVTLTTNNLDLGIESTFEADV--ITNGLIALEAKLLSEIIKKMPNEEIEINLENNYVSIASGKSKFTIVARTGEDFPALPKVQVQKG-----YTIPRAALKDMINQTIFSVASD-ESRPAFMGEMFHIKD-NTFNLVSVDGFRISYRQAEIVNEFGEIIVPAKALAEIARILPHDDGDVIMYFD-------NRHVFFDIENTKIVSRLLEGEFLKYSQMFTPDYDTQIIVNCKELLMCIERASVISREGKKHPICLEINTEQMIIKS-NTDFGTSIEELNA-DIQGKNLTIAFNPRYLMDALKAIEDDEIMINFLSIIEPCIIQPKNGNAYKYLILPIR 364
160 0.000e+00UniRef50_K9R516 Beta sliding clamp n=10 Tax=Cyanobacteria TaxID=1117 RepID=K9R516_9CYAN  ali  19  1MKLVCNQSDLNTHLSLTSRAVPSRPT-HPILANVLLQADNGQVSLTAFDLSLGIRTTFKA--EVLEAGTITLPAKLLNDIVSRLPEGEITLDGEGLTVTLKPKSGRYEVRAMGAEEFPELPVTENE-----KAIHLPASALIEGLGGSLFATSAD-ETKQVLTGVHLTVKQD-ALEFAATDGHRLAVVETTNENDSVQVTLPSKALRELERMLSAEDEPVAMYFD-------QGQVVFEWQNQRLTSRTLEGQYPAYRQLIPSGFERELTLDRKQLISALERIAVLA-DQKNNIAKLSIESQEITLSVETQEIGSGMESMPA-QILGDDIDIAFNIKYLMEGLKALPSAEIQMQLNNNLAPVIFSPVGGIKMTYLAMPV. 386
161 0.000e+00UniRef50_A0A1B3WT51 Beta sliding clamp n=1 Tax=Anaerolineaceae bacterium oral taxon 439 TaxID=1889813 RepID=A0A1B3WT51_9CHLR  ali  19  1MKLSVSQSLLSQALGIVSRSVDTKR-LLPILTNILLTTEDGNLRLSATNLELGINYRIPA--EIASEGSITVPAKTLIDLVNTLPNDVVHLELDASTLIVRCVQVVTDIKGLDAEDFPPMPVFDPQDAVV---FNLP--ELKKMIQQVAFAAATD-ETRPMLQGIYLTV-NGNELTLVATDGYRIAKRTQSLENAPISAIIPARALIEVNRIPGDSSDQIYV-----NLASGKNQVIFHQEHVDVASQLISGTYIDYKAIIPRNFKTDTVVSTAALQKACAQAMIIARDSKF-LTHFTIDDGLIQINAVSEETGTYDNQIPA-TVNGETLNIAFNVRFLRDVLDVVSSPQVMIRTNTNVSPSLITPLDDNDYEYVLMPM. 373
162 0.000e+00UniRef50_A0A136NVK1 Beta sliding clamp n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A136NVK1_9CHLR  ali  18  1MRLSVLQSNLARGLSIVSRAVESRPSM-PVLSNVLLKTEESRLKLAAVNMSLGITVWIGANVEV--DGSVTLPAKVFVDLVNNLSNDRVDLSLDTQTVHLRCGGNKGNIKGIDAHEFPPLNEGSGSD------LTVEGGLFKNMINQVGFSAAAD-DHRPALTGIFMQL-NGSTITMAAADGYRLAVHTGELEDKALNLLIPARSLQEVAKVITEDDEPVYI-----NLPGERDIIVFTVGQVEISAQLLDAKFPPFESVIPKDYSTSTVMYRTDLLAACQRAEIFARDSAFSG-RLYVKPGEVTIVGKSQERGDNEGLLDA-TVEGEPVDISFNIKYLIDVLRVLPDEEVVLQSKGAANPGVIRPVGRDNYLYVIMPM. 375
163 0.000e+00UniRef50_M9WT95 Beta sliding clamp n=35 Tax=Wolbachieae TaxID=952 RepID=M9WT95_9RICK  ali  15  15MRFSVGRPSLLNTLSRVSGVVERRNAID-VLACINIKAQHGSIKLKATDLDISIFASLAANVSA--EGEVKISAHTLHDIVKKLPTDDVHFEMNNGKLLISCGNANFSLPNVVSNNFPVL-----EEGDHQYDFTLLSADLVDLLTKTKFAVSLD-DTRYNLNGIYLH-TDEQFLYCVATDGHRLSRIKRPKPEDEFGVIIPRKTIMELLKVLGD--------CNEINIKLSDRKIKFTCGEYVLISKLIDGTFPDYKAVIPTSQDKQMIVESSKLASVIDRVSVVVSD-KIKSIKFSLQENLLTLHSNSQECSDATESIE-VDYDGALMEVGFNSRYLLDALSCIKN-KCKVSLSDGNSATIITDEDDPSALYIVMPMR 378
164 0.000e+00UniRef50_A0A2N2NJ51 Beta sliding clamp n=13 Tax=Bacteria TaxID=2 RepID=A0A2N2NJ51_9CHLR  ali  17  4.KVTVQKNTFAESLAIVGRAVGS-HTHLPILSNVLLRKDEGQLRLSATDLTLGVTVWMDAHMDGD-PG-LTLPAKTLTDVVNSLADPEVVFSVNGKEAALKCGTYKGVVKGVEASEFPSIPEFD-----VSSGIPLDANAFKKMIQNVAFAASVD-DSRPVLTGVLMNM-DGKSASMVATDGFRLAIYKVELPVGKKQLIIPASVLKEVVRILGATKANKTTLF----LPATGSQVVLRCENVQIVSQLIDGKFPDYQAILPKGYKTRAVVNTNDLLKACKQASIIAREG-SNVVRFHLQPGKVKLLAESDETGTSEIEI-GATVEGQELEIAFNVKFLQDGLETISTKNVVIEANAHNTPAAIRPTEEEDYLYVLMPM. 381
165 0.000e+00UniRef50_A0A0G1S1D6 Beta sliding clamp n=8 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1S1D6_9BACT  ali  18  1MKLEILQEELLGGLTTVLRAVSARVQL-PVLSYVLMEADKSGIGLSGTDLEIGIRVKVMGKVE--EGFTTAVPGKMLAEFLGTLPPGKVTVELKEKSLIITAGGYEASFQTMDPTEFPKLPEFGGRKG------KINNQAIEEAINGVVFASAKDS-LRPVLTGVLMEL--GKKLKLVATDGFRLAVENIEMGEGGESALVPSRVLAELPRMMKEEEIEI-------GLLPETHQIMFRGGSTLLISQLLEGNFPDYQKILPKEFTTEVKVGKEELLSAVRMTHIFAR-ENSNMMRWEVGAAKIVITSSSPEKGECRVEVPA-KIEGGEVGVVFNAKYVMDYLAGIAGENIWIGLGDKLSPGMFREEGDKNGLYVVMPI. 360
166 0.000e+00UniRef50_A0A1P8QJX4 Beta sliding clamp n=1 Tax=Methylobacterium extorquens TaxID=408 RepID=A0A1P8QJX4_METEX  ali  16  1MQLTVQREALMRPLAVAHRIVERRNTI-PILSHLRLGADTGSLTIRSTDLDIEAASTCEADIQ--EPGVTTVPAHTLRDIVSKLPQGELRLREDAGQLTLTSGRARFKLPTLPVEDYPDLQAGEMP-----HRFIIPVLDMARMVREISFAIST-EETRYYLNGIYLHAPDGEGLVGVATDGHRLARARLPRPEGMPGVILPRKLVAEIGKLADGDGGP------EFAVALSPTKIRITRDGTSLTSKLIDGTFPDYERVIPKDNPHTLAADGKALTTVLDRVTTISS-GSSRAVKVALEDERIVLTQQNPDTGEATEEADA-KFDGAAMQIGFNGKYLFDILTLLDSEHIEARFGDPGAPTLWRRRGDELLTVVLMPMR 373
167 0.000e+00UniRef50_A0A0K2SFI9 Beta sliding clamp n=1 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SFI9_9FIRM  ali  13  1MQILLEHERFANALAFVERTVASRDTI-PALTGILLEAESGGVRLTSTDLEMGATTRVDAEVET--PGRVLLPGRLLTSIVRRLPGGDVRLTLDGGVVSLTSGSSRFQIRTMDASDFPDIPTVEGGPW------QVDARVLREGIERTEFAASP-EESRPVLNGVLLEV-EALRVRAVATDSSRLAYYEMPLSSSPLRVLVPSRSLAEVMRLLAGLEEPVTLRLSE-------HHLSFETGSFLFFSRLIEGEFPDYRRVFRSQQVVSCTVDRQAFLDALERVSLVSRKGPA-VVRVRVAPGRLELESHGAEAGQASEALPVEETEGSGQT-AYQARYLTDVLRVLSCSHVRFAYSEGDHPGTVRPLDEEGYTYVVMPVR 390
168 0.000e+00UniRef50_A0A132Z8I9 Beta sliding clamp n=579 Tax=Bacteria TaxID=2 RepID=A0A132Z8I9_ENTFC  ali  19  1MKVTLNRASFMQELQTVQRAISSKTTI-PILTGVKITLTQEGLTLTGSNADISIETFLSANMQIESTGSIVLQARFFSEIIRRLPEETFTLEVENKQVAITSGKANFIVNGLDADNYPHLPVVESH-----NQMKLPVHVLTKLINETVFAVSQ-HESRPILTGVHF-ILSDNSLLAVATDSHRLSQRVIPVEADHFDIVIPGKSLIELSRSLTNEEEIVEISI-------MENQVLFKTETMYFYSRLLEGNYPDTNRLIPSSFNTEVEFSVPSFLAAIERASLLSHEGRNNIVRLSIRPDAVVLYGNSPEIGKVEESLSYTASSGDPLDISFNPDYMKAALRAFGDMSIKVKFISAIRPFTLEPTEDGQFIQLITPVR 374
169 0.000e+00UniRef50_A0A2G6C462 Beta sliding clamp n=4 Tax=unclassified Saccharibacteria TaxID=1895827 RepID=A0A2G6C462_9BACT  ali  15  1MKLQVTQENLHKALTNVSRVASTRGTL-PILSNVLLKTVDGRLSIAATNLDIAITQFIGAKVS--EDGLITVPARLMQDFISSLPSGVIDMRLDESKLHIETEQYQSVINGISAEDYPVMPDIDN-----GQTWSVSATALKTALQQVVLAASGD-EARPVLTGVYMHVFEG-SLYVVATDSYRLAEKKITSLKSTVSLLIPAAALQELMRVVGDS-------DDDVTVTHDDQQVLFRVGDVELVTRLIEGTYPDYRKLIPEKYSSLAEIKKSELQNITKVSSLFARENASVTINLDESAQAVSIRSVASQVGENIASAPA-KVTGDG-TITLNSRYILDALHVIGDDTVRFGFNGKLEPSVIKGAKTDDYNHIVMPLK 362
170 0.000e+00UniRef50_A0A2H0T6U6 Beta sliding clamp n=1 Tax=Parcubacteria group bacterium CG10_big_fil_rev_8_21_14_0_10_36_14 TaxID=2014326 RepID=A0A2H0T6U6_9BACT  ali  15  1MKFVCTQENLQQGLLVASH-INTKNINLPILNNVLLRVSNNTLKLISTNLEIAVTTKIRGKSEA--DGEYTVPAKLLADYVSLLPKENATLSLEDGFLRVSCGNKTTKIKGIDSTDFPVIPQIEKKTV-----FYIDGQKLRRALSQVSFAV-LPTETRPEISGVFVSFNSQPGITLVATDSFRLAEKKITLSEDNIQIIIPLKTTWELSNILSIISGDNDLL----EVCVDDGQVFFGYNGTELTSRLIEGAFPDYQQIIPKEFNTIAKLSVPDLLSGAKSASLFSRSGL-NDIKLNITKKSVEVYSTDNQTGEQKTIVSGV-VNGKENKIVLNHRYLVDGLSNLGSLEATLETIDENSPCLIRPNGDNNYIYVVMPIK 372
171 0.000e+00UniRef50_A0A2D7TM14 Beta sliding clamp n=9 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D7TM14_9RHOB  ali  20  1MKAIIEKKKLMQALSXLHGVVEKRXTI-PILANVLIXAXDXFLSLAATXMEXAXLQKVSCX--XKQNGVITTPAXVLHDIVRKXPEAXXELESEGKKXEXKTDKISFSLMCLXPKDFPX-----XHXGSFPDSFEIQAEKLSRLIDKTLFSVST-EETRYYLNGIYIHSENEEKLRVVATDGHRLSRLSTELPNNLQGVIIPRKTVIELRKIIDSKQNTVKIQLSK-------NKIRFIVDNISLTSKLLDGAFPDYEKVIPNNNTKELIIDNKEFIDAVDRVSTLSSD-RTRAIKFELSNKSLTISAENPDQGSAKEYLN-VHYTGDNLEIGFNSRYLLDIAKQISGAQVKFLLSDKLSPTLIFDDDDKQALYLLMPM. 369
172 0.000e+00UniRef50_A0A257BDK5 Beta sliding clamp n=1 Tax=Armatimonadetes bacterium JP3_11 TaxID=2012635 RepID=A0A257BDK5_9BACT  ali  16  1MKIQLNRKQFDEALGVVAGAAATRASL-PILSHLYLEAQGDTLRLVGSDLEQWVECRIPAIV--GEDGATTLPARLLTELVGSLGGEEINIETGEHQAIVTSGDSRYQLLGLPAEEYPPVPEIESP-----SELALPAKHFLEMVDSVEFAVSK-EEARQALTGIRMEF-EGDTLRLVATDTHRLAVRTACIDGEPTSAIVPLKAIQLVHKI---------PTSDTITLRLGAHRAAFLGENAAVYTQLIEGQYPNYQRVIPQSYTRKWTLIAQDFRNALRRAYLVARS-NSNKVYLRTDGEKLVISAQG-DVGEATERVDLIR-EGDDLEIAFNARYILDVLDVVKSEGVVIELTESLRPAVFKPAETGDYLCVIMPM. 361
173 0.000e+00UniRef50_A0A2H0RLJ7 Beta sliding clamp n=5 Tax=Candidatus Uhrbacteria TaxID=1752732 RepID=A0A2H0RLJ7_9BACT  ali  17  1MIFSCTKDNLQKGLNVVSH-ISNKQVNLPVLQNVHLKAEGGSIVLSTTNLEIAMRISIRGKID--KPGEFTVPAKLFYDFVSLLPNDRVDVERVDQLLEVRCGDTATTMNGIDAAEFPLIPQVETTAV-----IKMPAQLVREALSQVAFAVSHS-EARPELSGVLLKFNE-KTLTMAATDSYRLSERKVILPAQDRQLIIPAETVNEVNRMLSVFKDDPE-ADDVLELRLSDSQAVFVYGPAELITRTIDGNYPDYTQIIPTVFTTEVIVGRNELIKAIKTASLFSRQGVF-DVILQISPDKLTVTANEVTRGTNTVSCDA-DITGKENKMTVNFRYLLDGLNTMSSEGVTLKLIDAMNPCLVMPNEPGSQTYIVMPIR 374
174 0.000e+00UniRef50_A0A077AV41 Beta sliding clamp n=3 Tax=Candidatus Paracaedibacteraceae TaxID=1777752 RepID=A0A077AV41_9PROT  ali  17  1MKFAVERGEFLKALTHGGSVVEKR-TTVPILSHVLIHAEDGQLNLTTTDMDLALVETIPAVVE--KPGAITVSAHMVLEIVRKLPEGEATLNPENDQIALKAGKSRFNISTLPAEQFPKLTQND-----LPFSFKLTAEKLRYLIDRSRFAMST-EETRYFLNGIYFHAHEQKVLRSVATDAHRLACIEVDIPDGAPGIIIGRKTITEIRKLINDENAETEITIS-----LSPQRVEFKLPQAILSSRLVDGTYPDYEQAIPVGNDKPIIVDAKDFAKAVDRVATVTTD-KLPVIKISVAKNKLTLVAASSELGDATEEMEVDFPFDQSIEIGFNANYLVDITSQIGDEAAEILLSDGSAPAIIKGINDKEALFVLMPMR 374
175 0.000e+00UniRef50_D5C436 Beta sliding clamp n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=D5C436_NITHN  ali  16  1MQFSIEREEIVRHLATVCGVVERRHTL-PILFNVLLSVEEDRLSLTATDLEVEIRTTLE--VLHPKGGKTTVSARKFLDICRALPAAELEVQHEKGQFHVHSGHSRFTLSTLPAEDFPS-----TDSLEEVVELELTQAELKQLLHRTVFCMAH-QDVRYYLN-GLLLELGEETVYAVATDGHRLAVASLEKEGVQIQSIIPRKAVLELVRLLEESNEPVRLKFG-------TNQMGAEFQGLSFSTKLIDGQFPDYKRVIPVGCEKRFVADREQFKQALGRVNIL-TNDKYRGVRLHLSNLKLQATVTNLEQ-ESAEEELEVEYQGESFEIAFNNSYLIDVLNIINTEQVKLEFTNANSSCLITPIGEVGSKYVVMPMR 366
176 0.000e+00UniRef50_A0A1V4QPF4 Beta sliding clamp n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V4QPF4_9DELT  ali  18  1MKVQIDRDILLQGVTRTQGVIDRRGTM-PILGNFLLEAKDDQVNISATDLEVSFRGFYPAQIQ--EEGKLTIPAVSFFNIIRELPPGTIDLDTDNANLIIQVCEARYQLMGLAAEQFPPLPT-----GAELEMVTCKSQLLREMIEKTSFSVSSD-DLQYHLSGVYVEKIAENKIRMVSTDGHRLSLIDRVVPGADQGIIIPRKGVAEIQRLLADGEE--------CSIGLDRKNLTLQLDNKFLFIRLLEKKFPDYRRIIPANFGVQFILPRREFFEALKRLSQLSTD-RFKGVILKFNPDILEIQYVNPEVGEGRERLPATEAPGEPLEIGFNARYLLEPLGVMSSERVVMDINQKDKPCRLQGENEPDYLCIVMPM. 379
177 0.000e+00UniRef50_A0A1N6F444 Beta sliding clamp n=11 Tax=Nitrosomonas TaxID=914 RepID=A0A1N6F444_9PROT  ali  21  4..IKTSRDTLLKPLQMVTGIVERRHTL-PILSNVLIQQDNEKISFLATDLEVQIETATQNKITIEQTFSITVSAKKFQDILRALSSDEIILAIQENRLQVRSGKSSFNLQTLPGDGFPKI----SDETRPEAAITLQQKDLKNLLHHVSFAIAQ-QDIRYYLNGLLLLIEN-NDLKGVATDGHRLAYYIINLEESKKEVILPRKAVLELGKQLNDNDEPVIIEI-------FQNKIRFSFSNITLISKVIDGKFPDYNRVIPTQNTKQFDLDRLIFLQALQRVSILSNNEKFRGMRLIVSDSTLCIICKNNEQ-EEAREEIEIQYDNEMIDISFNITYLLDLLNNISAETIRCHFGDASSSVLITIPNNENFKYIVMPMR 370
178 0.000e+00UniRef50_A0A2H6K578 Beta sliding clamp n=1 Tax=bacterium BMS3Abin01 TaxID=2005709 RepID=A0A2H6K578_9BACT  ali  18  1MRISCPKDLILDKLQTSLKTVATK-TTVPVLSGIRMETKGDTVELASTDMELSLRLSLNVVVE--REGAAVLPGRLVTDIVRSMPDVKIDFNEKEQMAEITCSSADFKINCLSADDFPRLPSMPAE-----GAFELEAGPMIETVNTVARAASRD-ETRPVLTGVLVKFSQDK-IKMVATDSYRLSVRETEVKSEKKEVIVPRASLEELARLCGAGDAE------KVSVGVAEGQIIFGTTGILLTSRLIEGKFPNYQQLLPDEFKYEVEIDREELMEVVRRVGLMAQ--KNAPLRLRLEEGKLVVSALTPQVGEAQESLP-VPFKGEEMEIGFNPEFLRDGVESVGEEKVVLRLISPLRPGLLKGSSDA-FLYLIMPVR 366
179 0.000e+00UniRef50_M1L832 Beta sliding clamp n=6 Tax=Betaproteobacteria TaxID=28216 RepID=M1L832_9PROT  ali  17  1MRFYVVRESLLKTLSNIVGIVERRNTM-PILSNIMIRKKGNKVAFVTTDIEVQMTTYADCG-SGDSEVSTTVSARKFLDILKALPDSSINVELHDNKLYIESSKSRFNLQTISSEEFPMMSCPDNWDI----SINLPQRDTKNLFGMVYFSMAQ-QDIRYYLNGMFLVFKD-NCIVAVSTDGHRLSYNSTTANEFEKEVIVPRKTILELQRLLQDSDDIIRIDVSS-------SQIKFCFRDIEFISKLVEGKFPDFRKVIPNNYPISFSIKREYFQGSLQRVAIL-TNDKFKGVRFHFEDDNLKISSSNTDHEEAQEELEII-YRGDAFDVGFNVNYLLDVISNLKSENLIWSITDSNASVLITVPDTPNFKYVVMPMR 369
180 0.000e+00UniRef50_A0A2V2ENL0 DNA polymerase III subunit beta n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2ENL0_9FIRM  ali  16  4.KFSAPKENLLYGINAVQKAISAKNTV-PILSGIYLKAQGGRLTFAATDLEISIECTVPALI--ISEGDIVLPGRYFAELTRRLPEGEVIFEYQPDSVKITYENAESSIKGWKGEEFPTISQINGD-----KSIAIIPSEFKNLVKQTTFCANKD-DVRPVFTGALLEVEN-NQLKMVSTDSYRLSFKAGAIQNPDFQKVVPVKALEELSRILKDDDEDL------LHITYNQNQMSFSNSEIHFNTRLIDSNYPDYRRVIPSEHQTLIKFKKRSLQNTIDRATLFSSEDGTNVIKIKIEDENINITSQS-DYGKIDENLPIYQ-DGENLSIAFNAKYLTDAFKTMDYEDLQATFCGSLGAAVFTGLNDDSYLYLILPLR 370
181 0.000e+00UniRef50_A8DJY7 Beta sliding clamp n=3 Tax=Chloracidobacterium thermophilum TaxID=458033 RepID=A8DJY7_9BACT  ali  15  1MEFSVAKADLLKELSLLNNVVEKKTTI-PILSNILLSAASNLLTLAGTDLDATLRTSCPATI--RHSGTALLPARRLLDIVRNLPDADIHFKSDGGNMNITCERSRFRLFSPAPEGYPSLPE------TPALPLSVPAGIMRTMIPRVLFATSQ-EESRYQLNGVQMVVEASGLLRMVATDGHRLALIERPLPTEKISFLIPKKTMAEIARLAADT------TATEIAFGQDDRHVFFQIGSRLFASRLLAGQFPNYEGVMPRNNNNIIIFETERLVAAFKRVGVVA-DETTHAVKLHATEGRVEIMSQSPESGEAVETLS-VDYPGPSITITFNVTYLMDFLTVAHSTQTRFEFKDEITQIQMRPVDGDDYRYVVMPMR 390
182 0.000e+00UniRef50_A0A0F9MQD3 Uncharacterized protein n=2 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9MQD3_9ZZZZ  ali  17  1MKINCKREDFLESIQVVQNALT--STALPVLSYVLLEAGPEKITLTTTNLETTIRSSFPAQVEG--EGEICLPGDKLFYILRELPSAPVALEIEKSKATIRCKKAMFQLLGFSAEDFPEVPQIMVEKF-----FSLSQEELRQMIQRTVFAASRD-ETHQNLNGAYLEVEEKDA-KLVATDGRRLSFVHLSLASSSLEAIIPLRALQQLARILSGDEE--------VKIGVSERQIFFEMDHILLISQLVDAKFPDYRKVIPTEFSIAILADRDDLLRSVRRVSLL-TDEKSRLLKFKLKENTLLISAEAAELGYAYEEIDVRRERGEEIEIGFSSTYLLDILKNIEKGEVRIELTDSEGPGVIRPSENKDHICVLMPVR 363
183 0.000e+00UniRef50_A0A2E3RR02 Beta sliding clamp n=4 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E3RR02_9BACT  ali  16  1MKVVCDRAALNEALSISSSVIASRSPT-PVLLCLKLVAHDGLLSIMSTDAEVGLSVNV-AQVEVNQPGEALVPADKLSQIVKSSEDDTIHLEVKDHVTTVKGTDSCFKIFGYDPKEFPGIREFMEDQFD----FQIDSRTLKRVISLTIFATAV-ENNRFAINGVLVD-RNSKQLRLVATDGRRLAMXKGPNSDSDTSCIIPTKALNILNKLMSDPDAMVRVSIDD-------HHAVFQVGEATLSSNLVEGAFPPFEDVIPKDQDKRVTFDAAELTSAVRRAALLTTQD-SKGVRLSFGNDRLTLSSRAPELGEAEIHVDMDSYQGDPIEIGFNPNYITDALRVIDDPQIMVEMKAPNKPGVLKV--GNDFTYVVMPV. 368
184 0.000e+00UniRef50_A0A2D6NWF4 Beta sliding clamp n=1 Tax=bacterium TaxID=1869227 RepID=A0A2D6NWF4_9BACT  ali  17  1MKASCTQENLIKAISAVDKIVAS-NANLPILGNILFYIDQRRLKVSATNLEIGINFWIGAKIEKI--GAITIPARILINFVSQLPKRRVDIEVFKNTLNIKCENHKASINGLPAKDFPIIPKIEEKE-----QITIRSDVLKQALSQVVSSVALD-ETRPEIAGVLISLSNDK-IKFVGTDSYRLAEKTIKFKSEELSFILPSRTVHEVIRILDQTEKQVKITLGE-------NQIMFQSGWMNLVSRLTQGQYPDYEQIIPNKFKSEIIVSRSDFESVIKTTSLFA--GQTSDVKLKISKTQVEVSAESSDVGKNTSFVD-CAIKGVGVSLVLNSKYLLDGLKNINSEKISLKLNNSGSPVMIGPYSEIDYLYLIMPIK 370
185 0.000e+00UniRef50_A0A1G2B7J8 Beta sliding clamp n=2 Tax=Candidatus Kerfeldbacteria TaxID=1817907 RepID=A0A1G2B7J8_9BACT  ali  17  1MRISCLQENLNKGVSLVSH-VASKKANLPILSNILLRAKDGRIELLATNLEIGMKTQVRGKVE--SEGEFTVPAQLIGSYVGLLPNERIDVVLQGSELVLSSQSSQTKIKGEPSSEFPLIPEI-----ARTNKRVVAAKALLDGLSSVVVAAAID-DSRPELHGVLFQFSPA-QLVLAATDSYRLAEANIGISGEENRIIVPLQTVHELLRILQQDD------AAEVEIYISDNQVLFVAGDVELTSRLVVGTYPDYKQIIPREYTTEVHVPIAEFVKVIKVASLFAKSGV-NDVALAIEPKQVKVSSVNNQLGENVSSVP-ISGTGEKNEVVFNYRFLLDGLNVISADEVSLQVMNNTTAGILRPKGSKGFLYIVMPIK 367
186 0.000e+00UniRef50_A0A2H5YAC1 Beta sliding clamp n=1 Tax=bacterium HR23 TaxID=2035418 RepID=A0A2H5YAC1_9BACT  ali  13  1MKVSCLQENLAKALSTVARAVPSRPS-EDILLNILLRTEEGRLRLTATNLELAITVWVGAKVE--EEGGIAVPAQRLRDFVAQLPPERVDLSSVQRGIQVSCAWLKAMLRGVEAETYPPLPTVK-----EGTTALVSQKALGRAIEQVAFAAATD-ESRPILTGIRTEL-EGERFTMAAADGFRLAVHTGTLAETPVGVVVPAKTLKEVANLLEDSEEPVTLHI-----ARDGSGILFRLKGVEVYSHLLQGTFPNFRQLIPQSSQTRAVLDCQRLLQTVKAGSAFARTG-SNIVRILLEPGKVTVLAGMEEEGSASGELEA-SIEGEPARIAFNSRYLQDVLSVIGGEKVSMGVNTPSSPGVFRPIGGEEYVHVVMPM. 373
187 0.000e+00UniRef50_A0A1F9DW83 Beta sliding clamp n=5 Tax=Bacteria TaxID=2 RepID=A0A1F9DW83_9DELT  ali  18  9.RFQIEKGVLLLGIQRAQGVTEKRST-APIFSNVLLEGTKGQISIVATDLEIGIKGTYPARVHSXX--GIAVSGKKLHEIIRELPEGEVDISVEDGKLTIKSGNSFFKVAGSNKEDFPAFPEMSEESM-----VTIDSSIYREMIKKTLFAVA-DAEARQVLNGALLEIEKEGKIRMVATDGHRMALCEVEISQTAKQIILPKKTLLELRKFLEVNE--------RIKTGVGEKQISFKGEDVYLTSRLIEGNYPNYKQVIPPKGEQTVRINRTQFSGVVRRVSVMSR-EKTRAILIEFLAGKAIFRARDPEIGEASEDI-GIDYKGPGLTIGLNYQYLLDALESMEDEEVMMEMQSSLSPCVLKQESDPNSLSIVMPMR 387
188 0.000e+00UniRef50_A0A2U2ACD8 Beta sliding clamp n=2 Tax=Ignatzschineria TaxID=112008 RepID=A0A2U2ACD8_9GAMM  ali  18  1MKLVIQREQLMKPLQAIIGVID-RTQTLPILANVKCVVSEDEITLTTTDLEIELTCAFPHI--PLEQGATTFPARKLFDILKALPSGEVQIEVSDSRATISAGRSRFTLSCLPIDEYPV-----SDHLEFDKTLTLPKNALRKLIEQVAFSMAVS-DVRYFLNGLLLDV-NGAELNAVATDGHRLSVSYYQLPESSQQLIIPRKGVEELLKLIENESAPLHLELS-------ANHLRVELGSIVFTTKLIDGKFPDYRRVVPPLGDKIIAADRQGLIDGLVRASVLSQD-KFRGIRFTISDYLLKLQVNNPEQ-EQAEEEVEVNYQGEGFATAFNVSYLIDALKALDDDMVRLSFTAPNSSCLIQNSDNDNVRYVVMPMR 366
189 0.000e+00UniRef50_A0A2E6Q2Z3 Beta sliding clamp n=5 Tax=Phycisphaerae TaxID=666505 RepID=A0A2E6Q2Z3_9BACT  ali  17  19MKIVCDRTALADAVSLVSGVVAARSPS-PVLQCLRLSAGNGQLRLSATDLEIGVAQSID-EVDVQQEGEVLVPADKLSQIVKASDDPTLTLEADGDRLRIRGLGSNWSLHGFPVSE---APEVEDFDESITADYEVPAVILRKQIQRTLFAAANEQ-SRYAINGVLFE-RSGQTLRCVATDGRRLALSSCSCEKQDGNTIVPSKALQLLGKLLDAAQGEVRVSIREGRAHFGIGH---GSRSATITTTLVEGSFPPWSDVVPKDNDIHVTMDTSSLAGAVRRAALLTSQE-SRGVKLTFSAGHLVITSRAPDTGEAEIRVD-CNYEGDELGIGFNPGYLTDALKIIDSPEITLSLKGPQKPGVLKA--DGEFVYVVMPV. 387
190 0.000e+00UniRef50_A0A2H6HVA1 Beta sliding clamp n=1 Tax=bacterium BMS3Bbin04 TaxID=2005727 RepID=A0A2H6HVA1_9BACT  ali  18  1MRFRVAQDRILEALNRVAPTVPTKSTL-PILSNMLFNLEGNMLRIVATDLEVSVVTELE--VDGERDGSVTAPAKKIQDIVRELEGLVLTCDVDENNLHLETEIGQYQLLGSSAQEFPALPEFEG-----ATTISFGAEKFLSIITRTVFAVSRD-ELRPALTGVFFQIR-SHELRAVATDGHRLVRIDQKFESEEHELIIPVKALDIIRRNLPEA--------GDVEFAIGENQIQVKLPDTILYSRLIEGRYPHYESVIPSENNNRMFVSTDQLVRSLKRAQIFA-NPINRQVVLNLETDKVEITAEDIELGGKGREQIAAKYEGEPQTIGYNASYLLDLLKHITTEDVRFDLGGSKQAGIVKPTEGEDFLMLIMPVR 367
191 0.000e+00UniRef50_A0A1G2BLN3 Beta sliding clamp n=3 Tax=Candidatus Komeilibacteria TaxID=1817908 RepID=A0A1G2BLN3_9BACT  ali  17  1MKFTCTQENLSKGLTIAARF-SDRNINLPILNNVLLRAKKEGVIFTATNLELAITTVVRGKIET--PGEFTVASRLLAEFVNSLKKEIITVSLEEKTLTITGENHQTTLRGIDATDFPVIPTIDSK-----TAFTIPGDVLRHALSQVLFAAGTD-ESRPEITGVFLRVENSTC-TLASTDSYRLAQKKIAVPKEDREVIIPAKTLAEVVRIAEIEEPK------EVSIAINENQIKFTVGDTEITSRIIAGEYPDYKQIIPASFKNEVAFAANDMVRAIKTTSLFCKQGI-NDIRLSLEKTDIAVTAENSTLGKNTSNVPSLSKQ-QEFDIVFNYKFFLDGLQHLMGEQAVLKTNDPASPALLSSPSEKDFLYIIMPIR 367
192 0.000e+00UniRef50_A0A2H0V3V5 Beta sliding clamp n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0V3V5_9BACT  ali  21  1MKITCTQENLSHGLSITGH-LANKNVNLPILNNVLIEAKDESVKFSTTNLEIGISCIVRGKVET--DGVYTVDSKLLADYVGLLPSEAVQIALKDDYLNVKCKNNNTRIKGIAADDFPVIPEIEKNNPH-----QIKIADFKQAISQVIFAVA-NSETRPEISGVFISINEPGRLTMVGTDSYRLAEKKVATSGDKKELIIPVKTLQEVLRILNSLKDGGD-TPENIDIYVSDNQILFVVDSIEIISRLVEGQYPDYKQIIPNEAKTKTIINTQELTKVIKTTSLFSKTGIF-DINLEFENKSVVVSSNNIQLGESVSEID-IKFEGEKNNTTLNFRFLLDVLNAVSSSEISFDVIDSAIPCLIRPEGDDSYLYIIMPIK 374
193 0.000e+00UniRef50_A0A2E1UTI8 Beta sliding clamp n=4 Tax=Bacteria TaxID=2 RepID=A0A2E1UTI8_9GAMM  ali  23  1MKIIITKENLIKALQKIIGVVEKRQTM-PILSHILFREKEGGFEVVASDLEVQLSASL-----VLENGSITIPGRKLFDIGKGLPDEAIEIKIEEGKLQIRSKKSKFILSALDAATFPLMDASDENNLD----FIIKSSDFKQIVNKTAFAMAQ-QDVRYYLNGLYLNLSN-KELFGVATDGHRLAKSGVETEQESVNAIIPRKGVVEIDKQLEDVEENL-------NATISKNHLQISNKNTQAISKLIDGKFPDYEKVIPADANMQVIVDCKSLKEALIRVSILS-NDRFRGVRLNFDNNEIKVSANNPEKEEASDDIKA-TYSGDPLEVGFNVNYLIDVLNVIKTKNVQILLKDNNSSALLTPENDNSSSYVVMPLR 369
194 0.000e+00UniRef50_A0A2G6CQQ0 Beta sliding clamp n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2G6CQQ0_9PROT  ali  18  1MELKINRAAFLKGLYLAQSIAERKSTT-PAVANVLLRSEGDAIVCAATDLRTSMVAELPA--EVKSEGGVSIGAKHIYEIVRNLPADMVFLSSENNWAEIKAGKARYKLVGMSDRDFPRLPDHREVVFS-----EVSAPALVDMIGKTLFSVSTDN-TRHHLSGIYFEC-DGKRATMVSTDGHRLSKIEADLPTLDAGVIIPRKGVMEIKRLLEPVDETCDLGFADNN-------IFVRAQDVVLSVALVDAQFPSYKQVIPTANEKAIRLPRAGLLESLKRVSLMSS-ERSFGIRMALSQGRLRIMSDNPDLGEALEDLE-VEYNDEELTVGFNARYFIDILNEINKDNVILEFNGELDPGLVRPDDSRDYVGVVMPMR 366
195 0.000e+00UniRef50_A0A2D5EP21 Beta sliding clamp n=2 Tax=Myxococcales TaxID=29 RepID=A0A2D5EP21_9DELT  ali  17  1MELTIQQRDFLKGLARTHGVADRKSSM-PILSNLLLSAEGEKLRLSATDLYLGVSAVIPASIQ--RGGSIALAARTLFDIVKALPEGEITLSVGENQVTLEQGKIKYKIPGMPGEDFPPLPNAGEAEWA-----TLDAVALGELIQLTSYSMSSD-DTRPHLAGTLFE-GEGQLVRMVTTDGHRLSKAEVTLGEGAFGMLVPHKGXXXXXXXXXXXXXXXXXXXXSVDIATAAGNAFFRRADLQLSVKLADEQFPPYDKVIPQSQSKRVVALRTKLIDSLKRISLVASDKSGGGVQLSIDAGTMKIVSQNPDVGEGMEEVD-VDYAGEPLSIGFNAKYLLDALGALSHDEVALELSGELDPGVIRPVGETDFVGVIMPMR 385
196 0.000e+00UniRef50_A0A2M7XDG4 Beta sliding clamp n=1 Tax=Candidatus Uhrbacteria bacterium CG_4_9_14_3_um_filter_41_35 TaxID=1975034 RepID=A0A2M7XDG4_9BACT  ali  17  1MKFSCTRENLYQGLAITSR-VSGKNVNLPILSNVLLKADKGSLKLVSTNLELTVTCNVRGRIE--QSGEYTVPSKLFFDFVNLLPNEKVDIDLLDDTLSIACGNAKTKIKGIIASEFPVVPPVEGD-----VSYSVPVTEFQDALSQVLFSAATS-ESQPVLTGVLMSFHDEGTLTLAALNGYRLSEKIFKISGEQRKVIVPQRTLAELARVIGVLKDDVE-ASTTVEIQFSRNQIVLKYGAVEISGRTVEGDYPDYRSIIPENKVTEVTVNRSEFIQAIKTASLFARTGLFVGIVLDPEQGTLELKGADSTRGENTVVMNA-TLSGNKNSLTLNFRYLLDGMNAMKSENVTMRVVDSMTACVFVPEAGPGYQYIVMPIR 379
197 0.000e+00UniRef50_A0A1Y4LB21 Beta sliding clamp n=15 Tax=Firmicutes TaxID=1239 RepID=A0A1Y4LB21_9FIRM  ali  16  1MKFSCEKALLVSAVATTSRAVAAKSSI-PAMEGILIEA-DTRLRLTGYDLEKGIQATVPA--EIQEPGSLVLSARLFGEIIRKMPDDVVVFTAQNYMVNIKCGLSEFNILGTDPEEFPELPTVDQQ-----NSLSLEQSVLRSMISQTLFAVS-DNESRPIHTGSLFEV-EKNGLTVVSVDGYRLALRREAVDKESFSFVVPGSALSEVEKICSGE--------GPVTISQGARHILFQAGETLLVCRRLEGEFLAYRNAIPRNNPIQVECDARTLLASIDRVSLIISEKLKSPLRCVFGDGMVSITTKTG-IGDAADQCP-ITGDGQNLEIGFNNKYLMDALKAAPADKLKLEFSSGVAPCVILPEGEENFIYMVLPVR 364
198 0.000e+00UniRef50_A0A2E4US24 Beta sliding clamp n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E4US24_9GAMM  ali  14  1MNFVTTKEALLKPLQQVAGVIERR-QTLPVLANVLVVANDQGVQLTGTDLEVEMTASLSMDVHA--PGSVTVPARKLLEIWRQLPDGQVSVAVEGDQVVVRAGRFRSALSTLPVTDYP-----KPELTVPEISVEVGPKALRKLLDQTAFAMAQ-QDVRFFLNGMLLEFGSG-YLRSVATDGHRLALANVSASGTLKQIIVPRKGVSELIRLLGEVEQEF------VRVEVGSSHLRLELAELSFSTKLIDGRFPDYDRVIPRGGDHVALGERIEFAQVLGRISIFS-NEKYRAARLRFSPGVVMLSANNAEHESAEESCD-VEFDGESTEAGFNSGYLQDVMGALSGRRVRFHLNGS---AVIEDPDVEDALYVIMPMK 365
199 0.000e+00UniRef50_B5YFF3 Beta sliding clamp n=3 Tax=Dictyoglomus TaxID=13 RepID=B5YFF3_DICT6  ali  19  1MKFITQQEDLYKSLQFVKSAVATKTTI-PILTYVYMKAENDTLYLQGNNLEVGLALSMPVIVE--EPGEVCLPASLFIDVIGKLPEVTLEVYVNENRAIIHAGYSDIEIQGESPEEFPKVEVGNITEYHA----SLDRILFAKAIKQTIFAAAED-EIKQVLTGVLFEGKDGK-LNMVAVDGHRLALKTLEIDKDFPSIIVPAKSLKEWQKIITKALED------RVNIAALDNQVVFNCGEIYFISRLLQGQFPAYDKIIPTEFTASFKANRKDFLDILERMEVFAEIDQTNTVKISLSSEEVVISTLPSERGFAKEVLPAVNIDG-NLEIGFNVEYLMDPLDNADWDEIVMKFTSDLGPALITSPEDENYTYILMPVR 366
200 0.000e+00UniRef50_P52023 Beta sliding clamp n=364 Tax=cellular organisms TaxID=131567 RepID=DPO3B_SYNE7  ali  15  1MKLVCRQNELNTSLSLVSRAVPSR-PNHPVLANVLLAADAGRLSLTAFDLSLGIQTSFAAQVE--RSGAITLPAKLLNDIVSRLPNDDVTLEDNDAAATLSVGSGQYQMRGISADEFPELPLVQSQE-----ALQLSASALIEGLRGTLFATSGD-ETKQILTGVHLKVQPDG-LEFAATDGHRLAVVKTENPATEFAVTVPSRALRDLERMIAIRGSDEAIAL-----YHDQGQTVFQWGDQYLTSRTLDGQYPNYGQLIPREFNRNVAVDRKRLLAALERIAVLA-DQQNNAIRLSLENNRLALAVDAQDVGSGQEAVPA-EIIGEPLEIAFNVRYLAEGLKALNTTDIQIQLNSNTSPVVLSPLGPVKITYLVMPI. 371
201 0.000e+00UniRef50_A0A2H6EX96 Beta sliding clamp n=1 Tax=bacterium BMS3Abin05 TaxID=2005713 RepID=A0A2H6EX96_9BACT  ali  18  1MKFSVPRSEFFKAIQRIIGVVPQKTAT-PILSDVLLSLEENILKIYATDLEILISTEI--TVDGIEDGALAVSSKILGDILRELGDVQIELTEDNHRLRMISDRGVYKIAVDSSEDFPLMPISQLVE-----EFSIPSAKLSRMIDKTIFAVSHD-ELRPALMGVLFQVFE-NEFRMVATDGHRLSRKDFKANVSEKKMIVPTKALNLLLKNISEEPGLIKISFGE-------NYLVFKLNHTEIISRLVESQYPEYEAVIPTANEKKLILNRDLFYSSLKRVSIFS-NLLTKQVRLSLKSDKVELFSQDLDVGGEGMEVLPAEYNGEEMDIGYNAQYVMETIRHIDTEEVMFMLDMPTSAGIVFPTENEELLMLVMPVR 369
202 0.000e+00UniRef50_A0A2T2R5E4 Beta sliding clamp n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2T2R5E4_9ACTN  ali  16  1MKFRAERSEFTDAASWSLRTVGARATL-PALSGVRMEISGDELILESTDLEISSRLVLP--VQSEREGVALVPGRLLGDVVRNLPHAAVEAEMSDDRLHLECGRAKFDLRLMPAEDFPTM----AAPSSDVTPATMKAEDFSRSISQVARAASTD-DHRPVLTGILLESTEA-HLTLVATDSYRLAVRTLPWEHTAVHALVPRRALDEARRVADHLGSDVQLAL-------ENAQATMTFPDRRLTTRLIEGKFIDYRQLLPESWERRLRVNRRELLQVVKRVAVVGANSSATPVTLHITADAVQATAGNGELGEAEETLPG-ELEGEPLEISFNPRYLTDGLEAIMDEEVMLDFRDPLKPAVIRPTDGDSFLYLLMPVR 368
203 0.000e+00UniRef50_A0A140L749 Beta sliding clamp n=3 Tax=Firmicutes TaxID=1239 RepID=A0A140L749_9THEO  ali  17  1MEFVIDKDELLSGISLAERFIAGK-TTMPILSGVKFSAYGSTLELSATDLEMGIECRLPAQI--MEEGDIVISTKALSEILRKLPKGQVLFKCEGGRVYVESGDFHLTMPALESDDFP-----EAVPQQTSPLIKLPKEVFKNMVKQTIFARAEDSIARPVLTGELLELKEGK-FHVVALDGFRIAWRWEELEGSDFSVVVPGKALLELTRAISDGEDFLEIHTGGNR-------VVFRTENTTISSRLLEGKFIDYEQVVEIEPKVTAVANTDLLLSSIERAFVVAREGKNNLIKFNIESNCIKISTES-DIGSVYEKVD-CDTAGEELLVAFNARFFIEALKSVEKPEVEMKFAGEVGPCVIRPLGVENHVNFILPVR 363
204 0.000e+00UniRef50_A0A0G0E1G3 Beta sliding clamp n=7 Tax=Candidatus Levybacteria TaxID=1752719 RepID=A0A0G0E1G3_9BACT  ali  21  1MKATVLSDSLKQRLPTVFHAISGRSQL-PVLLNFLIEAKSGFLTISATDLEIGIVTKIGAKIE--KEGKITVPAKTFFDLISNISEEKLTLEARETTLELKGEHLKATFPTMPAGEFPEIVSDKGKKLA-----SLNKNALFESIAKVSFAASVDS-GRPALSGVLLK-KEAGGITLVATDGYRLSLKKLTNESLSENLLVPSRILKELL-FLRESGEDFDLYVSEK-----ANQIILETKSTILTARLIEAEYPDYQKIIPEDYETKAIFNKEEAQNAVKACSVFAR-EAANIIKVSLKKGKIVFSSSASSVGENEIEIES-KVEGEENEIAFNSRYLLDFLNAVTEEIIELQMTGPLNPGVFKTEKDKDYLHIIMPIR 365
205 0.000e+00UniRef50_A0A0G0R235 Beta sliding clamp n=15 Tax=root TaxID=1 RepID=A0A0G0R235_9BACT  ali  20  1MKVKCHQKDLALALNLVNRAVST-NTTLPVLNNILIKAQGKKIYFSATNLEVAITYFIEADI--LNEGAITVPAKLITNYISLIKEDEINLKLDETTLDIKTAFSHTKIKGIDSSEFPVIPEIQKGE-----QFTIKSSLFLQAINQTSFSASMNL-ARPILTGILFQF-EKDKVVMVATDSYRLSEKKVPIVSKDSNYIIPVKTIIELGKILGGFEND------DVECQLSKNQIAFSVQNLRILSRLIEGVFPDYKKIIPDDGKTNVTLNTQDFIMAVKKVSLFA-EETNNNIKINVNDGKLILSTSETQIGEGVTEIEAI-VKGENNQVAVNAQYLLDILAHINDENIQLIIDNKLSPITIHPAQKKDYTHVIMPLK 369
206 0.000e+00UniRef50_B1XL06 Beta sliding clamp n=10 Tax=Cyanobacteria TaxID=1117 RepID=B1XL06_SYNP2  ali  16  1MKFVCSQSDLNSQLSLVGRAVPSRPT-HPILGNVLLTADANRIQLTAFDLSLGIRTSFPAQV--IEGGTLTLPAKLLNDIVSRLPEGEVTLSCGDAQATLTAATGRFQIRGMGAEEFPELPTIQ-----DGKKLMLPAIALSEGLGGVLFAASPD-ETKQVLTGVHLTHHQD-CLEFAATDGHRLALVETKLPTEDFALTIPARALRELERMLTTANEADLIAL-----HLDDSQVIFEVNHQHLTSRKLDGAYPAYHQLIPRQFSRDVTLERRALISSIERVAVLA-DQKNNIVKFRLNEQKLHLAVEAQDVGSGEEALPA-QVSGTDLEIAFNVRYLIDGLKALPSNEIKMQLNENNQPVIFTPLGAVQMTYLIMPV. 390
207 0.000e+00UniRef50_A0A0T5ZYK0 Beta sliding clamp n=6 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0T5ZYK0_9BACT  ali  16  1MDVTVLQENLLPRLTAVARVASAKSAL-PILENVLLTAEKAVLHLAATDLETGIKTKVGAKVST--EGAITVPARLLVSLITNLPPGKVTLKAEKDILTISAESFSSKINGMPAAEFPNL------ASPGKALFKIPAKDFKEAVTQVSFAAAQD-ESRPILTGILLKLG-GGTLVLAGVDGFRLGEKKISIAGEGLTAVVPARSLGEVSRLV---EGEVEIGLAE------EGQLFFNAPDFLVLSQVLEGEFPEYEQIIPGNFETKISFSKEEMVKAVQLTSVFSDSGTTIIVNFDPQKKILEVSSQEAQQGEARLEIP-ISGEGKKGMIAFNSHYVSDALSALLDEDVTLAMNSSLDPVLLTSPKDKNYRHVIMPVR 360
208 0.000e+00UniRef50_A0A2G9YDJ9 Beta sliding clamp n=9 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2G9YDJ9_9BACT  ali  18  1MQIICLQEKLKQSLNITERII-GRNLTLPILNNILINVENNKLKISSTNLEIGINYWLTGKV--IQGGSITVPARLISDLISNLPNKKIELKVKNNLLELKCDKFKAVLNGLSANDF-----PIIPKIKEKPIIKINGAILRNSLAQVVEMVS-SSESRPEISGVYMKF-DKNLIKLAATDSFRLAEKNIEIKNNQQTVIIPQRTIQEIIRILSDKESEVEIVLS-------TGQILFNMEDVQVISRLIEGKYPDYQQIIPSDFKTEAITNREELINNVKLASLFS--GKINNVKLAVNPQKLEITAKDIDIGENNSQIET-KIIGNAIEVVFNYRYLLDGLNNIFSDKVILGFNTKTNPIVLKPIGDNSYTYLVMPI. 365
209 0.000e+00UniRef50_A0A1F7V493 Beta sliding clamp n=3 Tax=Candidatus Uhrbacteria TaxID=1752732 RepID=A0A1F7V493_9BACT  ali  13  1MKFNCTQENLHRGLALVSH-VASRASTLPILTNILFEATGTSLVLSATNLEIGIRTKVRGKVE--REGKVVVPARLIDECVALLPKENVVLTLEGDALRIQSGSHDNKIHTLPADDFPLLPTIDERIV-----IDVTPTRLAQVLRVTLFAVSFD-DTRPELSGVLI-ATRGGVLTAAATDSYRLAEKTTELSQDIEGVIIPLRTMQEVARALGEEEGVVKIALGE-------HQVSFHMEDTLIISRLIDGQYPHYQDIIPPQYESSATVERAVLEQALKAASLFSMTGI-NDISLTLGEGGIRVRAANIHVGENTTVVPA-SVRGKEVEVVVNWKYLSEGLQSFSAETVNLEVNNTQSPMVVKPQGEKGHLYLVMPIR 371
210 0.000e+00UniRef50_V5RTH3 Beta sliding clamp n=20 Tax=root TaxID=1 RepID=V5RTH3_9BACT  ali  19  1MKFSCLQENLNKGLQIITRAVPAKGSL-PILSNVLISTDNGRIKLAATNLETAITTYVNASID--KEGSITVPAKVLKELVANLHPSTIEIKMDNDILHLKSDNTKSKLNGTDAKDYPELPSISKDE----TSLELDPTVFAQAVSMVTFASSMD-ESRPIFTGVFITYEKGK-MVLAATDGFRLSEKSISVDAKKFTALIPAKTLAEVSKVFASSTSPLKMILSEN-----ENLALFSSEDTTIATRIIDGQYPDYKKIIPTIAPVKAVFNAGEFLEAVRLTTVFVKEGTNNTIKLRVDPGLIKISSLNNETGTHESEIPA-ETEGEMLEIAFSSKYLLDFLNNVKGEKINMEASSNSTACIFKTDVTEDFLHIIMPI. 368
211 0.000e+00UniRef50_A0A0G0NE71 Beta sliding clamp n=4 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G0NE71_9BACT  ali  18  1MEVVVLQEDILKGLMSVSRFVSTRVQL-PILSNILIVADKNTLRLAATNLEMGISYKLGAKIE--EEGAITIPSKVISELMSNLPAGKVRLKADKGQLTVTSNSSSANLSGISASEFPEVP-----ETAEKIDFTINKEILDTINKQVVFSASRD-DSRPILSGVLFSINQDG-LRAVSTDGFRLSCKDIQKNKKDQTVLMPARLIEEVAKLISNSEEEIGVSVLD-----GEKQLIFTTSTATLTGRLIEGDFPDYKRIIPKSTTITARFSKDDLVRAVKITSVIAR-ESSGVVRLKIEKDKLTVFTENPSFGCQEASLDA-KVEGGEVETAFNYKYLLEFLNSATGSEIVFSTNGSTASGVFKDSTDESYLHLIMPIR 366
212 0.000e+00UniRef50_A0A0G1U560 Beta sliding clamp n=1 Tax=Microgenomates group bacterium GW2011_GWF2_47_9 TaxID=1618541 RepID=A0A0G1U560_9BACT  ali  19  1MKIEVLQEELIKGIGVVGRVVSNRAQLA-VLGNILIEAQKTGLRLSGTDLQIGMSIGLPAKVS--ETGRITVPAKVLQEFVGSLAPGRLTLELKQDTLIVEGGSYRGKFQTISAEEFPAIPVLPDNK----AKIIVRQSEFAEMSTKVIFAAAKDS-LRPVLTGILLELS-KTSLRMVATDGFRLSVGKIKAQGADRSVLIPMQAIAEVAR-FEGEEELQIVSVEE------SNQVIFQAGESLLVSQVIDGNYPDYNKIIPKESKSEVVVNREELLQAVRVAHIFAR-ENSNMMKWDVNEKEIVIIAESPERGDSEARVPA-KIDGEGGKIIFNAKFLLDFLSVAKGSEITFGMGEPLDAGVFRSTGDEGLLYIVMPI. 363
213 0.000e+00UniRef50_A0A2E8WB56 DNA polymerase III subunit beta n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E8WB56_9BACT  ali  17  44.KAVIEREELVRGIQAVLDIVPSKSAL-PVLSNILVDATPDGITLSATDLDISIICGVNGEVE--EPGSTTVPARKFSEIIRELPDESIRLEASEGRVSIQSGQGTYALMSVPAEDFPELPSPEMNFGSGDEEEQLDGDLLSQMVAKTVFAVSRD-ETRPVLNGVLWQVREGRT-TMVATDGHRLVKFSKSLPGPETEAIVPPRPLNHLVKLLSSGSVLEQVKFG-------QNHLMFTLSDTCLYTRLIEGPYVDYEQVIPSGNAKKLHVSNSVLAPAVRRVSILASSQ-THQVKMEVDQDKVLLSANSQEIGGEAEEEIEAKYGDDAMAVGYNSGYLGDVLRRIDSDDVVFELDSPVTAGIIRPVEGEDYLCLLMPLR 435
214 0.000e+00UniRef50_A0A1J5IKJ7 Beta sliding clamp n=1 Tax=Candidatus Wirthbacteria bacterium CG2_30_54_11 TaxID=1817892 RepID=A0A1J5IKJ7_9BACT  ali  17  1MKFSCLKSNLNPIVQLASKIISTRPTL-PVLNNVLLKTDRGGVLVSSTNLELSMSAFVGAKVET--EGGITVPAKLLAEFINSIPDEKISLEFKDSRLEVTGANYSAAFNTIDMDEFPEPPAMKGED-----KVLIPVPVLRDNILQVALAAAAD-ESRPVITGVLMVI-DGKKFTLAAADGYRLAEQKVTLSEDSGKLIVPARGLHELHRLLFDAGEK-----DFVEVSFDENQALFKYKDIQLTSRLLAGQFPDYQQIIPKKFASTVTVERAEFSQAVKTAAIFAKDSAS--VIFDPAKKTLELKASTSQVGENNISV-AAEITGPGGSIAFNARYVSDMLAVTTSAKVSLNINDALSPGVLIPDTGAGYTYVIMPIR 371
215 0.000e+00UniRef50_A0A2E5LFK0 Beta sliding clamp n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2E5LFK0_9PROT  ali  21  1MKLQLSKSNFVKSLSFVQNIVESKTTI-PILANVLLEAKQGRLNISATDMDITIFDKIKVN-NIETDGATSVPAHTLYNVIKELPEDPIDLSYDDKKLHLMSSKSKFVFSCLSKDEFPI-----SSTESFKISFDLKADILKEIIDKTYFATS-NEETRYYLNGLYLHSNNKNYLRAVATDGHRLAQYQINMPKDNFGVIIPKKLIFELRKLIDDLKDNIKIDLSD-------RKIRFSFNETVIVSKLIDGKFPDYEKVIPKNTSNTFSIDRKKFLESINRISTISS-EKSKAIKLNLNNDKLTISASNLEEGGSGVEEINIKYSGPSLDIGFNSVYLKEIINQFTLEEISVLFSDSTAPTIIKDGSKSESLYVLMPMR 374
216 0.000e+00UniRef50_C8VV98 Beta sliding clamp n=2 Tax=Desulfotomaculum TaxID=1562 RepID=C8VV98_DESAS  ali  19  1MKFISTKDNLLYAIQTVQKAVSPKS-LLPILSGILFKAYDNTLIVRATDLELGIECFLP--VKVIETGEIVLPSKYIIDIIRRLPDTVIEFESNDNSITIKYKNSQANIHGFAADEFPMLP-----PLNDGFTFLISTSIFKKMLRQTIFATGTD-ENRPVFTGIHFQILE-QEFKMVATDTHRLAMITEHLPQELPGIIVPGKTLSELLKILNSTQDE------EIKITVTENQIFFLLNEINIISRLIKGQYPNYHHVIPKDIIAKIKIKLSDFIQSVERASLLSSSISQH-IRIDCENSDFIVISSNNEAGHIYEEIP-VFFEGEALQIYFNSKYLMDALKAVDSEEIYLELSGPINPCLLR-TEDRNYLSILLPVR 366
217 0.000e+00UniRef50_B0CDM3 Beta sliding clamp n=53 Tax=Cyanobacteria TaxID=1117 RepID=B0CDM3_ACAM1  ali  15  1MKLVCQQSDLNSKLSLLSRVVPS-NPTHPVLANVLLTAQAERLGLTVFDLSLGIQVWIAADVE--ETGALTLPARFLNDIVSRLPNCDIEVETDDTAVTLTCDSGHYQMQGLVAEEFPGLPSLD-----EIPALDLPTDVFLEGLQATLFAASTD-ESKQILTGLHLNTSESG-FEFATTDGHRLAIANFPVTPEPMTMTIPAKALRELERMLGRVNADVALRFD-------TNQAIFELGTERLSCRLLEGQYPAYPQLVPKQFERQVTVERQLLLSSVERIAVLAAR-KNNIIRLKIDEQNVALSAEAPELGMGEERLPA-QISGEDLDIAFNVKYLSDGLKALDSQEVQLQMNSATMPAVLSPLSGRQITYLIMPI. 368
218 0.000e+00UniRef50_A0A1J5IZ32 Beta sliding clamp n=1 Tax=Zetaproteobacteria bacterium CG2_30_46_52 TaxID=1805429 RepID=A0A1J5IZ32_9PROT  ali  18  1MHLKISRAHLFHQIQRCQNIVEKRNTN-PILVNILFETVSNGLKLTATDLQATYSSTQEA--EILEPGKLTVDAKKIFEIVRELPEQMIELKTKPNFLEIFSGGVKFEIAAKSADEFPSEPTDETD-----LSISLPGSELIRMIGSTSFAMSND-ETRKYLTGSLFEVSPEHGIRIVTTDGHRMALSEFNIANQSASCILPKKAVMELKRLAEEAEENIQLSLG-------QHQVRIELNQQRFTSKVIDAKYPVYQDVIPQSNPHTALVDKNLLDQALRRSMVVSNDF-THDVKLIFTDNNLSIAAHNTEQEQAEEDM-VIAYEGTTIEVGFNAKYMRDVLAAVSSQNVRIVLKDSLSPALLLEEGHELSKHVLMPMR 365
219 0.000e+00UniRef50_A0A2H0NIR5 Beta sliding clamp n=10 Tax=Candidatus Gottesmanbacteria TaxID=1752720 RepID=A0A2H0NIR5_9BACT  ali  22  1MHVIVLKENLGKALSIVGKIVSIRPQL-PILSNILLKAENHKLLLKATNLEIGMIYEVAAKIE--KEGETTVPGKLITDFINTLNSDKIEIILDDKKLIIKTNKSHASFSITNPTDFPTFPSLTDQKK------SLPIEKLKGAIIRTVFAASID-ESRPVLTGVKTIIKNGK-ISLSATDGYRLSMIEIPDKKEDLNVILPATSLLEVVRAAQETKNEEVIF----NIIENKNQVVFTLPNISIYTRLIDGEFPNIEKIIPQGFKTKVTINKEEFTRSVKTASLFARN-AANIIKVKIEKQGIRLSANTPQIGENEDFIEA-KVEGEVIETAFNYRFLLDLLANFPDDNVVFESSGSLSPGVFKPEKNLSFLHLIMPVR 366
220 0.000e+00UniRef50_A0A2M6X8Q3 Beta sliding clamp n=1 Tax=bacterium (Candidatus Torokbacteria) CG09_land_8_20_14_0_10_42_11 TaxID=2014298 RepID=A0A2M6X8Q3_9BACT  ali  16  10MKIICTQENLNKGLSTVNKAIP--NANLPILNNILLETKNGSLRLASTNLETGISYFVRGKV--VNEGRITIAAALLANYIGSLASDKVTLTLGDDGLKIETAGDRAIIRGLPAEDFP-FQYALIDKMKKGVMFSVSEAILRNGLSSVSFAAAQD-ELRPEISGVFFNFK-KRSLILAATDSYRLAEKKVGLAAEDLKAIIPFRAVAELLHILENREENVEIFFTD-------NQVLFQFREIGFTARLVEGQYPDYKQIIPQKMTTHVKAGGREFSQAAKRASLFASRE-TNDIRLKIDPGKVLISAESAAVGANQSRLDA-EVSGEPQEITYNHRYFLEGLNNLAAESALFETSGPDEPGIFRPGGGSDFLYLIMPIR 380
221 0.000e+00UniRef50_W2C1F1 Beta sliding clamp n=10 Tax=Firmicutes TaxID=1239 RepID=W2C1F1_9FIRM  ali  18  1MKFRCQQQKLSKALNIVSRAVTSRTTI-PVLKGILLEVNNGKLTMSASDLDIAIKNTI--DVEVVEKGSVVITAKLFGDIIRKLPSSEIEIKSDENNIVIDCLTSEFKVVGMSTDEFPIF----NTKIDVTNSITFDKKSLKTMIEKTAFAASLD-EARGIITGVLIELNEDE-MTMVAIDGYRMAITKKDYTTNPKKIVISVKTLNEISKILNDIDEE-----ENVNLYLNEKKAIFEMGNCKAELKIMEGEFIKYKDILPKDNKIEVIINRSMFLNSIERASLLSKAGKNNLIRMNISENVVTITSNSEE-GNVKEDI-IVTKKGENLIIGFNAQYVIDVLKNIDDDEVKMLLNTPITPCLIEPLEGNEYKYLVLPVR 366
222 0.000e+00UniRef50_A0A0G0YT26 Beta sliding clamp n=1 Tax=Candidatus Kuenenbacteria bacterium GW2011_GWA2_42_15 TaxID=1618677 RepID=A0A0G0YT26_9BACT  ali  16  1MRIICTQENLIKGLNVVSR-LAGKNISLPILNNILIKTEGGLIKLISTNLDIGIKTTLRGKVE--SEGEITVGAKIFTEYVALLTGGNVEISVDNNNILIKTENQQTTIKGQGTDDFPVIPWLE-----SGNEIELGSETLKEGLSQVINSASYNN-VRPEFSGILMVVNKDN-LVLAATDSYRLAEKNIKIVKNNLNQIAPLKALQEVIRICGDGEEPVKIKFGE-------SQIVFGFKETTIMSRLIEGNYPDYKEIIPNGWKTRVVAEKSALTTQIKTASLFSRAGI-NDVLLEFKNNNIIISAANAQCGENKSTVEAI-IEGENNSAVFNYKYFLDGLQNINQKKIVIEVNSSDLPVILRPENDNNYLYLIMPIR 367
223 0.000e+00UniRef50_I0IBA5 Beta sliding clamp n=11 Tax=root TaxID=1 RepID=I0IBA5_PHYMF  ali  17  1MKVICDRRVLIDALALMGGVVLTRTP-KPVLSCVKLSADEPGLTLEATDAEISVRLRSE-RVEVAEAGESLLPADKLSSIVRESIDSTITLATDGDVTLVTGSDSKFKIFGQPVGDFPAVAAFPGEAD-----FRIKAGELHRLIAQTIFATAR-ENSRYAINGVLFE-RAGQQVTVVATDGHRLALAKVAADGGSDEAIVPAKTLNLLLRLFDDAEQEVEVKLADNR-------IHFRTDQAVLASSLVEGNFPPYSDVIPKDGDKKATLPTDGFISAVRRAALL-TNEESKGVRMAFAEGGLTLTSRAPEMGEAEVSLPLADYTGDALEIGFNPAYLLDALKVVDDEKLQFEFKAPNKPGVLR--TGPDFLYVVMPV. 372
224 0.000e+00UniRef50_A0A2N2E918 Beta sliding clamp n=1 Tax=Candidatus Falkowbacteria bacterium HGW-Falkowbacteria-1 TaxID=2013768 RepID=A0A2N2E918_9BACT  ali  20  1MKFISLKENLKQGLSIVGH-LTSKNINLPILNNILIKAKKEGLELISTNLEISISHFLRSKVE--SEGELLVDSRVINEYVSLLPDDKVEIEGVNEELKIKCKNYKTKINTQSGKDFPIIPKIEGD-----SCFFVKTVDFKKAINSVLFSVSNN-ENRAEISGVFFSFS-GGKLVMVATDSYRLAEKTISFKGDSKNVIVPAKTLQEVVRVLSNFKEEDQLELGEIKMCLTESQVLFVIGSSSIVSRLIVGSYPDYKQIIPEKENTRVMVEKGALVKALKTAGIFSKTGI-NDVGVSIKKNKLIIFSSSSQVGENFIEID-VETRGEEVEIFVNYKYLLEGLNNILEQKVVLAFVDNASPCKIYSEEEKSFLYIVMPIR 373
225 0.000e+00UniRef50_H8Z1G9 Beta sliding clamp n=1 Tax=Thiorhodovibrio sp. 970 TaxID=631362 RepID=H8Z1G9_9GAMM  ali  16  1MKIEVQREDLVPALTSVAAVVERR-QTLPILSNLLIKTTEDGFLLTATDLELQISSNIASKV--VEPGAITLPAKKFADVCKALPENRISLEVSDTRGYVRCGRSRFSLSTLPAEDYPGL-----EGEASEQAFEVETAVLARMIERTSFAMAH-QDVRYYLNGLLLEICPG-RLVTVATDGHRLAKAESAVSEDKRQLILPEKTVAELKRLLAGKVGETT------RLEIGDRTVVIRVGNNVVTTKLIDGRYPDYSRVIPTQLQHSALLEREAVKDSLARTAVLSY-EKQKGVRMTFEEGTLKLEVSNPEH-EEAEEEIAIDYQGGSTTIGFNVGYWLDVLNVLDGKSVEVRFLDSEVSAILSDPESPNELYVVMPMR 368
226 0.000e+00UniRef50_A0A2N1TB96 Beta sliding clamp n=1 Tax=Candidatus Peregrinibacteria bacterium HGW-Peregrinibacteria-1 TaxID=2013826 RepID=A0A2N1TB96_9BACT :_  ali  19  1MKFLCKRRDLDYALNVVSKAISPNNTL-PVLNNILIRAEGNQVFFSATNLEIAISCHVDADIKA--EGKTTVPAKLITSYVALLTDEQLELHSGSNVLEINSTTSNTKINCISAEEFPLIPKVDKD-----IEFMLNVDDLGKAINETVFAASMNA-SRPVLTGVYFASME-NGVKLVATDSYRLAESKIDLGNSDFKCVVPGRTLMELGKILMKAEAK------GIKINISNNQILFSVDGVELISRLIDGQFPDYNKIISNESKTVFKVKVEDISLVVKRVSLFAR-ENNNSVKLNVEDGKLLVKSEETKVGEEKGEVL-IESTGENNSIALNAQYLLDVLSYIGDDKVEIKLNDRTSPAHIKPVDRDNYLYIIMPLK 367
227 0.000e+00UniRef50_A0A1Q7X4E9 Beta sliding clamp n=34 Tax=Bacteria TaxID=2 RepID=A0A1Q7X4E9_9BACT  ali  16  1MDVVLDRDAFLKGLQMVHNIVEPR-QTLPILANVLLEADGETVRLTATDLEVGARVSVPARV--ATKGAITVSARKLSEIVKELPAASLSLKVGDNAVTLRCGGVNYRLVGMLPDDFPAL-----VPAAPKAWLAMEAKTLREMLSQTVFAVSHD-ESRFALNGVLFVIQP-KEVRFVATDGHRLAISTRGVGHGLGGVIVPRKAVAEIMRVLGATE--------DVQIAITENQFVMQMPNFVMTARLIEGQFPNYEAVMPRDQPGRLAIARPALAAALRRVSVMA-EERNKPVRLVLNSRSLTLSAASHDLGEAEEALE-VDYSGGEVAIGFNSRYILEALAPMENDDVVFEFKDGLSPGVLRSAQDEGY........ 355
228 0.000e+00UniRef50_A0A1V5KXD5 Beta sliding clamp n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V5KXD5_9BACT  ali  19  1MNFTTSKREFFEALQKVIGVVPQKTTIS-ILTCVLMDLDGDTLNMTGTDLEISITTSL--QVSGHEKGSAAIPAKILLEIVRELPDVPLHIQDDSNKIIIKTEKGEYKIATQPKEDFPKIAVEEGE-----FSFIMDAGLLSRMVEKTIFAVSID-ELRPALTGINIELYP-NEIRLVATDGHRLAKVKVNFPVKKKNLIVPTKTMTLLMK---------NPQSSGVKIQIGEDHVVFYLENSVVYSKLINGAFPNYDRVLPKDNDKELRVNRDLLIAALRRVSIFSSS-LTHQVRLILSSHEMTIRSEDIEFGAEAKEVIPSQFSDEWLQIGYNSNYLMDVLRHVDTEEVVFELKDGNNSAIITPEEGESVLYLLMPIR 368
229 0.000e+00UniRef50_A0A0G1X9Y1 Beta sliding clamp n=2 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1X9Y1_9BACT  ali  22  1MKLEILQENLTKKLGSVTRIIPSKPQL-PILSHVLLSAKNNHLTLTSSNLETTIIISLGAKIE--SEGEFTVPARTLSELVASLPPGKITLQVKQSLLEITISQFHGQINGSPAAEFPPNPTDDLHSVW-----KVNAAGLFQALGQTMFSSATD-ESRAVLTGVLFKF-DSDFVTLAATDGFRLSVVKVDLPEGQSQVIIPTRTLVEITKLLNDENDQITINF------LKSNQVLFSLSDTKIYSQLIAGNFPNFEKIIPAESSVRIKIPSEELLKGIRLAAIFARD-SANIVKLKIAGSKLKIMANAAQVGENESEIDIEKGSGEDFQIAFNFRYLLDFLTSLGSKDVTIDFTTPLAPGVFHLPSDKNFLHLIMPVR 372
230 0.000e+00UniRef50_A0A2H6HFF8 Beta sliding clamp n=4 Tax=Bacteria TaxID=2 RepID=A0A2H6HFF8_9BACT  ali  18  1MRIRAERDDLADVLARAARAVGNRSPL-PILQGLLCEVSGDELRVTGTDTEITIRTTL--KVEVLEEGKTVIPAKLAADAVKRLPSGAVAITAADSEVEITGNGPRFRLREMNVEDFPTLPVGEGGEG-----FSIDSKVFIKALSQVGVAASTD-EARPTLTGVLFEKTDDG-LRLVATDSYRLAVCDLPGVDGPATALVPYRALRELGRSIADDIMQVVITDRD---------ATFTSERGSLTVRIIEATFPNYRQLLPDSYPSRLVVDRVSLVDAVSRASLVA--EDHIPIRFHLRSGGAELSVTRQEVGEETEQI-AGDYSGEEMTIAFNTRYLTDGVQAITTDKVVLDTSDPLKPGLMHGEGEENFRYLLMPVR 358
231 0.000e+00UniRef50_M1ZDB9 Beta sliding clamp n=2 Tax=Firmicutes TaxID=1239 RepID=M1ZDB9_9FIRM  ali  21  1MHLWIDREQLVYAIQTVSRAVSSRVVI-PILAGIKIDADDEKVTFTASDSDLSISYSYPIQVKVEQTGSIVLSARIIGDMVKRLPDGYVEIEEKEHGLVIHSETVEFNLHGMDPEDYPQFPSVE-----DHYHFRLHSSSLRKLLKQVIIA-SSNSDSRPILKGIEWTLKNGK-LSLTATDSHRLAKGTITLSEDDIRIVVPSKNSQELIKLLEDREEEVEILLS-------NTQLLLKAENLFFISRLLEGRYPDTSMIIPKGSKTKITLSTDSLQGSLERAQLIAQHERNHVVRISIENQEIEVYAFFPEVGKFSERIRGVQVEGEEIKISFNVKYLLDALRTVDHPEVELHFSGPVTPFLIHPKESDEILHLIVPVR 377
232 0.000e+00UniRef50_A0A2E4W4M2 Beta sliding clamp n=28 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A2E4W4M2_9BACT  ali  16  1MELVVRKDDLLPELQLIQGIVERKNTI-PILANVLFKAKTNDVEMRATDLEVALFSSCAAKVK--KSGVVTLPAKTLFEVVRALPETNITIKQQGQNTVMKGKKFISSMQTLPEEDFPTLAEPKTK-----QAVKLPGQPLREMIARTKFAI-TGEDTRYFLNGALF-FKDASEMTMVGTDGHRLALVSMKSIKSGKSVIFPKKTLQELSSLLTDNDKEI-------SYQEEENHLFFNVGGRTLISRKVDAQFPAYERVIPKDSDKAVEFERDRLNQAIKRVALLS-NERSSAVTFKIGNDVVDITSSRQDVGEASEKIE-VEYGGDSVQICLNAKYVLDFLSIVETDNVRLEFKNETSQAVMQPVGAEGYTYVIMPMR 377
233 0.000e+00UniRef50_A0A090EAE8 Beta sliding clamp n=3 Tax=Rhizobiales TaxID=356 RepID=A0A090EAE8_MESPL  ali  17  1MKFTVEASAISGALAVASKIVERRNTI-PILSNAFFDATADRLLIRCTDLDLELSLTVPAKVSDA--GQTTVPAHLLSDMMRKIPAGEASFEID-QQMVVKAGRSNFKMHVLPAEDFPVM-----GGADYSHTIEMSGEQLYKLFSSVQFAIST-EETRYYLNGIFFHARAGDTLRAVATDGHRLAKMEMPMPAEADGVIVPRKTVAEIVRL------SQTFADQKVILDVSDTKIRFTAGRNVIVSKLIDGTYPEYDRVIPAVGNKIAKVDAKTLAVAADRVATISS-ERGRAVRFQVTAGDLTLSVINPDAGDAQDSID-IDYDAEPLEIGFNSKYLLDALNALPGKTARISLTDAGSPARFTEDSDETFLVVLMPMR 370
234 0.000e+00UniRef50_A0A2D9SEJ8 Beta sliding clamp n=3 Tax=unclassified Alphaproteobacteria TaxID=82117 RepID=A0A2D9SEJ8_9PROT  ali  21  1MKFSIVKSDFLRPLXHIYSVVEKRXTI-PILSNVVIESLENKIAFTATDMEIDIVEEINANV--INPGKITVPAHTLYDIVRKLTDNEIIMSLEQNNLILSCNKSQFTLPTLPFDDYPVMTKI-----IEGKSFYISSXDLQNLIDNTKFAISL-EETRYYLNGIFLHENRDEVLRAVATDGHRLAQAEINLPEGMSSIIIPRKTVGEVRKLLEDTEGDIKITVSS-------NKIKFLINNCSLTSKLIDGSFPDYQRVIPKENTNNLIVSTRDFKDAVDRVSTISI-EKSRAVKLSLNNNNLVLKVNSHDTGNASEEIE-VSYNKTPLEIGFNSKYLLDVASQIKGKEIQFALSDSSSPALITDPEQEGIIFVLMPMR 368
235 0.000e+00UniRef50_A0A2I8AFL0 Beta sliding clamp n=3 Tax=Cyanobacteria TaxID=1117 RepID=A0A2I8AFL0_9NOSO  ali  16  1MKLVCSQSDLSANLSLVSRAVPSRPT-HPILANVLLQADNNQVSLTAFDLSLGIRTSFNA--EVWQEGAIALPAKLLVDITSRLPEGEITLSTDSNTVTLTPKTGQYQLRAMGAEEFPELPLIENTE-----AIYISATALIEGLRGSLFATSAD-ETKQVLTGVHLTVKQD-TLEFAATDGHRLAVVELEADEQQLEVTVPARALRELERMLAASDEPIALYLD-------QGQVVFAWANQRLTSRTLEGQYPAYRQLIPRQFERQVTVERRQFLSTLERIAVLA-DQKNNIVKLSIDANKLTLSCEAQEMGSGRESMPA-QISGTDIDIAFNVKYLMEGLKALSASEIQMHLNQELTPVIFTPLGGFKMTYLAMPI. 382
236 0.000e+00UniRef50_A0A2E5HPS6 Beta sliding clamp n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2E5HPS6_9DELT  ali  19  1MKVRIARDTLTNELFKVQGVTNQKSTLL-ILNNALLEARDGQLTIHATDLDVSISTSCEC--EVLEEGSVTLQAKRLFDMVKNLRDPELTLETENHHTRLKAGNVNCRFPGTPASEFPEVP-----DHSKVQFYSMGTARLLDMIEKTLFSVSTD-EGRPNLNGALLKSSDGGTLTMVSTDGHRLSRIEMSPAEDARGIIIPRKGLTEVKRTLN-------IEISELLFGLHGNNIVFKHGPATISIRLIDGKFPDVDKVLPKETDKKARVRKEDFIHSLKFVSIVAP-PRTGNIRITFEEGQCEIFTQDTEQGEARE-IVSIDYDGVTVKAGYNYRYLLDVLNVIDGDEITMEIIDTLSPTLIRPRPNCEMLFVVMPMR 376
237 0.000e+00UniRef50_A0A256G0H1 Beta sliding clamp n=11 Tax=Rhizobiales TaxID=356 RepID=A0A256G0H1_9RHIZ  ali  21  1MRVTLDRAQLAHALSTVTKAVEARTTI-PILGNVLLSADKGQLSITGTNLDLEISTSLP--VLDSQDGTVTVAGKLLADISKRATSD-ISLEADGNHLVVKSGKSRFKLDTLPAADFPSF-----NHGSFDTTIEFD---LASLVQEVQFAVST-EETRYYLNGVFLEAKDG-HIVATATDGHRLASTRIEQESSFAPVILPNKLLSLL-------------PTGVVSVSLSSNKVMVERGSTVIVSKLVDGTYPDYERVIPKPSERVATLSAKALREAVGRTSVIAS-ERGRAVRFSFASDALTLNVANPDRGDATEEME-VNFSSEPLTIGFNGQYVTELMAAFSADEVTMSMADSGSPALITSAGRPGYRCVIMPMR 351
238 0.000e+00UniRef50_A0A2W5EGI2 DNA polymerase III subunit beta n=1 Tax=Pseudomonas fluorescens TaxID=294 RepID=A0A2W5EGI2_PSEFL  ali  18  1MKLSISRETLFKALRHMSAVVEKRSSIA-ILGNVRLKAENNRLETTATDNDLSVQGIAEAFVD--QAGTTTVGALKLFEIVSKIPEGMVSLELTDGRLAVVAGKAKFSLATLGAEAFPDMTKVE-----DGVSFKLTATELKKALDRVQFAASTD-ETRAYLNGVYFHVEKVKLLRTVATDGHRLAKADMTCPEDMPAVILPRKCVTELKKLADEAK--------DITLTVSEKKIQAEATDITLTSKVIDATYPDYDRVIPKGNPTQLTVARRSLLQAVDRVSILSH-EKTRSVRFNAIENALALSANNPDQENANEEVKA-EYAGTPIEIGFNAKYLSDIGTQISGDDIHFFLKDASSPVLVKDPADSTTTFVVMPMR 374
239 0.000e+00UniRef50_A0A2H0KYS0 Beta sliding clamp n=3 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 RepID=A0A2H0KYS0_9BACT  ali  18  1MKLSCTQKDLRFALDIVSLAISP-STTLPVLNNILIKAEDQRLFFSATNLEIAINYSIPAEVKN--EGSITIPAKLITSYIALLEDDKVEMKVEDATLHIKSKSSQTKIKGISPEEFPLIPKVEKDTV-----IKIPADVLANSIDYTVFSAATTN-TRPVLAGVYMH-ADKSEMKMVATDSFRLAEKKTKLPTEETECIVPTRTMLELQRILSSKCGN-----EETEIHISKNQIAFRVKGIELISRLIEGKFPDYKKIIPKSTRTKFQTEASHLSMATKRVSLFAK-ENNNSIKLTTNDGKLQIATDETSVGEENAELD-IKMEGENNKVALNSQYLLDVLSHMK-DNVSVEMDEKLTPVVVKSAKKDDYVYIIMPLK 367
240 0.000e+00UniRef50_UPI000839D414 DNA polymerase III subunit beta n=1 Tax=Paenibacillus phocaensis TaxID=1776378 RepID=UPI000839D414  ali  18  1MKITISKQELHEALQHVSKAISGRATV-PILTGVKLDVQTEGVKLTASDIDTTIRAEIPAEVTVLEAGSVVLPAKFFVEIIKKLPKETVDIEVQPGFATITSGKTKLNLVGMDPEEFPATPIGDEDP-----TLSLQGDELKELIRSTTFAVSTN-ETSPILTGVLWELSDG-RLQLTATDRHRLARVAVDGAADFHNVVITARTLNDLTKIISDDEE--------VQISVGSSQVLFRAGRVSFFSRLLDGSYPDTSKIIPTTYQAELEVSAKAFADSIDRAHLLAREVKTNIVRLEVDEGTVRIESTSDGVGKVVEQIDADKFTGDPIRIAFNSKYMLDALKATDSDHLHIGFTGPMSPIIIRPQGGGSILNLILPYR 376
241 0.000e+00UniRef50_R7K7K2 Beta sliding clamp n=1 Tax=Subdoligranulum sp. CAG:314 TaxID=1262970 RepID=R7K7K2_9FIRM  ali  21  1MKLICDGLELSDAIGKVSKALPQR-VVNPVLEGIKITAEGETLTLYATDSEFSVERKINA--EIIEEGEILVPGRIFSDYIKKLTDEQIELETEKNRLRIRYNESEGYLQCLDKDDYP-----DKADINREKGFHILENELKDVINKTLFSASTD-DSRQILKGCLFEI-DEYTLTVVALDGYRLALAKKALEQKSMSVVIPSRALNELSKLLGDGDKIARLFVEENLL-------VVEMENTTVSTRLLVGEYINYRQIIPEEFTTNVIINKQQFEAALDRASLLSRGEKNNLVKFEIKENIVCIT-GNSELGNIKENVS-ISLKGKDLNIAFNAKYISDCLRAMDNDFVKMNFTSSVAPCIITPCETDEYLYLVLPVR 364
242 0.000e+00UniRef50_J9HDM9 Beta sliding clamp n=20 Tax=Alicyclobacillus TaxID=29330 RepID=J9HDM9_9BACL  ali  17  1MRFAISKTALVLAIQTVSKAVAVRTP-KQALTGILLEVREHELIATAYDLQLAIQMRIQSDLTVLDPGSIVLPARYFSDIVRKLPDTQITMQVASNYMTISSGKVQFHLHGIDADEFPELPKFLGITGA-----QIPSSTLARLIETTAFATATS-EVRPILTGISITCKNDE-LTFIATDGLRLAKRVVQADLPNWEAVIPGKSLVELAKILPDNDEPVEIYLTP-------SHSLFVCGQTSFYTRLLEGTYPDTSRLIPTSAKTELVVSGDEMLGAIDRAALIARDRDNNMVRLEMEQDAITVSSSSPEIGNVSETVQVLQRQGEDLQIAFNARYVMDALRALNAAEVNIRFNGPTQAFVIEKTGDSSILQLISPV. 370
243 0.000e+00UniRef50_A0A2E2TVI3 Beta sliding clamp n=1 Tax=Legionellales bacterium TaxID=2026754 RepID=A0A2E2TVI3_9GAMM  ali  17  1MAFQIARSDLIKPLQVVASAVERRQPL-PILSHILMTVKGQMLSLTGTDLEVELVARIPLSSPAAEQ-QLTVPAKKMLDICKALPDSEITVECDGDKITLKAGRSKYALTGLNPQEYPQF-----DEGPGALEFSLPPKKMRALLSQTSFAMAQ-QDVRYYLNGLLFWVKD-NTIRAVATDGHRLATREIEMEGAEQQVIIPRKAVLELSRLLAEESEELGVVLGE-------HHLRVITPRYSFSAKLIEGKFPDYKQVVPKGQAFEAIVNKDKFKEMLQRVSVLFSD-KYRGISISFDSGTMQVKAKNQEQ-EEAEEEIEIEYTGPERRIGFNCSYLLEYLAIVKSPMLKLRFSDPNASVLLEPAEEEGGLYVVMPMR 367
244 0.000e+00UniRef50_A0A2N2GCU0 Beta sliding clamp n=10 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2N2GCU0_9DELT  ali  17  1MEFKINRNTFLDGIQKTLGIVEKKTTT-PILNNVLLKTEHNKLKIIATDREISLISDYDADI--AEKGEITLSAKKLYEMVREIQGEIIHFTKSNNIVKVTCQRAVYKIPGLPADDFPSV-----ADSQNVQFFNIPGSAIKDLINKTSFAMAFD-ESRKNLNGVLLETSTDNHIRMVATDGHRLAVAKVPCPEMAKGIIIPRKGLMEVKKI-TDVHENVSIGIHK-------NMFVVKTENTILKVNLVDADYPDYKRVIPTEKGVGVTLDKESFLHALKRMNVVSS-ERYSGVIISFTSGKMTLNSTNLDVGEATEEID-ISYTGEDMDVGFNVNYVIDAVSVISIDNIIMEVGVGLKPTLIKPAEGDNYLCIVMPLK 369
245 0.000e+00UniRef50_A0A117SY85 Beta sliding clamp n=3 Tax=Acidibacillus TaxID=1765682 RepID=A0A117SY85_9BACL  ali  19  1MHFVIKKNELLTGLQQIVRVIPSR-TTKPILYGVKIDAEFNRVKMTAYDLEIGLEILIENNLQVEEPGSTVLNAKFLLEIVRKLPQQLVRFDMKNRIATIQSGAATYTLNGLDSREFPLLPQVDDDE-----KLSMGCSLFLQAIQKTVYAVAT-IESRPTLTGVHFRLKED-TLTLTGTDSHRLSNLKISVDTSFEEAIMPSKTLQELLRILPASEEMVEITLAD-------HQMLIRYDNIHFYSRLIEGTYPDISRIIPESFRTSIQIGTKRLIESIERAALLARENDNHVIRIHLRPSQTEITSTSQELGKVSEVIEPLSFEGEELLLACNARFLLESLRTIDTEDVSIQFTGPGSAFILKPIEDTNHLQLILPVR 377
246 0.000e+00UniRef50_A0A0G1VWP6 Beta sliding clamp n=9 Tax=root TaxID=1 RepID=A0A0G1VWP6_9BACT  ali  17  1MNVSILQENLLKALSRTGRVVSPKAQL-PIMQNVLLAAGESRLRIVATNLETTEVVSVGAKVE--KDGGICVSSRLLTDLVISLPQETVHLTAKEGALHIRAAGVNATIPGVPASEFPPVSAADGKKG-----VSLEKATLLDALVGVLFAAATD-EGRPILTGIKV-AKKGGAVVFAATDGYRLSVKHLTLSAGDLDLVVPARALGEVFKVSQEEKDAGSVDM----RQTGEGQLIFTIGDTEIHTRAIAGEYPNFEKIIPATHTTRALVDKTSLLHAVKSAAVFARD-SANILRFHIENQLLVVSANTPQVGENHVEVEA-KVDGEGGDIAFNSRFLLEFLSGFTGDELLFEMTGSLNPGVFKPVKDDSYTHIIMPVR 365
247 0.000e+00UniRef50_A0A2E9A2N7 Beta sliding clamp n=12 Tax=Bacteria TaxID=2 RepID=A0A2E9A2N7_9RICK  ali  22  1MKFIVQKSVIFKAMSHVQSIVEKKNAL-PILSNILIEAKDNNIILSSTDMDISITEKIECSI--IENGSTTVNASTLYDIIRKLPENEIELISNDGKLSIRSGSSRFSLGCLPKEEFPII-----EYENEGVKINIDSQVFLQLIEKTKFAIS-NEETRYFLNGLYFNLRKEEKITIVGTDGHRLSKIDYELSDETMGVIIPKKTINELSKLLSESTGQIEINLTS-------TKIIFYINNSVLLSKLIDGNFPDYKRVIPLENNNILKVKRINFVEAVDRVSTINID-KLPVVKFKLLNNLMNISTSNNDNNTATEDIET-DYSGDEIEIGFNSKYVLDMLNNLDDDEIILSFKDNSSPITATEKSNPNLVYVLMPMR 370
248 0.000e+00UniRef50_A0A2E3XLI0 Beta sliding clamp n=6 Tax=Bacteria TaxID=2 RepID=A0A2E3XLI0_9BACT  ali  19  1MKFRCDRDILVEALNTSNKAVTNRATL-PVLNGLHLNLKKDTLVITGSDLDLTITVSL--DVAGESDGTSVVPARLLSDVIRSVESGTVDITVDETDLQVIAGRSEFSLRTIPADEYPLF------EGVNSDPVTVDASLLVSALEQVTPAASSD-DSRPILTGVYM-VAEEKGFRLVATDSYRLAVRDMPGSSGQPPILVPSRALTELARLLEKD--------SEVSLYLGEKEASFEINNIRMTTRLIEGEFPDYKRLVPEDNPNKLTANRGELRDAVKRVRLLAQE--ATPIRLDMGMTGLQLIAKTQDIGEAHETVDA-NYDGDDLTIAFNAEYLLKGLEIAPGDDITLETMDNQKPAVLKSNEHPEFLYLLMPVR 361
249 0.000e+00UniRef50_A0A0Q9YPY0 Beta sliding clamp n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0Q9YPY0_9COXI  ali  17  1MRFLIHREALLKPLQRVAGTVDKRPVQKPILSNILITVKSQLLSLVGTDLEVELISRIPL-AENADAGEVTVGAKKLIDICKALPENQIEFNYQNNKLSLKADRSRYSLACLPADDFPQI-----EQSSADIEISLSQSILRQLLSSCGFALSQSLDTRYYLNGICLSFEPDG-LRVTATDGHRLATLKASCASEAREVIIPKKAVLEMQRLFAEGEEEVGIVIGK-------NHLRTITTGYSFVTKLIDGKFPSYKAILPSAPGETVVLNRELFKNALTRVSALLS-EKQRGVRLHFSHNLLKLITINSDKDEGVEEMEA-SFSGDDIEIGFNVSYLLDYLTAMHTETITMTVIDPNSSALFSCAEGEGFLYVVMPMR 373
250 0.000e+00UniRef50_R7IMG2 Beta sliding clamp n=3 Tax=Sutterellaceae TaxID=995019 RepID=R7IMG2_9BURK  ali  18  7.....SRESLLTPLTTVSGIIET-HQTVPILSNVLIQSDGSKVSFTGSNLEIQIKTH----AELEQEGAFTVSSRKIQDLIKSLPPTEVTISLGSQKMEVSTENSRFSLQTIPADKYPSFPEAD-----FTSSATIPAKQLKYILSMVHYAMA-NQDIRFYLNAVRLVIKDGK-VRVVATDGRRLAFCEITIVSEDVSVTIPRKAVLELKRLLPEEDDDKEI---PVKIDFAANQARFTFNGVEVTTKLLEGTYPDYERVIPTNNDKVFLISREALLQALQRTAVLASD-KFKGVRWLLSPGLLSIQSSNSDQEEGNDNI-AVDYQGDPIDIGFNIDFLSDVLSNLKNDKVKIALSGPQGSALITMPESDDFKYVLMPMR 386
251 0.000e+00UniRef50_D4S3T0 Beta sliding clamp n=34 Tax=Selenomonadaceae TaxID=1843491 RepID=D4S3T0_9FIRM  ali  18  1MNISLAKNDLISALQIVSKGLSTKPQT-PILSGIYMTAKEGQLELQTTNYELGFILTIPA--EIHNTGTAVLPGKYLTEFARKLPAEEVSIDTDDGLAVIQSGAARFTLRTMEISDFPVLHHMDG-----TLHFTIKDRTLARLVKKSAFACLREEDRRPIFTGCQLEV-EGKEITFAATNVHRLAVKSEQLEEDAGQVIIPAKFLEEVTRTISSE------VPADIHVTCSYNQVSMSSGSIYMTARLIEGTFPDYRRVIPREENTKVTLDAASFASAVDRASLIARADQYNIVKLSFTQGLMRISSNSPEIGEAEETIPA-EVTGDDVTIAFNASYLMDALKSLDSDTCILSLQGSNSPMTIREEADPNYIYVVTPVR 378
252 0.000e+00UniRef50_A0A1I3D5H4 Beta sliding clamp n=2 Tax=Bacilli TaxID=91061 RepID=A0A1I3D5H4_9LACT  ali  18  1MKFTIKRTAFLNRLADVQRAISSRTTI-PILTGIKIIADRDGLTLTGSDSDISIEAFIPIQLEIEETGAIVLQARFFNEIVRKLPEETMTVEVLDRQTSITSASASFTINGIDANNYPHLPVIDENE-----SFHLPVNLFKQVINQTVIAAS-SHESRPILTGINIVIENEQLL-AVATDSHRLSQRVIPLSQKTYNVVIPAKSLIELAKTLEDTAETIEMMVTE-------NQVLFKTENLYFYSRLLEGRYPDTNRLIPDQTATSVEFDAHTLLGSIERASLLSHEGKNNVVKLSVNPDRIKISGNSPEVGNVEEEVAFKSMTGESIDLSFNPDYMKDALRAFGQMDIKVKFTSPVRPFILVPAEGKEFIQLITPVR 378
253 0.000e+00UniRef50_Q8DGG8 Beta sliding clamp n=3 Tax=Synechococcaceae TaxID=1890426 RepID=Q8DGG8_THEEB  ali  18  1MKVVCSQSVLSSKLAPLSRVAPS-NPSHPILANILLQAEGGRLGLSVFDLSLGMQIWLDAAVKV--PGAITVSAKLFSEMVSRMPNRDIEITAEDTRVILDYGSGFFEIQGMSAEEFPALPTLE-----DVTPITLTAEALRRGLQGSLFAASTD-ENKQILSGLHVTF-ERDRLEFAATDGHRLAVTEQPVPAEPLSPIIPAKSLKDLERLMAKQDGMVALRCDP-------TQVVFDIGNARITSRLLEGQYPNYRQLIPKTFARQVTVERSALADALERVAILAA-QKNNVVKINIEAQELKLSAEAPQLGSGEENLPA-QISGESMVVAFNVKYLLEGLKVMNSADVQLQLNGETQPAILLPLGEAQMKYLVMPI. 366
254 0.000e+00UniRef50_A0A1V5U2R8 Beta sliding clamp n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1V5U2R8_9FIRM  ali  16  1MRFFVDTNELNAGISTVVKALPARTTVS-ILEGIYMKAAGNTLLLRCSDLSIQIETVVAATVE--EEGTIVLPGKLFAEMVRKLTGEMTSFDVKKNTASIESGRFKTTLQGESGAEFHTMSSVSRD-----LTVTVKPDALKRMVRGCIFAAAQD-DSKPILTGALMEV-DGNGVTLVALDGYRLALRRIEAKGEASNMIIPARSLLEIARVLPDEGGDVSIVFS-------RTHIMTDVGDTNITARLMEGEFIKYKQILPDSHATRVRVNRKDLLEGIDRVALMARASKSNLIKLTIADSLVNITANS-EIGRSVEDVEA-SIMGSDIEIAFNARYFTDVLRVLDEEEIFLDMTNNISPCVVRPVQGDGFYYLILPVR 364
255 0.000e+00UniRef50_E8LE21 Beta sliding clamp n=6 Tax=Phascolarctobacterium TaxID=33024 RepID=E8LE21_9FIRM  ali  22  1MIISCNTNSLNKAIQTVQRAIISKPST-PIFSGIHVIAADNKLEIQAMDLNMAISCTIDA--EISESGEIVVSAKHFADLIRKLPAESLTISKNEEKIKVSSGKSEYQLFLMNEDDYPKFPTFDAD-----RTIALDDGMIKELIKKTIFSCSTD-EARPLFTGILVEAKDGK-ITFVGTNTHRLAIKSLPYEGEELSMIIPSKVLGEISRNLTGE------VPQQVLISLLNNQIMVVIDNIVIVSRLIEGQFPDYRRVIPPKFALTSKVNIKELAGAVERVALFSTDGDYSIIKMSVAADEITITSSSPDVGTGLE-VVSCQTIGDPLNVAFNAKYILDILKNLEAEEAVLSMNTSLSPVCVTCADEPDYTYIVTPVR 366
256 0.000e+00UniRef50_A0A0G0DDP8 Beta sliding clamp n=3 Tax=Patescibacteria group TaxID=1783273 RepID=A0A0G0DDP8_9BACT  ali  20  1MKATILQENLNKSLSFVTKLVSSRTQL-PILSNVLLETESGYLKVSTTNLETSMSFWVGASVE--ETGAITVPAKLLSEIVASFSHEKIILSTDGFNLKLICGDSESTLSGIDAKEFPPLPQ-----TGQQKSIILDKHVLDNGLPFVLISASQD-ESRPLLTGIKFAAKE-EHLEMVATDGYRLSVKELPIKGMEEGLVISAKAMADVFRLIEEKAENIALYISK-----DKNQAVFKLEKAMVATRIIEGEYPVYAKIIPSTFTTKSIFNKEEMIRAVKLASVYAR-EAANILKFKVTKETITISASSAQIGENKTTISA-KTQGEGGEIAFNARFLSDLLNVFPEEDVVFEMNGNLSPGVFHPQKDETYLHIIMPVR 365
257 0.000e+00UniRef50_A0A166MFN5 Beta sliding clamp n=2 Tax=Oleiphilus sp. HI0009 TaxID=1822219 RepID=A0A166MFN5_9GAMM  ali  21  1MEFTIAKNEIINPLQAACGAIENKS-NLPVLGNVLINAKGSELSITGSNLEVEMIAVIH-NVEIKSEGSVTVPAKKLNDICKSFSNDDIKFSLKDGKALVRSGKSRFTLTTLPSDQYPNV-----NLDKNTQNITMQANELKRIIDATSFSMGV-QDVRYYLNGLLLDV-NGNKIKAVSTDGHRLSISEAELTENPVKAIIPRKAISEIAKLLTSGEE--------VTLKVSENQATINVDNYTFTTKLIDGTFPNYEQVIPKGGDKSVKADRELLKSVLQRASILSH-ENIKGVQLTVNHNTLNVAANNQSHEQAEENIE-VEYSGDELTIAFNVNYLVDVMSNLKEDDVSITLSNGSSSALIE-ASNTQTTYVLMPMR 365
258 0.000e+00UniRef50_E0E1L9 Beta sliding clamp n=6 Tax=Peptostreptococcus TaxID=1257 RepID=E0E1L9_9FIRM  ali  20  1MKILCNQKKLAHAITNAQRAINTKTTVE-ILRGILISAEDNKLKVRGYDNEISIETEIEAQVELA--GSIVINSKLIGEIVRKLPDSYISIETDDNNVFISCMSSRFKIKGISAEDFPNIDSIEVGDM-----LKISQADMKNMIRNTVFAAATDN-SNQTFNGELIEI-DSEKINMAALDGYRLATMTNPFKSKNLSAIVPRNTLNHLNSLLSDD--------GDLYIAISPRDVVFKFDNTRLVGRLIDGEYADYKSLLPKEYVTKISVETKKLQEAVERASLLFTSDKNNTIKMTVTDKLLVITSNN-ENGNAYEEI-GVEFEGDMLDIAFNSRYFLDGIKYLNSEYVSIEFLGAINPCVIKPLDDIEYTYLILPVR 364
259 0.000e+00UniRef50_A0A1V5Z3K9 Beta sliding clamp n=1 Tax=Candidatus Latescibacteria bacterium ADurb.Bin168 TaxID=1852850 RepID=A0A1V5Z3K9_9BACT  ali  16  1MRVQMDQSELLGMLQTVIDAVPSKSTL-PILSMMLMAVEEGTCSLSGTDLEVFLTTT--RAVQDAEDGRITFPGRLMFDFVRELPAGPVTITEADGRVTLRSANGECSLLGMPANEFPTVPK----GIEGGVTISVDGDLLRRMIEKTAFAVHPDQ-TRPVLSSICWRV-NPNGMVMVATDGHRLAKISEVVEGDPLQVIVAPRVLQQVERLIRDDNKLESITIGE-------RQIHFAYSGANLVTRLVEGKYVDVESVIPKDNNRRLIVSRDEFQPAVRRMQILSS-QQNHQVRLALHKDELELSTVNRDTGEARERIPA-QYDDEEMEIGYNANYLKEVLSKIDSEQVEFHFREPVSAAIIKPPEGEDYFCLLMPLR 369
260 0.000e+00UniRef50_A0A0P1CZN3 Beta sliding clamp n=32 Tax=root TaxID=1 RepID=A0A0P1CZN3_9NEIS  ali  19  4..LETQRDNLLKPIQAVTGIVERKHTL-PILANVLLESHAGKIRVLATDLEIQIHTQ-GAESE-HGDFRLTTNAKKLQDILKALPDANVQLDWADHRLTLKSGKSRFNLQTLPAEDFPTMNVGDTT----TAAFALPQETLKHMISQVQYSMAV-QDIRFYLNGLLLQV-EGNQLRLVATDGHRLAFASTTIDTDKQDVILPRKTVLEWNKLLNQPKENVIIELLD-------RQVRLRCNDTVVVSKVIDGKFPDYNRVIPMDNNRIVVLNRLALLGALERSSILA-NEKFRGVRLQLSAGSLRVSCTNNEQ-EEAVEELELAYQGESLETSFNISFLLDMLRALSDEDVQIAFGTATQSTLFTLPEQPNFKYVAMPMR 366
261 0.000e+00UniRef50_A0A1F7U8E1 Beta sliding clamp n=3 Tax=Candidatus Uhrbacteria TaxID=1752732 RepID=A0A1F7U8E1_9BACT  ali  17  1MKFSCTQENLHQGLSVVSH-IANKNINLPILSNVLIKCDTAGLKLLTTNLEIAINCVVRGKVEAA--GEFTVPSKLFSDYVALLPKDRVDVSLEGNSLVISCGTYKTTLHGVPASEFPLIPTIDRK-----QRIAVSVSELKKAIGQVLFAVAPN-ESRPEISGVMMRFMPGLRIVLAGTDSYRLAEKVVAADTESVSVIVPSRTVAELIRILGVFKDEAS-GPSQLEIFIGDNQIMFAFNNTEIVSRTIEGKYPDYRQLIPDRFETEVVVEKEELLRAVRTTSLFSRTGL-NDVHLTFRPDQIHLSSRNNQTGEHAVDLEGV-VNGKNNEVTVNFRYFQDGIANIESGGVTLQLIDGMSPCVIRPVKDGDYLYIVMPIR 382
262 0.000e+00UniRef50_I4BZL3 Beta sliding clamp n=1 Tax=Desulfomonile tiedjei (strain ATCC 49306 / DSM 6799 / DCB-1) TaxID=706587 RepID=I4BZL3_DESTA  ali  16  1MLFEIARDMFFEGLSKTVPITEKRSTL-PILSHILLNASNSSLLITATDLEVGLQMMYTCSIS--KEGMITVPAKKIFEIVRELPSGDLTVELQENRIKISSGRSVFELAGMDASEYPVWQAAEEVETA-----TIPSADLIYLIDKTLFASSND-DSRFNLNGVLFERNEGKT-RLVATDGHRLALADGEVLLPESKVLIPKKSLMELKRLLESVKEDVSIGFEPKNM-------VLKTDKFFMTLRLIEGDYPDYRKVLPPPGEKKITVPKTSFLHSLRRVAVLAA-ERNKGIVLDVQPGRIELSATHPDLGTASDVVET-EYSGDPITVVVNVAYLIEALGAIDSEQVSLNFLQEGAPIVISPEPVASYFNLVMPMR 363
263 0.000e+00UniRef50_A0A2A4SVH7 Beta sliding clamp n=1 Tax=Candidatus Peregrinibacteria bacterium TaxID=2030811 RepID=A0A2A4SVH7_9BACT  ali  17  1MKFSVSREQFLHGLNLTSRAVSTNNTL-PILANILLHSEGNKLYFQSTNLEISIRYFIQTDIQN--EGKITIPARLFQNYVNLLHDDEISIHVNGDTINVISNNSKTQIKGIPAQDFPQTPTVERQ-----FELEVPAKKLAEGITQVVFSAATGN-ARPILSGVFLR-GQKNELKLVATNSYRLSEKKITLEKPELQAIVPARTMQELGRIIADSSEKI------VTIIVSDNQILFKVGNVELTSRLIDGMFPNYEQLIPKNAKSNAKVEKSSILQDVKRVNLFARENNNNIVKFNPEESKIHITTEATQIGTEEANILA-NIEGEENEISLNSEFFLDILNALPAGELHLSVTDKFAPILIKHKDMSDYLHIIMPLR 368
264 0.000e+00UniRef50_A0A2A6E0S3 Beta sliding clamp n=1 Tax=Paenibacillaceae bacterium JTherm TaxID=1906605 RepID=A0A2A6E0S3_9BACL  ali  14  1MKFVVLREHLRAAIQQVSAAVSSRPPV-PVLGGICIEAGPSGLTLAASDTDVSIQSSVPLEVSVERPGRVVLPAKLLTDLVRKMPADSVEFESSEGHAVIRSGTSTVQLVGYDPDDFPDLPSPE-----EGRRIVLSSEQLRQMIRQTSFAASR-HDSTPVLTGVLWDVGRD-RIRLVACDRHRLAWSEAKVEEKNENFVILWKTMDELEKLLEGSPSFVDVVFTE-------SRVSFKFRSVSFHTRVLEGTYPDTSKLVPETFRSELVMDVALLIDSIDRASVLTREEKTNIVRLALEEDAVEVSASSAEVGKMSETLPVVSLTGERIKVSFNSRYMLEALKAIGGERVHIGFSGPAAPIVMRPEGGGDVLQLVLPYR 376
265 0.000e+00UniRef50_A0A2P5N1L4 Beta sliding clamp n=45 Tax=Bacteria TaxID=2 RepID=A0A2P5N1L4_METSP  ali  21  1MKFIISRDQLLAPLQQIVSVIEKRQTMA-ILSNVLLHVYENQLTMTGSDTEIQIVSKLNLE-SSTDFGEITVPARKFLDICRLLPNGEIKFELHEDKVKLASGRSRFSLSTLPAEHYPEFNESEFD-----YQFLLNAGKLKKGLDKTIFCMA-NQDVRYYLNGLLLHISN-TRLKLVASDGHRLSIFEDDIGQPEARIILPRKAVQELSRLLEDAEAELNIQFS-------NNHIRIYYKDVVFSSKLIDAKFPDFSKVFNQAFMTPLLIHKQLLRDALTRVAILS-NEKYKGITFDIGDDLLKLSTHNPEHDEAEEELQ-IDYQGQPLSISFNSQYMLDAVSNLDSELAVITIASNASSCFIEEPELPLFKFIVMPMR 366
266 0.000e+00UniRef50_A0A1W9SCB0 Beta sliding clamp n=1 Tax=Rickettsiaceae bacterium 4572_127 TaxID=1971637 RepID=A0A1W9SCB0_9RICK  ali  19  1MQFTITHKDLLKSLSHVVPIAERKSTI-PILTNIKIEA-GNNLVFTTTNTDIETIETVPAQI--IEEGKTTVPAHILYDIARTLTEDEVSFATKDGKMVISAGKAKFSLPMLPADDFPMM-----SGTSLPFKFKISPDDLISLIDKTKFAVS-NEETRYYLNGIYLHVVEKNLLRSSATDGGRLAIYDVPAPEGSKSVIVPKQVIAELRKFLDSSDKDITVEVSETKT-------RFLFENATMTSKLIDGKYPNYLAVIPKGNDKKLIVNTAKFKNCVARMSSVSID-KFQAVKMIIEKDSLTLTANSPEAGTGTEEMVA-SYDGETIEILFNYKKLLDMTNQVETEELEFSLANSTAPAIMKEKGNDHFLYVIMPLR 367
267 0.000e+00UniRef50_A0A1L4BWT0 Beta sliding clamp n=6 Tax=Carnobacteriaceae TaxID=186828 RepID=A0A1L4BWT0_9LACT  ali  19  1MKFTVNRIAFLKKLKDVQLAVSSRTTI-PILTGIKLVADSEGIKLTGSNSDISIETLISATLRIEEEGSIVLPARFFSDIVNKLPDETFSVEVMDRQTAIKSSSSSFLINGLDAANYPHLPEIDTD-----QAFTLPVQLLKTIVKQTVIAVS-SHESRPILTGVNLSLKEGK-LKAVATDSHRLSQRVIPLESFSYNIVIPGKSLQELSRLLDDTLDEITVAIAE-------NQILFKTEDTYFYSRLLEGNYPDTDRLIPETSSTQITLDAQVLLGAVERASLLSHEGKNNVVKLSVSKDEIEITGNSPEVGRVNENVSFKNIDGEEMEISFNPDYLKAALNTFGPVEITLKLISTLRPFVLVPSDDNEFIQLITPIR 376
268 0.000e+00UniRef50_A0A1W9L3G0 Beta sliding clamp n=1 Tax=Beggiatoa sp. IS2 TaxID=1934247 RepID=A0A1W9L3G0_9GAMM  ali  19  1MYFEISKKELLNPLKMLIGIVEQR-QTLPILSMALVKVTAGKLDLTANDSEIELACSLPIDLDSSQEGEITLPARKFYDICRSFSDNTIQVSTEPNKALVKSGKSRFSLACLPAEDFPNSPDLESVRV-----FKLPQRTLKRMLKQTSFSAAT-ADVRYYLNGVCFH-SENSTLNMVATDGHRLAFTKELLINESFQVIVPRKAVSELASLLNDSEEEVEISTDD-------RHIKFIFDHLTLISKLIDGRFPDYAVVIPVNAEKLAVTKGTQLKQALTQAAILS-NEKFKGVRLAFSENLLTISGRNPEQEESVIECE-IEYNNESFEIGFNVQYLLDVLSVISTDEVELHFTDANSSVLITNRHQDDAKFVVMPMR 392
269 0.000e+00UniRef50_A0A1F6R8Q7 Beta sliding clamp n=3 Tax=root TaxID=1 RepID=A0A1F6R8Q7_9BACT  ali  19  1MLFTVQKENIYNALNAVIKATATRG-IQPVLANVLIETDSDQIKLCATDLDISIEVNIPA--EIITTGSITLPAKKLVEIVTKLPNQPIKFDLENNLTEITCGKSKFDLIGISSSEFPTISHIESED-----SIEIEIEPLLKAIKETVFAAAT-YDTNNVLSGIFFQVKD-NSLEMAATDGNRLTRTVKNIDGKEYSIVIPARTLNEFSRILTGTSDE------KVSITIKSAQISFKLTDRVLTSRLLEGQYPKYTQLIPSNYEILAKADKNLLIAALERTSTLV-NERTSIIKLIFNDNQLELLAETPDLGDSSDQID-IDYAGDELKIAFNYKYILDTLKVLDSDNVKIELGTSLSPTLFKPDSDEDYLCLIMPV. 367
270 0.000e+00UniRef50_UPI000646522E DNA polymerase III subunit beta n=1 Tax=Firmicutes bacterium ZOR0006 TaxID=1339252 RepID=UPI000646522E  ali  19  1MKISISRQHFIKAISTVSKAITSKS-VLPVLSGLKVEVDATQMTLTGSNAELTIVTHIPCIIDVQEPGIVILPAKYVLEIVKKVQDEMIQLEVDSGLIRLATASSEFQLNDLAVEEYPVI-----QLITDQPDFHISSNVLKTIIRQTLFCASTS-ESRPILTGVHF-ILEKNELLAVATDSYRLAQKVVPLPKFSKNIVIPAKTLTELMKVLEDEEKIVTIYFGD-------NKVLFTWDDIYLQSRLLEGSYPQTNRLIPTEFHTEVTIDHSALFQAIDRASLLAREASNNVVNLNISANKIEVTSNSPEVGQVRERLTPANLLGEPLRITFNARYALEALRALDGDAVTISFVGELRPFIIRSKNDEKVTQLILPV. 374
271 0.000e+00UniRef50_Q48AS6 Beta sliding clamp n=36 Tax=Proteobacteria TaxID=1224 RepID=Q48AS6_COLP3  ali  20  1MKFSLNRELLLKPLLLVSGAVERKSTL-PILSNILFEVSGQSLTLTATDLELEMVAYAEIQNQGD-DGKITIPARKLLDICKSLPESSISFEVIDETIKLSSGRSKYSLSTLPAVDFPNI-----EEWKGDVEFQLLKSEFLRLIESTHFSMA-NQDVRYYLNGMSIE-SEGNEIRSVATDGHRLAICKISNETPARQVIVPRKGILEIIRLLAPVDEAVQVFLGS-------NHIRIIDSEFSFTSKLVDGRFPDYRRVLPRNGDKVFETNKDALRQVLSRASILS-NEKFKGVRLNFSDTNLKITANNPEQ-EQAEEEIEINFPYGELEIGFNVSYVLDVLSAIKDENVKFTLADANSSVVIEGSSNGEALYVVMPMR 366
272 0.000e+00UniRef50_A0A1V5KMB4 Beta sliding clamp n=1 Tax=Firmicutes bacterium ADurb.Bin467 TaxID=1852894 RepID=A0A1V5KMB4_9FIRM  ali  15  1MRFTCPTPALMEGLQIVTRALTAR-TTNPILEGVLLEAQSGRIQLTASDERLTITTRVDCDV--REFGRGVLPGKLFSEIVRRLPTDTTEVRMSDRFLTLTSGASRLNVAGQDPDLYPALPKIDGD-----CEITLPQDMLRDMIQKTEFAIASD-DAREVLTGCLLEIA-GGDVTMVALDGFRMAYKRAKCSDENVSAIIPGRAVGDIGKLLSGEED----AFATLNFNGNKLQIRLQKTDVYVM--LVDGEYINYRRILPTSFNMRAIVNLEALRRAIDRAALLAREGSNNLIRFYLHDGILEIEANS-QMGDAHEEME-VEIDGSELAIAFNVRYMMDVVRAIDAESVEMSFTSSLSPCVISPVGDGDYVHLVLPVR 365
273 0.000e+00UniRef50_UPI0004F3D3EA DNA polymerase III subunit beta n=1 Tax=Candidatus Hepatobacter penaei TaxID=1274402 RepID=UPI0004F3D3EA  ali  17  1MHIHLDRAPLLKALQYQQGIVDRKVAI-PILSHLLLKTDDGHVEMVGTDLELTLVQKIPA-IDVKEPGSLTVSAHLFYDIVRKYPEDPIVLKFDQNLLSLMCGMSEFHVPTLPEEGYPSL-----DDHQATHTFSLSGKEIKRLIDQTRFAMSG-EESRFFLNGIYLH-AEDNYLKAVATDAHRLALSWVPLPSGAKGAILSRKTVAELRKIVDSDDLVV-------NAEFSQTRVAFSYDDTKFFARFVNGTFPQYDKAIPQANPSTLKIDTRLFREAVDRVSVISSGDKIRGVRLHVEKGVMSLSSKGADSGSAEEEVS-VDYEGTPFSISFNARYVLDAVHQIKGDVFFFHFKDAQTPVVLKDVADDKVLYVLMPVR 370
274 0.000e+00UniRef50_A0A2M7V9E5 Beta sliding clamp n=1 Tax=Candidatus Magasanikbacteria bacterium CG_4_10_14_0_2_um_filter_37_12 TaxID=1974637 RepID=A0A2M7V9E5_9  ali  18  1MKFTCTKENLAYSLGLVGG-VAQKHANLPILLNILFQARESKVELVATNLEIAVKTSFRAKID--KEGSFTIPAKTLLDYVNLLSDEQITIELKDNEVLIFCGSSSTKIKGSSAEDYPVIPEIE-----EIHGYSIAVESFKKALSQTSVATAKN-EIRPELSGVYFDFFSDSGLTMAATDSYRLAEKKISIGEDKISCIVPARAVHEIGRLLGIASQAETE--STVRLWISENQIAVRYDKFEMSGRLVSGIYPDYVQIIPENFKTTTVIPVDDLVKRIKAASLFTAVGV-NAVSFDLNVDTVGISSTNTQTGEHSSEID-VEISGEENSILLNHRYVLDGLQQIDTEAVEFCVNSGDVPCLFRPKGKEGYLYVVMPIR 375
275 0.000e+00UniRef50_A0A2E7ZVF9 Beta sliding clamp n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E7ZVF9_9DELT  ali  18  1MKVRIDKGALFTPLYRAQGVIDRKASTN-VLACVHITAGDGTLTFTATDYDVTMTADVAADV--MESGAALVNGRALFEVVRALPDGDVQLSCDNHRIRIEAGRSYYHLNGLAPSEFPQV-----LEDASGKSLHLDKDQLSNMLRRTLFSVSHD-ESRPALNGVLLEIEPDQSIRMVSTDGHRLSKVERAVEGAEHSCIVHRRGAAELLRIFEGPDQGVRIEFLGRT-------VVFTSDHARLQVRQIEERFPEYNRVIPEQGDVHITVSKTAFVNAIRRVSSLAT-GKHNLLRMDLDDGRMALEMVHADFGDAHEELEIPEYQGSQVEVGFNPRYLLDVCNVMETDSITLELRDQFSPCLLQSEDESGSTFVVMPMR 374
276 0.000e+00UniRef50_W9EEI5 Beta sliding clamp n=368 Tax=cellular organisms TaxID=131567 RepID=W9EEI5_9LACO  ali  20  1MNFSINRVAFIKALNVVQRAISAKTTI-PILTGLKIDVTDHEIMLTGSNADISIQTTIDNELQIQATGSLVLPARFFAEIVKKLPDRELQVDVADQQTTIKSGNSEFNINGLDANGYPHLPEIDHE-----HQIELPAKLLREVISQTVIAVSK-QESRPILTGVHFTLE--KHLLAVATDSHRLSQREVELESPPADFVIPGDSLKELSRMLDDEEDLIKLSLSE-------NQVLFTFGETQFYSRLLEGNYPDTSRLIPNSSDTKVQFAAGELLAAVERASLLSHESRNNVIKLTIKDKQVMITGNSPDVGKVEENLEPQALSGNDLEISFNPDYLREALRVFGSVPVEVAFTSALRPFTIKPLERPDFIQLITPVR 377
277 0.000e+00UniRef50_V5V7W3 Beta sliding clamp n=350 Tax=cellular organisms TaxID=131567 RepID=V5V7W3_ACIBA  ali  15  1MRLKIAKESLLNVLSHVVGAVERRHTLN-ILSNVKIQTNAQALTITGSDLEVELVASTALEGACLEAGETTVPARKLMEICKSLPTAAIDLQTEDQRCILKSGNSRFVLGTLPAEDYPLL----TTENSQGTQVQVTQRELKRLFEKTAFAMAV-QDVRFYLTGTLLEI-DENQLRAVTTDGHRLALCEISTSSQLVQAIVPRKAVGELQRLLSIEDEQLTLLIGRELLNVTINTPSRDKEQVRFTTKLIDGKFPDYRRVIPRGGDKHVLIGHDVFKQSLQRVAILS-NEKLRGVFLNFNQDSLQLRANNPEQDEAIEDL-AIQYQSAPLEMSFNAQYLLDVLGVLDGDDVNMSMTEANQSVLVQDPAHPDQTYVVMPMR 381
278 0.000e+00UniRef50_A0A2H0LXU6 Beta sliding clamp n=4 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A2H0LXU6_9BACT  ali  18  1MKIRILKDDLLENLQIVQNIVNPKNTL-PILSNILLDAQNNNLKMNTTDLDIGILVNVPA--EVFEAGSITIPARKMFEIIRDLPSGAIDLTVKNNMVIIESHKCQFKIMGLPKDEFPKIPSFE-----DKKAVKIEQKIFKEMLNLTYFAVSRD-ETRYILNGVLIEIKQ-NKLKLITTDGRRLAVVEKELSNQEIKIIIPTKTIQELIRNLKDED--------VVSIILGLNQVMFDLSGVLIISRLIEGEFPNYQQVIPQPVDNKITINREEFLSALKRANLLSTTD-YQAVKLEVFKNKMVVSKSTPDIGESKEEV-GIGYAGKEMVVGFNPVYLIDVLKNIKNDDIILELADSEKPGVLR---QDGYVYVVLPMR 368
279 0.000e+00UniRef50_A0A1F2XKK2 Beta sliding clamp n=3 Tax=root TaxID=1 RepID=A0A1F2XKK2_9PROT  ali  18  15.HFVTEKASLLKALAHCQGVVERRNTT-PILAHVHIEAQGKKIKITATDLEIACIESFAAQVHL--SGRTTVSAQLLFDVVRKLPDGEIELKTNEDMLNLRSGRSKYNFACLPAVDFPFM-----TTENLSCTFKLHATELAQLIDKTRFSMSM-EETRYYLNGICFHATADGYLRAIATDGLRLAQAQVELPEEMPQVIISRKTIYEIRKLIEEAAEDITISLSE-------NQVRFVVGSSVLISRLIEGKFPDYGKAIPLDNDKVIDINARAFAESVDRISIMSTD-KLRSIKIQVDSTTLKISAHSSETGNALEELE-VAYKGVPLDFGFNVRYILDVTQQISSGTLEFLVGDETQAIIAKDANDNSALYVLMPMR 381
280 0.000e+00UniRef50_A0A136Q472 Beta sliding clamp n=6 Tax=Clostridiales TaxID=186802 RepID=A0A136Q472_9FIRM  ali  19  6MQFTCAKEDLLTAIGTVNRAASKMQKT--ILECILFSCAEDVITLRATDIALSIKTEMNAQIE--KTGDAAIPAKLLYEIIGRFPESDVTFSVGENSVEISCLNSKVVLQQMNADEFPVFPELENKE-----QIKLPQCALRTMINQTLFAAAVNED-KPILTGLLFDI-EKDSLTIVALDGYRMAVRKQPAISDSKKCVIPARTLREVSRIISETEENVKISIS-------GNMALFEAGNTEIYTRLLEGEYINYRNLLPADCATSVKVETNMLKDSLERASILAREGNNNVVKFEISEKNLEITSNS-EMGNIDEQIPVLT-EGKDLKIAFNAKYVLDVLKNVEESEVLMQYNTGVSPCVVKQENSDAYEYLILPV. 366
281 0.000e+00UniRef50_UPI0003631D9D DNA polymerase III subunit beta n=2 Tax=Sporomusaceae TaxID=1843490 RepID=UPI0003631D9D  ali  21  1MRITCQQDVLNQALQTVQIAVPSKAQI-PVLSGIYLNAEDGCLQLQASDHQTSMIYTMEA--EIAEPGEMVVSGRYFYDLIRRLPSQTVTLSKDSNTLKLVSGRYDYQLLTIPPQDFPVL-----KPQEGRTSFSILDHVLKDLVKKTGFSCSSD-EARPIFTGCLIEINEG-VIQMIATDTHRMALAQVEPSTTTAKMIIPAKLLNEICRIVP--------ANTQIQVHLLDGQVAFVFGSVYLVTRLIQGQFPDYRKVLLTQVQTQATIDTQQWLLAMERIFLLVREGKYNTVRMFFKEDHLSIVYSNPDIGTASESVS-CQLEGNELEIAFNARFLLDILKNIDSEQCTIALNTSLSPAAIRPVGESQYTYIVTPMR 370
282 0.000e+00UniRef50_A0A2F0AMG6 Beta sliding clamp n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2F0AMG6_9DELT  ali  19  1MKFAINRDLFGKALGRIQGVLSRRASL-PVLSNVRLEVDEGKLRISATDLDVTYDGYLLCR--SAAKGSVTVDGKRLYEVVRSLPGEEVDIDVDESRIVLKCKNAEFVLLGTSSDTYPALP-----DAHGVKLFSVDGVGLRELLERSMLSISTD-ESRPNLNGVYFRCLDNNRICMVSTDGHRLSQGERSVDRDAPGVIIPRKGILELKRMLDEAGKEVSFGFLDNN-------IVIASSNSFLFVRLIDATFPDYMQVIPKSSERVIVLDRVPFLDSLKRIGLLAS-ERTHGVRIELTDGLMTLLSDNPEFGKAREEIE-IDYNGGDLIIAFNAKYVIEILSTLGAAKVEMALNEALSPGLFREHQNDEYLFVVMPMR 369
283 0.000e+00UniRef50_A0A134AL66 Beta sliding clamp n=1 Tax=Peptoniphilus coxii TaxID=755172 RepID=A0A134AL66_9FIRM  ali  21  7.KIQIDKSALVSTVSMVLRAISSKTNMQ-ILEGIYMEAKDGQLILRATDTEISMESRHACLVE--EEGSIVLNASLFGDIVRKLPSAMVHMESEGQKLSLNCEQTNFEIMGQNPDEYPQLPELGGSE-----KIVVTGESLLKAFKETQFATSND-DMRIVLTGVLLDVKQDG-ITFVALDGYRMAMSKIKGEQEVVDLILPARSVSEISKLIDENKTFV--------LEIGNNHILIQFDDTKFFTKLLNGEFFQYDSLVRKTHDMELLVERKPFISALERASLMTGKERNGLVKLDIHDDVIEILSNS-EVGKVHETVKAEK-TGKDLTIAFNARYLLEGIRVIEDDTIKMGFTDAVNPCIITPTDGEDYLYLVLPVR 366
284 0.000e+00UniRef50_I0I6B4 Beta sliding clamp n=3 Tax=Chloroflexi TaxID=200795 RepID=I0I6B4_CALAS  ali  21  1...........................MPILGNILIEANDNQLRLAATNLEIGVICWIDARVEDT--GAITVPARLLTEFVNSLPPERIDMEVRTQTLHLRCASVEANLKGIDAANFPIIPTFETDPDIAALQIELGSAGLRKMIDQVVFAASTD-ESRPTLTGVEVTFKEG-RLTMAATDGYRLSVRSAAVEGTPVTVIVPARSLSELARISADADESRPVQV---FVTQERNQILFQFQRVELVSQLIDARFPDYRAIIPKTYNTRTVVDTAALLKAVRVAYLFARD-NANIVRIKINPGHVSLAATSAEMGDSVNELDAM-VEGEDLEISFNAKYLIDVLSQIEEPQVVIETTQPTRPGMIRPVGEDEFLHVVMPM. 372
285 0.000e+00UniRef50_R6AWU0 Beta sliding clamp n=1 Tax=Clostridium sp. CAG:138 TaxID=1262775 RepID=R6AWU0_9CLOT  ali  17  1MRFSVNTRELNEAVSVVTKAMPS-NATLPILEGIYMYAANDTLFIKCTDLSLQIETEIPAIID--DEGSAVLPGKLFSDLVKKFSGDTIDFESDGNTMNIRSRRVKSSIQIQNADEYPEMMRVDDEFSAD-----IPQNKLKSMIKQVIFSVSND-ETKAILNGVCLEFDSDNTLVMVALDGFRIAMRKEKINNGKKSVVIPKRAMQEIAAVLSSDDSEVKLIFSS-------THIKIDFGGTKVISRLLDGEYVNYKGILPKNFATRVLINCEELKNSTERALLMARESKSNRIKLMFANNTLTITANS-EKGNINDEIE-IQLVGKDLEIAFNATYIQDVMRVLDDECVYLNMNNAVTPCVIVPVEGEAFYYMILPVR 364
286 0.000e+00UniRef50_A0A2N1V4P3 Beta sliding clamp n=2 Tax=Bacteria TaxID=2 RepID=A0A2N1V4P3_9BACT  ali  19  1MKITCQTEDLKKTLQAVQRAVANKG-ILPVLSNVLLSSDQESLKLVGTDLEIGIEARLEA--ELNEPVHTTLPAKKWFEIVNKFPDEAITLEFKDGTVSLLGQKLTFHLNTLPADDFPRLPLVQRDKV-----IELNLLEFCQAIRQTCFAAATDS-AKTILTGVNVQIQDG-QLKMAATDGYRLAVRQLTLAGDSPTAIIPRRTLLELEKLVKQDEQESLL------MSLTDNHVLFESQDKILTSRLIEGKYPDYNKILPKQFERKIWLETRPFLAAVERVAIMAS-EQTHVVSFAVQSGSLVISAG-AEQGRAQEEVD-IKSEGEPLTISFNSQYLIEVLRTYAEDHIMLQLNSEVQPVVVSAVDKDDYLCMLMPIK 369
287 0.000e+00UniRef50_A0A1F5CB19 Beta sliding clamp n=12 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1F5CB19_9BACT  ali  16  1MKITCLRENLKEALDHAER-MTSRNTTLPILNHFLLITDKGQLKVSATDLEVGFSAYVQGKISN--DGSLAVPAKLLTQFVNNLPNKKIDLEIKNSSLHLNCESARAVIRGLNPDDFPIIPKIKSTQV-----LIINSKVLKEAFGDVINACAAS-DARPEIAGVYVIIS-SDYIKFVATDSFRLAEKTVFKNDDNYNIIIPVRTVSEVLRIIGDKNQDISIFIDP-------NQILYDFGESRLVSRLINGKYPDYEAVVPKDYETQVLISRDVFEEAIRLASCFTGRLSDVVFKTNSKNGELEVFSNDTDLGEHQTKLKS-DIKGKDVQAVFNWRYVLDGLKNIRSEELLIEFNGGERPAIIRPVGRSDYFYIVMPIK 367
288 0.000e+00UniRef50_A0A2H0W5A9 Beta sliding clamp n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0W5A9_9BACT  ali  18  1MKISCTQENLNQGLMVVSH-IAYKNSNLPILSNILIKVEDKLLTLATTNLEIGVTIQIRSKVE--KEGEYSVDAKLFSDYVSYLPKERVDLELEDDSLKIICEKQKTKIKGQSSIEFPLIPKIEK-----TNPYIVSAKDFKQAISEVVFAVA-NSEARPEISGVFMGL-DSNNIILTATDSYRLAEKKIKLNTNERKIIVPVKTLNEVSRILGIFKDNISLEIENIEIYLSDNQIMFSYNGIDLVSRLIEGQYPDYTQIIPSEYKTLASLNTKDLIKVVKTSSLFTKNGI-NDVKLDLKEKEITITSSSSQTGENISKLES-NITGDDNNMILNFKYLLDGLQNISSNNVILEINNNNSPCVLKPEESDNYIYIIMPIK 375
289 0.000e+00UniRef50_E1R6N1 Beta sliding clamp n=10 Tax=Spirochaetes TaxID=203691 RepID=E1R6N1_SEDSS  ali  21  1MKFTCEKNALLKEISIAQEIISTRNALS-ILSNVLLEADDGSLTIKATDLKVSFETRIP--VEIAAPGSTTVFCDKFLGILRSLPEGDIEVELVDNRVMIRFQKINFQLKSIAGDKFPEL-----QEVSEDLYFEIPQKDLIEMIGQTIFAVS-DDETRYYMNGVYVE-QDGESISMVATDGRRLSLIKRRIESELKEVIIPPKVLQLIRK-LSSGEGNLKIAISDRN-------IFVQFDDQRITSNLIEGQFPNYRRVIPDSQDYQLVVNRDQLEEALKRVSLLV-EQKSRRVYLSVENAMMRLTSEESDIGVAKEELS-CSYEGPETTIALNYLYLAEPLKVMRCEEVVLRFTEANKAITLEPVPEGDYFHIIMPM. 364
290 0.000e+00UniRef50_A0A1E4ZX29 Beta sliding clamp n=1 Tax=Chromatiales bacterium (ex Bugula neritina AB1) TaxID=1868282 RepID=A0A1E4ZX29_9GAMM  ali  19  1MKFSISKLELFPPLQQVVGVVERK-QTHEVMNNILFDAGLDFLELTGTDNEVELRTRIPLIV--TEPGRSTIPARKLFDICRSLSDDKIDFEVNDEKAKVVSGKSRFTLATLPVDEFPVV-----EPLSEPLEVSLSQIDLEKAIKRTSFAMAQ-QDVRYYLN-GLLLELNNNELCCVSTDGHRLALHKTTADPEPISAIIPRKAINELSRLTDGSDTRINLKLTK-------NHLQISLGSLVMTCKLIDGTFPDYEKVIPLASDNKALIDRELLMHALTRSAILA-NETYKGVRLTLENGILGIQTNNPKREEAEDELQ-VDYTGEPLEIGFNVVYLLDVLNAIETESAELNVKDNTSSMVIHPSGDDSSTYVVMPMR 365
291 0.000e+00UniRef50_K2EHK5 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=K2EHK5_9ZZZZ  ali  20  2MKFSIKRESLLKPLQLATGVVERRQTM-PILSHILLTAHGKLLTFIGTDLEVELHGLVNTDHAVKNPAQITVPGKKFLDICRTLPENTIELTENNGRITVACGRSRFVMTSLSTKDFPCVPEQK-----AVMNFELKQKTLRELIEKTSFAIPQ-QDVRQYLNGLLFEVKDGSIQTL-ATDGHRLAVHSIEVDSSFAQVIIPRKCVFELMRLLENPDEEVSVSFNNNF-------VRIKGSNFILISKLISGKFPNYNKIIPKRGDKKVELDCNELKQALTRVGILS-NELFRSVNFKLRNDTLVLTTNNPDQEEAIEEL-TVDYKNENVDIILNIGYFVDILNAIETEKINIFFKTGDSGIVIEEVGNPNCLYVLMPIR 369
292 0.000e+00UniRef50_R4YZ70 Beta sliding clamp n=3 Tax=Actinobacteria TaxID=201174 RepID=R4YZ70_9ACTN  ali  15  1MKFRCERDVLADAVGSAGRATSGRGGALPVLAGLRLRLDGDHLEITGSDLDLTVTAEIE--VAGGDDGVAVIPARLMADIVRALEPGAVNVEVTEDQATITGGRSEFSVNVIPPEEYPQVSEPTAD------SVTLSAEALADGLRQVVPAASND-DNRLILTGVQL-AAEGDGLRLVATDSYRLAVRDLSVLEEGQSVLVPSRALTEVIRSLGDAEE--------VTLVLGAQDATFRIGGVRVTTRLISGDFPNYRGLIPETQANTLTVDRHALIEAVRRVKLMARE--STPIRLEMSHNSLELVAVTQDVGHASERMD-VTFEGEGLTIAFNPDYLLDGLDAARGEEVRVETIGDNKPAVLRGSDADDFLYLLMPVR 362
293 0.000e+00UniRef50_F9UCD3 Beta sliding clamp n=4 Tax=Chromatiaceae TaxID=1046 RepID=F9UCD3_9GAMM  ali  17  1MELVVNRENLLPVLSKVVGVVERR-QTLPILGNLLLSASDDRLDICGTDLEVEVKTSCNASV--LREGETTLPARKLMDICRNLSEGEIRFRQTNERCLVTAGRGRFTLGALPAPDFPLM-----DAEIDGVEVKVPERILREILEKTSFAMAQ-QDVRYYLNGLLVEW-EHSGITAVGTDGHRLAKFHRALDPEPVQVIVPSKTVLELRRQLAPTDEAVSVAVGSKS-------IRVAVGGMVMTSKLVDGRYPEYGRVIPRELGKVARVGNEALKRALARTSILS-NEKYRGVRLAFEEGVLRLQAHNPEQ-EEAEEEIELDYGGESVAIGFNVAYLSDVLGAVEGSEVEVRFSDAGSSSVWRGVGAEDETYVVMPMR 365
294 0.000e+00UniRef50_A0A2M8EID2 Beta sliding clamp n=1 Tax=candidate division WWE3 bacterium CG_4_9_14_0_2_um_filter_48_10 TaxID=1975078 RepID=A0A2M8EID2_9BACT :  ali  19  1MKATVLQENLLPKVAAVARIASAKSAL-PVLENILLSAEKGKLTLAATDLETGIKTEVGAKVE--KSGALTVPARLLVGLIGNLPPGKVTLSAEKDLLTIEAEGISSRINGLAAEEFPAF-TVEGKEL-----FTLKASELKKAIDQVSFAAAQD-ESRPILTGVLLRIG-GGELVLTGVDGFRLAEKKLKVSSEAVTLVVPARGLIEVGRLVEGGEVKVSI--------PELTQLLFQTEEFSIFTQSLEGEFPDYEQIIPTNFETKLTFEKEEFVKAVQLTSIFSERG-TSVIKLSPAKGTAEVSSQEAELGEVKIEI-AIKGEGKVGEIAFNCRYLSDCLGALDSGRIELSLNSALDPALFRAPSDPSYLHVVMPVR 369
295 0.000e+00UniRef50_E3PQY8 Beta sliding clamp n=2 Tax=Acetoanaerobium TaxID=186831 RepID=E3PQY8_ACESD  ali  19  1MKITVNQNELQSAINMTLKGVSNKNTIE-ILKGILFETYEGKLMLTSNNLEIGVQTVIDADIQ--REGKVVIDAKIISDIVRKLPSSDVCLDVDETHVKISSTSLEFNIKGFSGEDFPIPVSIEENYYK-----EISSDIFKEMVRKTSFAVSLD-ETKPLLMGELIEFKN-NSINMVAIDGFRLAIKYIKDDNTDSKIIVPGKTLVDISRMIPPSVDKIKLGFDE-------KHASFIIGETILTTRLLEGEFINYSQIIPKEFSTKLKIHTKDFLYALDRACLVA---KNNLIKIDISDDNLKISSKNDEIGNLEENI-FIELEGSNLEIAFNAKYFMDALKTIDEEYISLELNTNVSPCILKPYDDDSYTYLLLPVR 362
296 0.000e+00UniRef50_A0A1M6T550 Beta sliding clamp n=1 Tax=Alicyclobacillus montanus TaxID=1830138 RepID=A0A1M6T550_9BACL  ali  18  1MHCVVNKNALLNLINNVSRAVATR-TTKQILSGILINLSSNTLIATAYDLELGIQDELSVQTEISEPGSIVLPARYFLDVIRKLPDEKVQIQTNSNYITIVSGHSEFHLHGIDASEFPKLPSF-----LSSNAFKVSSKKLRSLIESTVFATS-SSEVRPILTGLHVEL-NRDFLSFTATDGLRLATKKYPFEEVKISAVLPGKSLNELAKILPDSDEEVVLQLSE-------GHSLFIFGSMHVYTRLLSGAYPDTSRLIPSQWKTELLINRSELLSAVDRAVLILRDKENNKVKMEIQNNEMSMSSNSPEIGNVQEQLWINEKSGEDVQITFNGRYVLDALRNLESETVTIRLNGSNQPFVILENQENGSLQLISPV. 374
297 0.000e+00UniRef50_UPI0009FAB425 DNA polymerase III subunit beta n=3 Tax=Peptoniphilus TaxID=162289 RepID=UPI0009FAB425  ali  21  55.KFQIEKSVLSTIVSTVSRAISSKTNMQ-ILEGIYMEAMEGQLILRATDTEISMESRHTCFVQ--EPGSIVLNASLFGDIVRKLPNAMVHMESEGQKLSLVCEQSEFEIMGQNPEEYPQLPELGGAE-----QIVVTGESLLKAFKETQFATSND-DMRMVLTGVLLDVKKED-ITFVALDGYRMALSRIEGEQAERDLILPARSVSEISKLIDETKT--------LTLEIGNNHVLIQFDETKFFTKLLNGEFFRYNSLIRKEHDVTVVADRKQLIDSLERASLMTGKERNGLVRLEIKDDQIEILSNS-EVGKVHETIRAQK-TGADLTIAFNARYLLEGIRVMDTEEISMGFTDAVNPCIITPLNGNDMLYLVLPVR 414
298 0.000e+00UniRef50_A0A2R3MYP3 Beta sliding clamp n=1 Tax=Lachnospiraceae bacterium oral taxon 500 TaxID=712991 RepID=A0A2R3MYP3_9FIRM  ali  20  1MRFKCDKDKLADGLNIALKAVSSRSTL-PILQSFLLKSAGETVKCIGNDLEMGIEATVPANIE--EEGMIAVNARMFFEIVKKMPDGEITISSDLTTVKIVSGRSEFNINAEDSKEFIMLPQVEKKQV-----LTLPQATLKKKIGQTIFSISLD-DNRKVLQGELFDIV-GDRLNLVAIDGYRISIQSLELKQEESSIIIPGKTLSEIQKILSPEEEE------QVSVYFTDKHVLFEMDQTIVVSRIIEGSFPKYMQMFSEDFKTMVEIDRHKFLYGIERAALLARESKKAPVKLEIKDSRLIITS-NTELGTVYEELEINQ-SGDDITIAFNPRYLLEALKAIEEETVNLRFTIASNPCIIRPEKSEEYKYLILPIR 367
299 0.000e+00UniRef50_A0A1Q3QWG1 Beta sliding clamp n=6 Tax=Acidobacteria TaxID=57723 RepID=A0A1Q3QWG1_9BACT  ali  17  15.EITVSRAELLRELTAAQSVVERKTTI-PILSNFLFEAADDKLTITATDLDQSLRTSCAAKVK--KPGACTIPARKLYDYIKLLPEGDISIKLDNHWVQIRAGRSNTKMVGMARANFPQVPEF-----PASSAVKISVSSLKNMVSKTIFAIS-NEESRYTLNGALL-VLKAESMAMVATDGHRLAHIELEGISGEKKTLIPRKALSELSGLLGNTEAEALEFADDDQT------LFFKVGGRVLTSRKLTGQFPNYEAVLPRDNTKFVIVRSEDLMGSIQRVAQFA-DERSGAIKIRLEQNELKLSSSSTDAGESEDTIETP-YNYDPLVVGFNSQYLIDFLKAINTGEVRLEFKDAQSAGQMRPEEDVKYRYILMPMR 385
300 0.000e+00UniRef50_C1F9N7 Beta sliding clamp n=108 Tax=Acidobacteria TaxID=57723 RepID=C1F9N7_ACIC5  ali  18  1MEISVSRQDLLRELTASQSVVERKTTI-PILSNFLIEADEDRLAITATDLDQSMRTSCAAKVK--KPGSCTIPARKLYDYVKLLPEGDVSIKLDNHWVQIRSGRSNTKMVGMARANFPQVPEF-----PSTGAIAIPVASLRNLIAKTIFAIS-NEESRYTLNGALL-ILKAESIAMVATDGHRLAHIEKSGENFEKKTLIPRKALSELQSLLGNTDAE------SVEFADDDSTLFFRIGHRVLTSRKLTGQFPNYEAVLPRDNNKFAIVRSEDLSRSIQLTSQFA-DERSGAIKIRLEQNELKISASSTDSGESEDVIETP-YSFDPLVVGFNSAYLLDFLKAINTGEVRLEFKDAQSAGQMRPEDGQEYRYIIMPMR 372
301 0.000e+00UniRef50_A0A2E7MPH5 Beta sliding clamp n=3 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A2E7MPH5_9BACT  ali  16  1MRLTIERNELWRGIDTVLDIVPSKPAM-PVLANLLLSAEAGRLSLAATNLDLSIRTDIPASVQ--QPGKVTVPARTFAEIAREWPESELNIEVRDELLLIEGSEGTYSLPGMPVDEFPVMPT-----SLNGFSIALDAQLLSKMINKTGFAVSRD-ETRPVLNGVLWRL-DGEGVEMVATDGSRLARKKVDLDGGSAEVIMPPQACSHLVKLLGGQEEPAKLAVGE-------SQVFFDLGETHLLARLIEGPYVDFAQVIPEQNDKRLQMSNEYLLPAVRRVSILSSS-YTHQVRLTLDGSSLKLSAASQEIGGEAHEVVPVLYDQEEMEIGYNALYLMEILRKMDSREVFFDLNNSVTATLLRPEEGEDYFCLLMPLR 379
302 0.000e+00UniRef50_A0A2M7ASH0 Beta sliding clamp n=8 Tax=Candidatus Shapirobacteria TaxID=1752721 RepID=A0A2M7ASH0_9BACT  ali  18  1MKFSLLEENLNPALTHVSRFVSAKAQL-PILNHILFSTDSGRLKLSATNLEMGINFWVGAKIET--EGSLCLPAKDITEFVSYLPTGKIDFNLDKELLSVKSAKATSTFTTLPPSDFPVIPSLDSK-----TAFDFDLPVLDQSVSQVAFSAATD-DTRPVLTSVLCRFS-ATSLTLVATDGFRLSVKDIKLGNNEITLLIPAKSLMEVLK-LSASSPKIKIGLT-----LDRHQVVFVLEDLELVSRLIEGDYPNYERIIPESSLTKIFVNKNELAQAIRLASVFAR-QSANIVRFSVKKTSLELSANAPQIGQNQISLDA-RIEGGPLDIAFNYKFISDFLAVTKGDEIVIELNEPLTPGAFRDQSDPHFLHIIMPVR 371
303 0.000e+00UniRef50_A0A2D9LDQ4 Beta sliding clamp n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D9LDQ4_9RICK  ali  18  1MKITVERDELLRALNHIQGLVEKRNTV-PILSNILXDVNDNKLRXXATDMIIEVVQSLNCXV--LNTGKTTISAHTLYDIIRKLSTGQVEIMQAGTKIEIKSGKSNFKLPSISPEEFPXM-----DNAKMPFNFLIKSNDLCLLLDRTKFAMSA-EETRHYXNGIYLHVKDKEALIAVATDGHRLAKIKXDKIGNMPSIILPRKAVLEIRKLLEDYEKEVSISLDE-------NKICFSLEALTFSSKLVDGHFPDYSKVIPEGNKNILIVNRKSFSEIVDRISTVST-ERSQAIKISLEKKMLAVSASSPDSGSAVEQL-AVNYDSEPISISFNARYLLDITNNINEENIRLELETPSSPTLIRGEQDTSCIYVIMPMR 371
304 0.000e+00UniRef50_A0A2M8AXJ2 Beta sliding clamp n=7 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M8AXJ2_9DELT  ali  13  1MNFTVDRDLLIDVLTGIQGVAERRHTM-PVLSHALMTIGGGNLTLVSSDLEIVVRCLQP--VEAGEPGSIALPARKLLDIAKVLPESPVTVAKEGNYVEISSGRSHFRLAGLPSQEFPEMP-----EKPSGKTVSIDGDTFRKLSERVVPFASSD-ETRYNLAGILLERAEGSMLRMVATDGHRLAMADGEVGDAARKILVPKKGILEIRKLAENGPGSIELSASEKFLFAAK-------GDTEVWVRLLDADFPDYRQVIPKENPLTVTVGRDAFAEVLRRVAVMAPD-KVHSVKLSFSGKQLEVSSTSPDQGEARDLLEA-EYEGPAMTIGFNGRYLQDAVSGISEETMALQLKDEVSQVILRPEKERNYLAIVMPMR 372
305 0.000e+00UniRef50_A0A2M7RC49 Beta sliding clamp n=14 Tax=root TaxID=1 RepID=A0A2M7RC49_9BACT  ali  19  1MKVILLAENLQRKISFLNHVVPSRSQL-PILSNVLLEAEKGKLKISATDLELGMVTLVSANV--GEEGAITVPAKIFSDLSLNIKEGKISIETSGTNILLKAPGVEATLQTMPSEEFPKIYKEKGDIF-----IKIKKEVLEKEVSRIAFSAAQDG-GRPSLSGVLVR-QDKDGLTMVATDGYRLSLRRLSGKDQSSSVLVPAKVFKELLAI-KEDEDDVTVSISKNT-----NQIIFSQGETVLVGRLIEAEYPPFEKILPTSHSTTVSFERAKLLSAVKICSVFARD-TANIVKFSIGKNKMVVSANTPSVGENKADVEA-KTEGEENEIAFNARYLLDLLGNIDDEDLVFEMTGPLNPGVFKIKDNPYFLHLIMPIR 366
306 0.000e+00UniRef50_A8PQB9 Beta sliding clamp n=3 Tax=cellular organisms TaxID=131567 RepID=A8PQB9_9COXI  ali  15  1MQFTINREILLKPLQLVTAVIERR-QTLPILSNLLIRLNDRNLSLLGTDMEVELAGRITLE-KPGQSGTTTAPARKLMDICRSLPEEELKFQQKGDKLYLQSGRCRFNLSTLPATDFPI--SEALDNHPEQAKFVLSPKGLRSLIESTNFAMAH-QDVRYFLNGMLWEL-DRGSLRAVATDGHRLALKEANITVDNNQIIVPRKAIYELSRLLSDEEND------SLTIFLTKNQLKVAMQDYTFTSKLIDGTFPDYDRVIPKSGDKIFEIDRDLFKASLLRVSVLS-NDKHKSVCLELRRNLLRIFANNLEQEDAEDYLD-IAYHGKDISIAFNINYLIDVLNSLPAGPVKITLTSAEASVRLESKEKDAGLYVIMPMR 369
307 0.000e+00UniRef50_A0A2E9FAN9 Beta sliding clamp n=11 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2E9FAN9_9BACT  ali  19  1MELMFQKEDLSKXLQMLQGVASGRNTL-PILSNILIRAGNGRIEMAATDLEVGIKVNVXG--EITEEGDITVSARKLXEIVRELASEVVKLSTVGNRVQVESGDGVYKIPGLPTDEFPPMPEIDGD------SFTIAGELLVSMIGKTEFAAST-EEARYFLNGLYFSLT-SELTKVVATDGRRLAVASXEAEGESIGVIVPLKAIKEIAKIFVESPE--------VKISLKENQILFADDDATLISRLVDGEYPQYXKIIPDSNEIKIVVDSEKISGSLRRVSLFS-NPKNRLLRVDVKSDGMRVSAKSPELGEAFETLDISSANGE-IDIGFDAQYIKDALAHITPGEILLEFKDALSAVTLRPVESEDHLCLIMPMR 367
308 0.000e+00UniRef50_A0A1C6FK48 Beta sliding clamp n=8 Tax=Firmicutes TaxID=1239 RepID=A0A1C6FK48_9FIRM  ali  20  1MKFECNQQLLTKALNIVSKAVTSRTTI-PILKGILLEVEDGKLKMSASDLDITIEETV--DIESGISGSIVVQSKLFGDIIRKLPNATVSVELVDTNVVIKCMNSEFSIIGLSADEFPSIKNIEEN----QEYITFDKTILKEMISKTSFAASVD-ESKGVITGILIELLND-AINMVAIDGYRMAIREAMVNLEEKNVIISAKIMNEISKILSEASEE-----ENVNLILNDKKAIFIIGNVKVVLRLLDGEFIKYKDVLPKDNKIKVKVNRNDLMESIERASLLSKEGKNNLIKFAIKDTIVTITSKSEE-GNVREEV-IINKEGEDLDIGFNAKYVLDVLKSIDDEEIYMFFNTSITPCLVEPVNGDSFEYLILPVR 366
309 0.000e+00UniRef50_UPI0006D0EEA0 DNA polymerase III subunit beta n=1 Tax=Methylogaea oryzae TaxID=1295382 RepID=UPI0006D0EEA0  ali  16  1MKLNVARADLLGLLQKVMGVVERK-QTLPILGNVLIHSEQGRLSLTATDLEMELIAE-AALPEVSEQLAVTAPGRKLLDICRSLADGDVGLLVEGDKLRLQSGKARFTLATLPVDNFPSF-----EAPAVEERFVIDGSKLRRALEQSMFAMAL-QDVRFYLNGLLLEV-EGTALRAVASDGHRLAYSEQILDAPQKQVIIPRKGVVELHRLLGDWSGEVELTLGGNSLRAV-------IGDTVFSVKLVDAKYPDYRRVIPSDVGRVISVDKESLKQALARVSVVCQ-EKFKSVRFDFTAGTLSLSATSPEQEEASDVVD-VDYQGKPLETAYNGSYIMDALNHCGGESIRFGIADGSTACVIASEGDAASRFVVMPLR 366
310 0.000e+00UniRef50_A0A1W9RRE3 Beta sliding clamp n=1 Tax=candidate division KSB1 bacterium 4484_87 TaxID=1970772 RepID=A0A1W9RRE3_9BACT  ali  19  3MHFTVNRSVMQKGLQKVFGVIPTKTTI-PILENVLLELQGNQLKLTGTDLEICTATEIEVNGDV--DGACAVPAKAFNEILRELPDIPIDVELNDNKVIIKTPNGTYKLTSQPREEYPRIELEEGE-----GQIEIDAKILSRMVDKTIFAVSTD-ELRVILMSVYFQFME-EEFRCVATDGHRLVRYKVKSPNFVKNVLVPTKALSLLLRNLETLEKADQ---TKVNVSIGENHIVFRFEGTFIYSKLIEGEYPKYENVIPLDNDKKLIVNKEEIISAAKRVSIFS-NSFTHQVKFMIQGNKMDISSEDVEFGEGNEQID-VQFDGDSLEVAYNGVYILDLLRHLDTDEVIFKLKDSVSAAIVEPSEGEQLTMLIMPIR 375
311 0.000e+00UniRef50_A0A2E6YKQ0 Beta sliding clamp n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E6YKQ0_9CHLR  ali  20  1MKISCLQENLIKGLSRVQRAVANR-TTLPITQNVLLETEQGRIKLVATNLEIAITSWIPARID--EPGLITVPARLFTDLVNSLPPGQIDIESTEEGINIKTGEVNSQLNGLDPSEFPPIPSVDDGIVC-----ELESQFLKTAIDHVAFAAAT-EESRPVLTGIKVDV-NKNNITFAAADGFRLAVYTGTLETEFLDFVIPSRGLQEVNRLIESTEETVQLTITP-----SKSQAVFHLENAEVVTQLINGEFPPYQTLVPDKHETLAKINVSDFFSASKTASIFARDG-SGILRLLFEPNTITITSKSDEVGESTNTISA-DIEGSKNQIAFNNKFLTDVLGILKQKDIELLVTSSSAPGLIRPIENESYKYVIMPM. 374
312 0.000e+00UniRef50_F0HQC7 Beta sliding clamp n=33 Tax=Terrabacteria group TaxID=1783272 RepID=F0HQC7_9ACTN  ali  19  1MKFSINQSELQNALSVVLKGIATRSTL-PILSGIYLDAHDDTLTLQATDLELSIQYSVSALIE--ETGKAVVPGKLFSEIVKNLPDAAVHVAAEDDSAVITCDTASFSIKTLDAEDFPGFPHVDVQ-----QEVSIPFTQFASMVKRVARVVSKD-ESRAILTGVLITL-EDTTLKMVATDSYRLAITEAELPEEEFQAVIAGSFLQEISSLPRSED--------DLKLALAENQIVVTYHDTVFINRRLEGNFPNYRQLLPDSYATRVSMDVGHLVAGVKRTSLL--GQTSSPVRFDINSQTVQLSAVAQDVGSAQETLS-CEGEGEDVEIAFNYAYVLDGLSSVNTDNVFLEVQSSMKPGIFKADEGENFLYLVMPVR 364
313 0.000e+00UniRef50_D1PRN1 Beta sliding clamp n=33 Tax=Clostridiales TaxID=186802 RepID=D1PRN1_9FIRM  ali  14  1MKFECEKSLLASAIEGVSRAITNRSAI-PVLEGIYLKAEGFNLTLTGYDMEMGITTTIECNVLV--PGETVLEAKLLLSMVSRMPAGDVRIETDEGQAIISGGVAEFEIPALNASDYPSLPV-----TGADNTMTIPTSMMRELIEKTIYAVSQD-DKKPAHTGELFVIEPG-SLTIVALDGYRLAIIQRDVETRDIRIIIPAKTLQELLKIMGGPDDPVKI-------DANRRYVVFTTNGYTIMSRLIEGDFLNYESVIPKDNRTRVTVDCKTFINTIERASLIITERLKNPLRISFAEDKITVRCQTP-LGKVVDEFPPVAMTGDPVEIGFNNRYLLDAMRYSKCERMVLEINGPLSPVKILPEDGKDFIYLVLPVR 364
314 0.000e+00UniRef50_A0A2H0XY08 Beta sliding clamp n=11 Tax=Candidatus Saganbacteria TaxID=1703751 RepID=A0A2H0XY08_9BACT  ali  18  1MEFTCEKKYLQSGVSSVEKIVTTRSTL-PIIGYLLLEAKKNGVKLSANNLEIGIELALNSKVE--KEGAILVPAKTIAGIVAKLPDTKVSFKLNEKGLIIAFGRSNFNVHTLPADEFPVLPKIKAD-----KSFSLSAKLFAAMIKQTIFSVSSSDD-KHVLTGVLLEFGKSGRFRMIATDGYRLAKRVIELADEKGSIIVPAKALQEIARIIELDKEEAEIVIT-----FSADQIAFSFKDVYLVSRIIQGQFPDYRQVLPKKGVTKVLVSRKALLDSAERATVIAS-GSANVVRFDLKENKLHLFASTPDIGTVDEIIDA-EVTGQNVQVAFNIRLVTDVLKVLENEKVIIELSESLGPGLIRGDTEGQYLYIVMPIR 375
315 0.000e+00UniRef50_A0A2H0YC82 Beta sliding clamp n=1 Tax=Parcubacteria group bacterium CG08_land_8_20_14_0_20_38_56 TaxID=2014322 RepID=A0A2H0YC82_9BACT  ali  18  1MKFICFQENLKQGLNVIEKIV-GKNPSLPVLNNVLIITQKDSIKLCSTDLEIGISCWIAGKVE--KEGTLCVPVKILSSYINSLPNKKIEINSRENKLNLKCENYKASIVGFNSEDFPIIPQIKEKEFISLNSFK-----LCQGFSKVIGAVA-SSDIKPEISGVFVKLKKD-FIKLVSTDSFRLAEKTIFFEKPEKSVIIPAKTVMEVIRIFGETEQ----SKSEIDLYLSSNQILFSLPKIHLISRLIEGEYPGYEEIIPKDFLTKVLLERQEFLQHIKIAGLFTTRTNDIKIKVNPAEKSMEFLSSNSDTGENKSEISA-QIEGEKIEIIFNCKYLMDGLMNIDDEQVILELNGDEKPGVLKPYKKGEYVYIIMPIK 371
316 0.000e+00UniRef50_A0A0G0FST0 Beta sliding clamp n=15 Tax=root TaxID=1 RepID=A0A0G0FST0_9BACT  ali  18  1MKIEVLKENLKTGLNIVERVV-GKNLSLPILDNVLMDAEDNFLSLSSTDLETAIKLWILTKI--VKKGKTVVPARFLSSFISLLPNEKIILEEKKQNLYIECKNYKNQIQGYNPEEFPIIPEFKNLD-----YLEINNKKFCQGLAQIVDIASPSQ-TRPEISGIYLFFSKD-VVKMVATDSFRLAEKTLTLENKEYSFIIPQKPAREIINILEEKEGLLKIYFSPSQILFDFPMKEVSHSQVQITSRLIEGEYPPYHEIIPSKFKTRVTLKRDEFLNQIKTASLFS--GKINEIKFNLQNKEIEIFAQSPDIGESR-SILSGKIEGEAIEASFNYKFLIDGLNNIKSSEVCFDLSKEEGPCILRPVGDTSYIYVVMPIK 372
317 0.000e+00UniRef50_A0A1F5KGW0 Beta sliding clamp n=3 Tax=Candidatus Daviesbacteria TaxID=1752718 RepID=A0A1F5KGW0_9BACT  ali  17  1MKISILQQDLLPALQSVARSCGVRASLA-VLANILIQAQDNILKLSATNLEVGVIKVVKASIQ--ESGEITVPAKTLLEIVSSLGTSELELVTEGDQLLITSLHFNAKLNGIPANEFPAIP------LASEKSISVSAKVLALSLPQIAFAAA-SEDGRPILTGVLTEIHKD-ALELVATDGFRLAHKTADLSKEEFRSLIPRRTFEEVVRLIAEEAGGEENALVEVSTSDNQNQIIFKIGQTQLSSRLIEGQFPAWEKIIPQTEAATATLSRTDFLKAVKIASVFARGETANIIKINLAAGKFSISSEARELGGQETQLESVT-EGEDLVIAFNSRFLTESLSACSSSQVKVQFSGSLSPTLIKPLDEPGLEYVIMPVR 375
318 0.000e+00UniRef50_A0A173XV60 Beta sliding clamp n=7 Tax=Ruminococcaceae TaxID=541000 RepID=A0A173XV60_9FIRM  ali  14  1MNIICDKTLLSAAIDGVSKAVTLRSTI-PVLEGILLKAEGFQLTLTGYDLEMGIVTTIEANVK--EPGEIVLNAKLLSSMVSRMPSGQITISADNGKTTIQSGVAQFEIQSMSASDFPELPNTGAEE-----TLTIQTGVLRDIIDRTLYAVSQD-ERKPAHTGELFEILPDK-MTVVALDGYRLAIVERPIKAKDIRIIVPSKTMNEVSHLLANDDEEL------VHICANRRYVVFMTAGYTIMSRLIEGEFLNYHNVIPDGSRTRVTLDTKEFIETIERASLIITERLKNPLRISFTAGKVVVRCQTN-LGRVVDEFNA-QCEGDDVEIGFNNRYLLDALRNARTEQVRLEISGPLSPVKVLPAEGSDFLYLVLPVR 364
319 0.000e+00UniRef50_F9MS90 Beta sliding clamp n=3 Tax=Firmicutes TaxID=1239 RepID=F9MS90_9FIRM  ali  18  1MKVEIHKQDLIGPINTVQKAISGRTPL-PILEGIYFKAENNQITLMGTDGEISIQSTVAAKV--IEEGEIVLGSRLFGDIIRKLPSATIYLTLTEHNLNIRCQQSEFNIMGQSTQEFPQMPEI-----NDPVKIQLARESLVDSLRSTSFAVSLD-DLRMALTGVLLDCKPGK-MSFVALDGYRMALNELEIQSDEIQAIVPARACTEIVRLLDDSLDTILIELAD-------NYIKIDLGSTIFVSKLINGEFFQYQGLVRNDHKINVKLKRQDFVQGLERANLLAKEERSNLVKLDISANEILIESHS-DIGDVHELIP-CTTEGEGLKIAFNSKYLLEGVKAIQEEEIICHFIDSVNPCIIESSEKSGYIYLVLPVR 362
320 0.000e+00UniRef50_A0A258XAW3 Beta sliding clamp n=1 Tax=Alphaproteobacteria bacterium 16-39-46 TaxID=1970490 RepID=A0A258XAW3_9PROT  ali  19  1MKATIGRSELLKALQHAKGIIEKR-TTVPILSNILIEAQGNELTLSSTDLELSIHESLVAE-KVEELGAITVSAQMLYDIISRLPEDSSELSCHQDTVNVKVNRSTFRLGTLPAEEY-----AEIKRVVSPYEFTMKASDLGDLIEKTRYAMSL-EESRYYLNGLYFEVDDKPFLRAVATDGHRLAKAEKNVEGQSPKIIVPQKTISEVVKLLDKGGEVI--------VSFSSRSISFTFGGVHLQSRLIDGAFPDYEKVIPNDNPFFLKVPTKLFADAVDRVSVMASD-KTHTIKLTIQEETLMLSSSNPELGTAFEEVE-VSYAGVPFETGFNARYLLDAARHVKGDMLSIALKDPGSAILLQDEKDPGLSFVVMPMR 381
321 0.000e+00UniRef50_A0A1W2BCY6 Beta sliding clamp n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1W2BCY6_9FIRM  ali  19  1MKFNCNKSDLIDAISIVQKAIKTNSTVQ-ILDGILIQADENGVKLTGYDLETGIEADLVSDVK--ENGSVVVNSRFFGEIVKRLPEEMTTISSDDNQVTILSGSANSVIKGNSAESYPKIPIIDNKD-----RITVSQKLLKNMINHTIFAVSKD-DTRQSLTGCCLE-SDGKTISMVAIDGFRMALRREDAGSDFPNFIIPGKALSEASKIFDGENDD-----NEVIIYSSSNHLLFDVGHVRIVSRLIQGPFVNYNSIIQKNPKSIMTVSRKDLLDAVDRAALIITDERRCPVQLTMSDDTTLMVSANTETGTHKEDID-VTVEGDTVDIDFNSRYLIDALKNIEDETVRIEFNGSQGPCIIVPTEGNSYVYLILPIR 368
322 0.000e+00UniRef50_A0A1X6W6T2 Beta sliding clamp n=1 Tax=Chlamydia abortus TaxID=83555 RepID=A0A1X6W6T2_CHLAO  ali  20  1MKLTILKDQLSESIQHVSKAISSRTTI-PILSGIKIDATPKGVMLTASDTDISIQSFIPLNVQLVQTGSVVLPAKFFMEMVRKLPSEQIEIEAENHQTIIRSGTAEFQLVGFDPEEYPLLPQVDEEKV-----ISMSSDLLKAMIKQTSFAVSTS-ETTPILTGVLWSLTENN-LKLIGCDRHRLASRESQIDTPPDQVIISGKTLSELNKILPDHNSLIDIVFTE-------TLVLFKLSNVLFYTRVLEGVYPDTSKLIPQQFQTEMVIKSKSLMDAIDRAYLLTRENKANIVKLVMNDDQIEISSSSSDLGKVKEVLPVSSHSGNLLQISFNSKFMLDALKVIDSEFVHIGFTGPMNPIVIQPEDGTRILQLILPYR 377
323 0.000e+00UniRef50_A0A1C2G1Y9 Beta sliding clamp n=2 Tax=Acidiferrobacter TaxID=986106 RepID=A0A1C2G1Y9_9GAMM  ali  18  1MRMSVTRDDLLKALNVVGSVVERR-QTKPILTHVLVAAGDGEIVFTGTDLELEVVARCPADVQ--EPGKVTVSGRKFLDIVRTLPSDSVRCQTEEGRFRVAMGKSRFQLATLPVEDFPNL-----MDIQWDTTLSVARGDLRRAIEKTQFCMAQ-QDVRYYLNGVMLEMS-GQALRAVAADGHRLALCAVEMGSGERQVIVPRKAVVEMARFLGDGSLPIEVSLSGNHMRVAQDHLVF-------VSKLVDGRFPDYHRVIPQAVKNEVVLPRAAILEMLGRVGVVST-EKFRGIRLRFQGNRLAASATNTDRDEAWEEL---ELTGPELEIGFNVTYLVEAIGALEDEEFLFGWNDSNGGVRLKAKKGDDQVYVVMPVR 366
324 0.000e+00UniRef50_D3EYQ5 Beta sliding clamp n=11 Tax=Actinobacteria TaxID=201174 RepID=D3EYQ5_CONWI  ali  19  1MKISAAREELLAQLQTVSRVASTRGAIQ-ALSGVQLIAAGGRVELRATDMEVGLRVPLPAEIE--REGSVVLPARLIVDVVRSLPTATLELRPAEQDVELVAGNAQFHIRTLRAEDFPPFPEPESEGV-----VSVPAKAFVETVLRVANSASRD-ETRPVLTGIMVSASE-RELRMVATDSYRLSVKETTLEEPGFEANVPARALQELARLVQQIDGE------QLSVGVRQNQVVFQIGEVVLSSRLIEGQFPNYRQLLPDSYEHELTITGSEVTDVVRRISLLAQ--KNAPLRLSFAPGELTVSAQTPDIGEARESLP-VAFQGEPFEIGFNPDFLRDGLESVGSGDVMLKLISPLRPGLIQSAEDGGFLYLIMPIR 366
325 0.000e+00UniRef50_A0A2M7ILD2 Beta sliding clamp n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M7ILD2_9BACT  ali  18  1MKVICTQENLTKGLNITSH-IAGKNITLPILNNILIKIEQGKFNLISTNLDIGIKTSVRGKVE--EAGEITVPARLFSEYIALVSSGNIELTRKDNDLVIGAGEQQSVIKGQGADEYPIVPEIEGVE-----YFSLETMEFKEVLSQVIFSASY-EDIRPELSGVLF-LSQDDKLVFVATDSYRLAEKIISLGKENEKIIVPLMVLQEILRILGDNQGKVEIGFNE-------NQIIFKFDETVIISRLIEGNYPDYKEIIPSEYRIRAMVDRNSLIKIIRTASLFSKKGI-NDILLEFNSKELKVSAANMQLGENKATI-GIESEGENNSVVFNYKYLLDGLQNMPSKKIVFELSSSDSPVVLKPEGIKDYLYLIMPIR 368
326 0.000e+00UniRef50_A0A0G1ES34 Beta sliding clamp n=12 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1ES34_9BACT  ali  15  1MKFFCTKENINNGLALVGH-VATKSTSLPILNNILLKTTPGGLQLTATNLEVAITTIIRGKTEG--EGNITVQGKLLIEAAALLPDDKVELLVDNGSLTITCGRSRTVIKGAPAEDFPVIPQING-----GNKFIIPTQKLAEAVSRVVFTVNPD-EGRPEISGVFLGNVSKKTV-LVGTDSYRLAENTLGESKNPEGLIIPLRTAQEVGRISQSSD------IEQIEVVLGDNQVLWQIGETQIISRLVSGQYPDYLQIIPKEFSTTAKLNREALQQAVRAASLFVRSGINVRLKFKVSDKTVLVSSTNSQLGENTTEV-GAEIDGEETEVIFNYRYLLDGLSVIPGREIKIKVAGPNSPSLFEPKDGTDYRYLIMPIR 367
327 0.000e+00UniRef50_A0A0G1X8U6 Beta sliding clamp n=4 Tax=Bacteria TaxID=2 RepID=A0A0G1X8U6_9BACT  ali  17  15..VSVVLDKIKGALQGVERVVSSRSTL-PILNNVLIRTSKNGVEVMATDLEIGLRFFLGGKVE--REGVITVPGRTLVSLVNSLHGDTLSLESKGNILQVSCGETRASINGMPADDFPVIPEVEGGKV-----VKVKSEQFKNLLSQVDFAASG-EDSRPVLTGVYL-IYDGGTLTAVATDSYRLSEAMAKDKGEDFNVIIPARTLQEVRRLVGEA--------AEFELRIGENQIMVITDSATLVSRIIEGEYPNYKQIIPPTSETTIEMDVQEFSDAIKTAAIFSMEG-SNTVRLNVASGLVEVVSESSQVGNFTSKLKA-EVKGPGGEISFNAKYLLDGMNSFDTPRFTLGMTGKTAAGVFRPSGVEDRLYLVMPLR 374
328 0.000e+00UniRef50_A0A1M6AM81 Beta sliding clamp n=2 Tax=Dethiosulfatibacter TaxID=448125 RepID=A0A1M6AM81_9FIRM  ali  20  1MKCNVNQSDLSKAIGIVQKAVSVRTTT-PILTGILMEVENNKLSLTATDLDLGIKTTIDCQ--SSEDGAIVANARLISDFVRKLPSKSIEITTDENKMDIKCMKSDFVILCNSADEYPS-----NTFYNEGMSINMKSQALKRLIKYTTFAAAQDN-MKPVLTGCLMELEQ-NVCTFAAIDGYRLSVKKEEVEDGECNIIIPSKSLLEVSRILEDEDQDVEMLVSE-------THVSFVFDDTVIISNLLEGEFIKYKDIIKDGYQTKINIKTIDLKNSIERVSLLAREDKNNLIIITIEDDNLKIESTS-EYGNAEENIE-VQMEGDDIKIGFNSKYILDLLRVVEDDELSAIFQGSLNPCIFKLPENEEFIYLVLPVR 364
329 0.000e+00UniRef50_A0A2L2X9A7 Beta sliding clamp n=3 Tax=Peptococcaceae TaxID=186807 RepID=A0A2L2X9A7_9FIRM  ali  20  1MKFFINKENLLYAIQNVQRAVSPKSPL-PVLTGIHFKCAGDKLVLSATDYEISIRCSVPATVE--EEGSLVLPARYITEFSRRLPDTVIEFETGNNMAVIRYGNSEFNINGYDAAEFPPFDIPEG-----YFSFKLDSDIFKEIVKQIIFAVSSD-ESRPVFTGVLFEI-EGDTLTLVATDTFRLALRKLKIETELINIIIPGKTLNELARTADQK--------GSVDVVIGKTHTAFITEDTLILARIIAGKFPSYRQVIPDHFNTEIKINLKELLESAERASLLAG-ETNSLVNLQAREDRVVLNIRS-ETGWIREEVNSES-SGENMEISFNARYLCDVLRAINYERLQLKLTGSLTPAMIIPEENQDYLSILVPAR 364
330 0.000e+00UniRef50_A0A285N1D6 Beta sliding clamp n=1 Tax=Persephonella hydrogeniphila TaxID=198703 RepID=A0A285N1D6_9AQUI  ali  20  1MELVIEKSDLQNVLKKAISATEKKSAL-PILSNFLLEAVDDKLIVQGTDLEVHVSVSVFAKIE--KEGKACVNAKKITDISRLLPSNEVYIKLEDSVLKIKSGKTKYSLPVVPSEDFPMM-----YPFPEDNAFVVSGDDIQKAISKTSYATSK-EETRYALQGVLFKSLDG-TIDVVATDGHRLALYTINRNGGDVEIIVPQKALNELKKLLTGLE--------DVEMAASDQYVFFRTKEWILMSRLLEGAFPDYTKVIPQDFNIEIKLDKKEFLDAVKRVSAVI-EGDPKPIKLTLKENTLQLLSKSSEYGEAVDELS-VDYTGEEFSIGFNARYLIEAVEVIDGDTVIIRFTTPNAQTLILPKDENDYKAIVMPM. 361
331 0.000e+00UniRef50_F6DB38 Beta sliding clamp n=13 Tax=Piscirickettsiaceae TaxID=135616 RepID=F6DB38_THICA  ali  16  1MKLTLNREQFLKGLQTVAGVVEKRQTM-PVLGNFLLQINGQHLTLTGSDLEIESRAQVVIDQLEGDAFDITLPAQKLLTIVRSLPEGSVNLTFEAQRCTLTAGRSSFKLSTLPAADYPHL-----DLSRVELALQMSQAQLKQMLAQTSFAMA-SQDVRFYLNGMLFDVSP-QALRLVATDGHRLSTTALEADLTPMQVIVPRKGIVELGKLLQASDDLVELAFAK-------NYLTVKLADIVFTCKLIEGRYPDFRRVIPQNNEVAVQTDRELLRAILQRAAILS-NERFKGVRMVIDNNLLTVHAQNTEQDESNEDM-AIDYLGDKIEIGFNVSYLLDVIQAVKDDHIVLSLKDNSSSCLISTADGITAQHVVMPMR 368
332 0.000e+00UniRef50_A0A1U9NHA1 Beta sliding clamp n=11 Tax=root TaxID=1 RepID=A0A1U9NHA1_9BACT  ali  18  1MKVKFNRAALQEALGLVTSVVPSRTP-KPILQCVQIKTEVDAVTVCATDLEVGINYQV-TQVEIEEQGEIVVPADKLSSIVRESVDEVIAIEESEATVEIKGADSHFTIYGHDADQYPSVPGFEGD-----AHFTISLGKLQEGIELTVFAAAK-ESTRYALNGILWEV-EGKKLTLVATDGRRLARCAVNLDTPDGRIIVPAKTMNLLDRVGGSADTKVSVRFVD-------NQIVISCGQVIISSNLVEGNFPKYEDIIPKDYTNSIGLNTDAALSAVRRAALLS-NEDSKGIKLALSDNKMTFSSRAPETGDAQVEM-TIDYSGGEMEIGFNPAFLIDVLKVIKADDFKLELGDSERPGVIRS--GDQFLYIVMPV. 365
333 0.000e+00UniRef50_A0A226BX27 Beta sliding clamp n=1 Tax=Natranaerobius trueperi TaxID=759412 RepID=A0A226BX27_9FIRM  ali  24  1MKLKIHKDRLMEALQTTQKGMASKNTI-PHLNGFYLETEEETLSIITYDLEMGIKYYLP--TEIIEQGSVVVPSK-FFDIIRKLPEDQVTISLNKENVSVESGQAFFEIKGLDPQEYPKLPKIKEN-----NYFSLPEIALRKMIYQTSFAVSK-EETKPAFTGVLFKFSNSDKIDMIATDSYRLAWRNGKIVNDEGEYIVPEKALSQLQKVVGEEDTLVKLYLSNGYFYC-------ETENVRLFSKLIDEQFPNLDQVIPQNYQTKVVVDTKILQNSMERASLLASEGSNNIVKLNITEDNLEITSNSPHTGKLKEDLSIYK-EGDNLSIALNSKFVIEVLKVLEEDQVELEFTGSYSPMIIRPKDNSQYFHLILPVR 371
334 0.000e+00UniRef50_A0A2M6WXI8 Beta sliding clamp n=1 Tax=Candidatus Berkelbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_41_12 TaxID=1974513 RepID=A0A2M6WXI8  ali  22  1MKIRCKKSNLQRGLSVVSRIVSTR-TTLPVLGNVLLRAQDGRLDMTSTDLEAAMNVEVSAKIE--QDGSITVPLKTFMDFVLTVSDEEMAIDTSGADVLVKSSHYSVNIKGIDASEFPIIPKIENPKI-----FKMKSLALKKSLPKIIFAAALD-ETRPVLAGVYMKMS-GNKLVLAATDSYRLAEQKLETQANESTVIVPSRTLAELERILPESDEAVEIKMGE-------NQIEFATGSILFMTRLIEGAFPDYEQIMPKKFESEIEINKNEFGEALKVAGIFAR-ESSNNIKIAVAADAITLKAASANLGQTEARVKA-QVKGAGLEVAFNGKYILDAIANISGETVALGLSGKLSPGMLTSGSEKDYRYVIMPLR 363
335 0.000e+00UniRef50_A0A1I6HQS5 Beta sliding clamp n=1 Tax=Thiomicrospira sp. ALE5 TaxID=748650 RepID=A0A1I6HQS5_9GAMM  ali  16  1MKLILNREHFLKGLQTVAGVIEKRQTM-PILGNVLLQVNGHHLTLTGSDLEIESRAQVAIDQVDGEAFDITLPAQKLLTIVRSLPEGSVSLDFEGQRCTLKAGRSLFKLSTLPAADYPHL-----DLSRVEVALQMSHTQLKQMLAQTTFAMA-SQDVRFYLNGMLFDVSP-QALRLVATDGHRLSTAALEADLKPMQVIVPRKGILELAKLLLASDELVELAFAK-------NYLTIKLADTVFTCKLIEGRYPDFRRVIPEHNDVLVTTDRELMRATLQRAAILS-NERFKGVRMVIESNLLTVHAQNTEQDESNEDM-AIDYIGDKIEIGFNVSYLLDVIQAVKDEHIVLSLKDSSSSCLIATTDGISTQHVVMPMR 368
336 0.000e+00UniRef50_A0A2I0N1G4 Beta sliding clamp n=2 Tax=Clostridiaceae bacterium JG1575 TaxID=1658742 RepID=A0A2I0N1G4_9CLOT  ali  17  1MNLRVNKKDLVDGISIVQKAVSSKSPM-PILECICLEAKDQRLILRGSDVELSIETSF--TTEIAEEGAIAINSRMLGDIIRKLPNGVITLETENNTVIISAEKSVLNLLYMDASEFPVFPTVE-----DAVTLSLQQKDLRIMVRRVLFSVAQD-DSRPVLNGMLLEGENGN-LNMVGLDGYRMALATTSIPEPEVRRVISGKALRDVLSILTDNDEEVRLVFAE-------NHVLFEMGATKIISRLLQGEFLKYRNMIPDYHKLSVILDRQEFFEATERASVLANDGTSNLIKMQFTDNSVVLSSHS-KLGKLREEVYA-EMDGEAMELAFNAKYILDILKTIEDEKIVMDLTSALSPCLIHPEGSTDSMYLVLPVR 363
337 0.000e+00UniRef50_A0A0X8X6S0 Beta sliding clamp n=1 Tax=Halorhodospira halochloris TaxID=1052 RepID=A0A0X8X6S0_HALHR  ali  17  1MKLQAQRENLLPVLQHLVSIIDRK-QTWALLNNILIKAEDNGLRFVATDMEVELVANIQADV--TDNGMVTLSSRKLMDICRNLPEESLDIELSGNKVLLTSGKSRFNLGTMPPDEFPVLGSIEIAE-----SVTVKQNELKDLIERTYFSMAQ-QDVRQTLNGLLLELT-GTGARAVATDGHRLSLVDSSSANNPYQVILPRKGVQELLRLLSNSEDIAELQLGK-------KHLRVELDGMCMTSNLIEGSYPDYNRVFPSEIDHSLVVCRDSLRQAISRVMVLSS-EKSRGVRLAAEEDALRVFSHNQEQEEATDEIEA-EFGGELIEIGFNGSYILDALNAIEGEKVEILIGRNNSSGVFKGIGDESARYVIMPMR 367
338 0.000e+00UniRef50_A0A0G1D6W7 Beta sliding clamp n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1D6W7_9BACT  ali  17  1MKIICTQPNLQRGIVAVSH-IAGQGGTLPVLQNILLKAEKGMITFSATDLEIGITATIRGKIE--QEGAFTVSSKIMNNVVGLLPDENVELEVKGQNLHIKSGGSKTKINGIEATDFPIIPTLNEGDG-----VLVEASAFKKALSQAIVAVSQDM-SRPELNGALFRFSDS-ILTIAATDSYRLAEKKVGVVKKEGQVIVPLKAIREVLRTVEEALD------GRVLIATHEGQLLFLSTDIRIVTRLIEGKYPDYEHIIPKTFQSSFVVQKEGFLRAVKAAGLFTQMGVNGIVRLHPEENLLEISSQNTQTGENASTLS-VSGNGVAGAIVFDYRYLSDGLNTIDQDEVTLALNEPTSPGVLRPNGKDDYIYIIMPIR 369
339 0.000e+00UniRef50_A0A2D5HKA9 Beta sliding clamp n=1 Tax=SAR116 cluster bacterium TaxID=2024888 RepID=A0A2D5HKA9_9PROT  ali  20  1MKIITEKSALLKPLSHIQGVVEKRNTI-PILSNVVIKADEDGLSLSATDMDIDILEKFNCNV--INPGSVTVTANIFYDVVRKLMDGEIQIEFNGGTASLISNKSKFQLPVLPVEDYPNLNQDD-----LPINFKVTVDELCKLIDKTKFAISM-EETRYYLNGIYIH-KHDKKLIAVATDGHRLARTSISLPSGANGVIIPRKAIYEIRKLIEDFSHDDQVSIS-----LSDSKIRVKISNTIITSKLIDGNFPDYEKVIPKNNDNIVKLDCLVFSESVDRVSTIFSD-KSKSVRLSLSKNNLSLEANSPDTGSASEEI-GITYDKDDISIGFNSRYLLDVTSQIGSGDLIMALKDSGSPALISLPDDTESLFVLMPMR 367
340 0.000e+00UniRef50_A0A2H0W9S7 Beta sliding clamp n=1 Tax=Candidatus Berkelbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_43_13 TaxID=1974514 RepID=A0A2H0W9S7  ali  19  1MKIIVLQSNFAKGLNQISRIVGSRATL-PVLNNVLISAEKGKIQMSATNLEVGISTQVIGKIE--EDGELTLPVRLLSDFVLNNKDESIELVTEAVSGKLKSEHFEATIQGISAEEFPTVPKPPTEVVA-----KISRTKLIDAFKKVNIAAATD-ETRPVLAGIYCQFS-GNKLTLAATDSYRLAEKKITLETKEQNLIVPLRTAAEVLRLISTEDG-----VEDVKISAKENQISFSIGNTYIVSRLIEGAFPNYSQIVPESFKITAKTKLSDILSAVKMSSLFARDSANNNVRVIVKKNDLTISSVASESGTAKSSI-ASETTGGDVEIAFNARYMLDILNVISDEEIILNFNESTAAGAIKTPKDPDYFYIIMPLK 366
341 0.000e+00UniRef50_C6M528 Beta sliding clamp n=104 Tax=Proteobacteria TaxID=1224 RepID=C6M528_NEISI  ali  18  4..LQADRDSLLKPLQAVTGIVERRHTL-PILSNVLLESKDGQTKLLATDLEIQINT--AGPESQAGDFRITTNAKKFQDILRALPDSAISLDWADNRLTLRAGKSRFALQTLPAEDFPLMSVGEDI----SAAFSLSQETFKTMLSQVQYSMAV-QDIRYYLNGLLMQV-EGNQLRLVATDGHRLAYAQIEAELPKTEVILPRKTVLELFKLLNNPSEPISVEL-------LNNQVRFQCNGTTIVSKVIDGKFPDFNRVIPLDNDKIFLVSRTQLLGALERAAILA-NEKFRGARLFLQPGLLSVVCSNNEQ-EEAREELEIAYQGGELEVGFNIGYLMDVLRNIHSDDMQLAFGDANRSTLFTVPNNPNFKYIVMPMR 366
342 0.000e+00UniRef50_A0A1G0I042 Beta sliding clamp n=8 Tax=root TaxID=1 RepID=A0A1G0I042_9GAMM  ali  18  1MNITVHRNALLKPLQAISGVIDKK-QSQPILANVLLSTKDNQLCLTGTDLEMELVGTVPL-LSMTEPGRTTVSARKLFDICRVLPEDAISLSLGKNNLLLRSGESCFTLKTLPAEEFPNL-----ENHIYATELTVSEAGLKQLLTKTYFAMG-EQDVRHYLNGILLDIKQ-KKIQCVAMDGHRLAFAAIHIDHVEMQALLPRKSVLELMRLLENDSD------ADMTLRVNEQRICVTAKHFIFTSKLIHARYPDYQRVIPQG-ATTVVLERDAIKQALIRAAILS-NEKFRGVRLQLENNRLLISANNAEQEQV-EEVVSLDYAGNAMEVGFNVSYLLDAISTLSSAAIRFIFTDAQGGLLIRSETDEPHFYVVMPMR 366
343 0.000e+00UniRef50_A0A2D5WXK8 Beta sliding clamp n=2 Tax=unclassified Pelagibacteraceae TaxID=1655516 RepID=A0A2D5WXK8_9PROT  ali  21  1MDFRVNSTDLLKALSHIHGIVEVRHTL-PILSNIIXTTNDNSLSLSSTNLD--IFCSDDLXAEVGQNGSTSVSASTFYEIVKRLPSGEIHLSEEDSTLVLKCGRSKFNLTTISPDDFPKISHDDLN-----IQFVLSATELKRMIDKTKFAIS-NEETRYYLNGVFLHQTQKNSLRAVATDGHRLAQYDIPLPKDMNGIIIPKKMIQELRRVLDDANGDINIQLNE-------NKIKFSFNNMQIISKVIDGTFPDYTKVIPQSNDKSITTNNDELKKAIDRVSAVAINEKSKAIKLIIESNKISLSVDSTSRGSAIEEID-LEYNSEKVEIGFNSRYLIDICNEIDGDKINLKFLNSTSPAIILDNTDENLFFVLMPMR 374
344 0.000e+00UniRef50_A0A1V5YC04 Beta sliding clamp n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A1V5YC04_9FIRM  ali  20  1MRFYLNNQDLNAGITTVIKALPPRSTNA-AREGIYIEASKDGIRLKCSDLSLQIETVVPATVE--EEGSVVLPGRIFSELVRKLQGEMTEINCENETAVIKNGRVQTTIQGTPADEF-----SSMSVLTGDIRFSLKQCVLKDMIKQSIFATASD-ESKPILTGVLFEI-DNEELTMVALDGYRLALRKEEISKDPGSVVVPARSLAEISRTLLDSEESTDIEITK-------THVVLDMGQTRIITRLLEGEFIKYKQILPTEHKTRVRLNRQELSDSIERASLMAREGKSNLVKMSFSMDTLTITANN-ELGKINEEIS-IELIGSELDIAFNGRYFIDVLKALDDEEIYLDMNSNISPCVVRPVQGDKFYYLILPVR 363
345 0.000e+00UniRef50_K7ZCX4 Beta sliding clamp n=3 Tax=Rhodospirillaceae TaxID=41295 RepID=K7ZCX4_9PROT  ali  17  1MKITIDRSSFLKPMAHIQSVVERRNTI-PILANVLLQAKAGRLSMTATDMDMDLVNSTVCIVD--QPGSITVSAFTLYDIIRKLPNGEVKLNMDKDSLSISAGRSKFLLPTLKADEFPSLP-----NDQITINFMLSAVNAKSLIDRTRFAIST-EESRYYLNGMYLHVNNISVLRAVTTDGHRLALMEIPLPESASGVIVPRKAIIEIRKLIDESEGSVHVAFSK-------NKLRFNFVDTAITTKLIDGNFPDYERVIPTSNDKIMRLECRSLKKAVERIAIIST-AKSRSVKLEINKGNLILSAKNPDNAWATEDMN-VDYDSDPIEIGFNSRYLLEIANQFDSATVLFHIADKTSPAIVTNEKNDGALYVIMPMR 372
346 0.000e+00UniRef50_A0A2H5ZGI8 Beta sliding clamp n=1 Tax=bacterium HR30 TaxID=2035425 RepID=A0A2H5ZGI8_9BACT  ali  17  1MECRMTKDDLLGALYLAQGIVDRRVTL-PVLAHVLIQVGNRDATILATDQEIGLRRRCGAAV--TKRGAATANARVLYEIIRSLSDGEIELRSDEHHLEVKQGKSQFRIVGIEPSEFPAMPAVP--DVKSKAQLSVDAEVLRRMLELTLFAASSD-EARPALCGVCFERRDG-LLHVVASDGHRLSLVSRALKGPEPGVILPRKAVTEMMKVLDGLSGEVQLTFGSGV-------VFLTAGDVELAMRTVQADFPSYEAVIPRETAHLLTIANGPWSQALRRVAVLAA-EQTHPVRLTFDAGKVELSARNPELGEAHEEVEA-NYSGETFTIGFNARYLLDVLSLFPGDTVEVGLQDDESPTVFRVPEEPEFLYVLMPMR 368
347 0.000e+00UniRef50_A0A2M8KZI5 Beta sliding clamp n=9 Tax=unclassified Saccharibacteria TaxID=1895827 RepID=A0A2M8KZI5_9BACT  ali  17  1MKLQVTQENLSKALGTVARVANTRNTL-PILSNVLLRTVDNRLSISATNLDIAITHYIGSKIE--KNGAITVPARLMQDFVSSLPDSVLNLELTDHKLNITTDKYQSSINGIVADDFPVMPAI-----SGGSVWKLPAKDFKKALGQVVLAASGD-DTRPVLTGVYFH-SRGNEVVAVATDSYRLAENKLAKHKEPVNFLVPASAISDVLRIVSDTDKEVVITHDEQ-------QVSFKVGDVMLVARLIEGNYPDYRKLIPTKFATVTRLKRADFINIAKVSSLFARESAGSIIKVDKAEKQVSINAVASQLGENTAKATA-EVSGDG-EVTLNSRYLIEALNAFLGEDIEFCFNGKLEPCILRSSSDTGYIHLIMPLR 362
348 0.000e+00UniRef50_A0A0E9M8H4 Beta sliding clamp n=3 Tax=Betaproteobacteria TaxID=28216 RepID=A0A0E9M8H4_9PROT  ali  20  5...TLTRDALLKPLQIVIGIVERK-QSLPILSNVLIEKSQRELKLTATDLEIQVST-VSVDVGISKDDAITLGAKKLADILSKISDDKVSLDLSDGKLQIRSGNSRFNLQTLPSNDFPTL----KKSIEANVCVVLAQGKLKKLLGQVKYSMAQ-QDIRYYLNGVLFSL-DGPNLCLVATDGHRLAFTSTILENPKKEVIIPRKAINELLRLLDDSDSEIVLNISDNNISAEFSNVFFQ-------SKIIDGKFPDYRRVIP-EYSNHLLLDRKTILSALGRVSILS-NEKFHGVRFILTEKNLKIISNNSEQEEAQEDIET-DYRGEALDIGFNVNYLLDGLNNISADTVQISFGGANSSVLIALQNNLEFRYVVMPMR 367
349 0.000e+00UniRef50_A0A1B6B7Q8 Beta sliding clamp n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1B6B7Q8_9FIRM  ali  19  1MKFSCNQQELSTAINLVSKAVSSK-TTLPILSGIFFETVGDQLRIIGNDLNLSIETFM--NVTVYEEGNIVIPSRLLTELIKKLPNNTIEIEVSDNNVIINCLESSFKIVGLPGNEYPELPNIE-----DQNSFEIDKELFSNMIKQTSFAISQD-ESRPILTGALLEIENGK-FNMVALDGFRMAIKRANIKTNSNKAVVPGRTLNEINKIMMQVESK-----GDLKISFDDKQVLFTFESLKVYSRLLAGEFINYTQILPSDFKSVAKVNTNEFLTCIDRSFLMARENKNVAIKLEIKDDLIKISSSSEMG--SSMEKLNVELEGNDLEIGFNPKYLIDALKVIDSEEIYLELINNVSPCIIRPIDHESYTYLVLPCR 365
350 0.000e+00UniRef50_U7UNS8 Beta sliding clamp n=24 Tax=Firmicutes TaxID=1239 RepID=U7UNS8_9FIRM  ali  23  1MKFNISKKELSKHISIAQKAISSRSAMQ-ILEGLLLVAENNTLTIIGTDTDLTIITSASAIVE--EEGKIVVNSRLFGDIIRKLDDSDIKIRIEKHNMNIICNKSEFNITCQSPDEYPMVTNFEEK-----NSFKISSEELKEAIRKTSFAVSQ-EDTRKMFTGVYMDCTKG--INFVALDGFRMSLVKLNKETKESKSIIPATSLNELSKILEDSQVDVKV---------GENKILFEFDNTKLYSNLFGGEYFSYKDLIRDNHTTKVKVDRGLFQISLERASLLAKEERANLIKLEIKKNSLVISS-NTEIGNVTEEIP-CQTEGDELTIAFNSKYLLDGIKIIEDKDVVLNFTDSVNPCII---NTDSYTYLVLPVR 355
351 0.000e+00UniRef50_A0A2V2FJH9 DNA polymerase III subunit beta n=1 Tax=Clostridia bacterium TaxID=2044939 RepID=A0A2V2FJH9_9FIRM  ali  17  126MRIHINTQELNAGISTVIKALSVRTTVS-ILEGIYLEASNGWLLLRCTDLSLQIETNVAATVQ--EEGAIVLPGRLFSEMVRRLPGEMTFIDVKKGTATIESGSFKTTLQGEDAEGFHTMSTVTREHI-----IKMKCDAFKNMIRQCIFAAAQD-DAKPILAGALLEQHEGD-LSLVALDGYRLAMRMERIPGGDRSAVIPARSLLEISKILPDSDQEFDMIFSK-------THVMIDLSHTNITARLMDGEFIKYKQILPDGHKTRVRVNRQELMSGIDRVALMAREGKSNLIKFTFTSDKLTI-AANSELGRSHEEI-AVDAMGEDIEIAFNAKYFTDVLRVLDEDELYLDMNNNISPCVVRPVQGSAFYYLILPVR 489
352 0.000e+00UniRef50_A0A2H0VEF9 Beta sliding clamp n=2 Tax=Candidatus Doudnabacteria TaxID=1817799 RepID=A0A2H0VEF9_9BACT  ali  20  1MKLNCTKENLKRALGFASRAVGS-NTTLPILNNLLLKTEEGQLKISSTNLEIAIKTWVGAQIE--KPGEITVPARTIVDYINNISEEKIMLETKMTDLLVKTPSTQSVVKGLPAEDFPLIPEIQDGIVT-----TVNAEILAGAVAQILFA-SSFSETQPELSGVLFELGE-KKLTMAATDRYRLAEKIIDLKGGEKKAIVPNRAITELGRVLSGCKNDAEILISD-------NQILFKVNGVEIISRLIEGQYPDYKQIIPTDFPTQIKLGVKELTSALKLSGLFAQE--NNNVELDIIKNKVVIKATSQRAGSNTTEVRGV-VEGEDNNIIFNYRYILDCLNHLHNKEVVLKVINSSSPAMVVPEGEDNYLYLVMPIK 364
353 0.000e+00UniRef50_A0A1G1WTH1 Beta sliding clamp n=2 Tax=Candidatus Woykebacteria TaxID=1817899 RepID=A0A1G1WTH1_9BACT  ali  18  1MKADLTKENLTKALSTCMRAVSLKASL-PILANICFNTEGPKMKFSATNLELGVNYWSEAK--TLEEGSISVPARILLEYISSLDVSQISLESKDETLLITSDQGEATIAGISSQEFPPVPT-----LTEQANIFLDPNEFQKAVAQVAFAASTDA-SRVVLSGVLLHFSP-EALLLVATDGYRLAQKKWDREGTEQSVIIPAKSLYEISRIVSEEGEELKIFLNK-----EKNQAIFGLDKVHMTTRLLDGNYPNYTQIIPTSFVSRAVVEADKLGKAVRTVSVFARD-SGSVIKADFSSSTLALSAQTTQVGDTKTSLP-ISFEGEPMSVAFNQRFLQEALSAISSTQVSLEMTSPTSPIVVRGVGNESYLHLIMPVR 367
354 0.000e+00UniRef50_M4ZVR3 Beta sliding clamp n=9 Tax=Actinobacteria TaxID=201174 RepID=M4ZVR3_9ACTN  ali  13  1MKFRCERDVLADAVGSAGRAATNRTGTLPVLAGVRMEVAGDTLTVTGTDLELTIRLTVE--VGGEQDGAAVVPARLVGDIVKALPAGAVEISLDSGEMSISAGRSQFSVRPLSLDDYPA------QTEPSGEAVTLSAETMSDALRQVVRAASTD-DARAVLTGVLL-ASEDEGVRMVATDSYRLAVRDLPDSGSGQKVLIPGRALNELQRVMGDVEE--------LTVRFGEREATFEAGTTRLSTRLIEGEFPNYRNLLPSSYPNLLTVSKASMMEAIRRVKILAQD--STPVRLTLGGDTVQLTAITQDVGNAAEEIDA-SYDGAEMTVAFNPDYLAAGIDAIDADDVTLATMDPMKPAVLRGAGQEDYLYLLMPVR 366
355 0.000e+00UniRef50_A0A1F7AEX4 Beta sliding clamp n=2 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 RepID=A0A1F7AEX4_9BACT  ali  19  11MKLICKQIDLALALNLANRAVSPNNTL-PVLNNILLKAEGKKVFLSATNLEIAISSSFEADIEN--EGSLTIPAKIFTSYVSLLEDKEVELTVNGNTLIIKSPGSETRMKGISSEEFPSAPKIEKGD-----SFKFPVKPVLEALEQVVFAASTNT-SRPVLTGIFWKVV-GRVVKLAATDSYRLGEKQFELSKDDTSFIVPSKTAQELQKILENSKDE------ELEVRVGKGQIQFKVDGAELVSRLIEGNFPDYDKILPKETKTTAVLSTEEFLLGLKKVSVIVR-ENSNNVKVRIEKGKLLIFSDETQVGQGATEIVVENVKGEALETALNVQYLLDVLSHLKDTRVNFSLNDGLSPVMVTPAKTSGYIHIIMPLK 377
356 0.000e+00UniRef50_A0A2H5WXZ9 Beta sliding clamp n=6 Tax=Bacteria TaxID=2 RepID=A0A2H5WXZ9_9BACT  ali  18  1MKLQCNRKQLDDALGVVAQAAASRSTL-PILSHLYLEAQGDCLRLLGSDMEQWVECRIPALV--GETGATTANAKLLTDLIGSLNTEEVNLETGDHQLILQAGDSRYQLMGLPADQYPPIPELE-----SGTELQVPAQLFREMVDSVEFAVSR-EEVRLTLTGIRMEY-DGSNLRLVATDTHRLAVRDAQIGGEPASVIVPLKAIHLLQKL---------PTSDTFTMQLGTHRAAFIGENASVVTQLIEGQYPNYQRVIPQEYTRRWVLMVDEFRDALRRAYLIAKS-NANKVYLRTDGEKLVITAQG-DAGEAKEAVDLVR-EGDDLEIAFNAKYILDVLDVLESEGVAIELTEALRPAVFKPVDRSDYLCVIMPM. 360
357 0.000e+00UniRef50_R5A974 Beta sliding clamp n=5 Tax=Firmicutes TaxID=1239 RepID=R5A974_9FIRM  ali  18  1MKLTCSKDLLLQYINIVNKAVSNR-TTLPILECILLTANERGFIMTGNDLEIGIRTA-PIEAEIQKAGEVAIEARIFNEIVRRLNGESVTIATDEDAVTIVSGSSEFKIMGQSGEDFPTLPEVEQERL-----YSMEQAKLRDMIRQTIFSIAQDG-SKPVLTGELFELR-SNSVHVVSVDGYRISFRKNSLGSGDTDVIVPGKTLAELNKILSQEEDDT------LSIYLTEKHILFDLGTAVMVSRLIEGDFIRYAQSFSEDYKTKVVINKSELIQALERASLVSRDNRKTPVRLMIRANGMDITARS-DMGTAHENVTA-EVEGDDLAIAFNPRYLIEALRSIEEETVKMIFMASLSPCTILPGEGDSFKYLILPLR 366
358 0.000e+00UniRef50_A0A2M7XCN5 Beta sliding clamp n=4 Tax=root TaxID=1 RepID=A0A2M7XCN5_9BACT  ali  18  1MKLSCTKDNLHQGLSITSHLM-TKNVNLPILQNVLVKAEGGAIRFTTTNLEIAVNCTVRGKVE--EPGEYTIPSKLFFDYVSLLPNETIHINASDTSVEVECGSHNTRINGLVASEFPLVPKVDGEKM-----YQIPVEEFKQSLSQVLFSVAAN-ESRPELTGVAFRFHEGERLTLASTDSYRLSEKVIPVVSEEFKVVIPAKTLSEVNRILSVFKDEVDLP-STLTMTLTNSQVVFSYGPVELISRTIEEEYPDYQQIIPTQFQTKVLIDRNDFIKAVKTASLFSKTGLF-DVALSIKPNLIEVSATDATRG-ANTTAASADVSGQANSVTVNYRYLLDGLQAIRSDQVIFEMIDASNPCLLTPKDETDYRYVVMPIK 377
359 0.000e+00UniRef50_A0A1Y3PKI9 Beta sliding clamp n=1 Tax=Bacillus thermozeamaize TaxID=230954 RepID=A0A1Y3PKI9_9BACI  ali  18  1MLITIDRMCFNTAVQQVHHAVNSRTPI-PILTGILFIADENGLTLAGSNSDISIQTKIPLRLLVHRPGKVVLPARYTAEIIRRLDGEKLTIEVSANTAKITSGKTEVLLNGLDPEEYPALPGFDWENNP---SIVLPGNLLKTLIQQTVFAVAES-ETRPILTGVCWEMHEG-RLRLTATNSHRLAKRETPIEVNFEQVIIPGKSLNELLKLIEGEE--------SVEIAFTQNQILAKAENWLFTSRRLEGFYPDTSRIIPQSAKTEVLISNRILHDAINRAYLFAREIKNNVVKCSIQEGQLVITADSPAVGQVTEEVPILGFSGESAHIAFNARYMLEALRAIDSEDVQLLITGPMSPFILRPEADDSLIQLILPVR 381
360 0.000e+00UniRef50_A0A2M8KCM2 Beta sliding clamp n=1 Tax=Candidatus Portnoybacteria bacterium CG10_big_fil_rev_8_21_14_0_10_38_18 TaxID=1974813 RepID=A0A2M8KCM  ali  17  1MKIICLQDNFKKGLNIVQNII-GKNLTLPILNNILLNTDKKQLKLSATDLEIAISNHVLCKVE--KEGGITIPAKTLVNFVSNLPNKKIEITAKNNVVYLKCENFKSNIKGLDVNDFPIIPKIKSEPV-----LEIKSMGLKNTLEQVVNFTSFS-DIRPEITGVLFDFSSEKEIKFVTTDSFRLGEKTISLKNNKISVIIPSKTVQELIRIISNQEDGEE----TIKISLENNQILFSLPGVQIISKLIEGTYPAYQQLISKQFDTSVLIDKEDLIKAVKLSSFFSSKINDVRLRINPKKSLIEVFSQDIELGENLSELHA-NIKGKELEVIFNHKYLLDGLNSISAKNIFLGFNGEASPGAIKPEGDESFNYIIMPIK 372
361 0.000e+00UniRef50_A0A2M8PWZ7 Beta sliding clamp n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8PWZ7_9CHLR  ali  18  1MRVSVLQENLQRALNIVTRAVPSRPTL-PILNNVMISTDNARIKLSATNLDLGIHVWIGGSVD--EEGATTVPAKLFYDLVSILSPERIDLNLDKQTLYLHCGGNNNQIKCIDAVEFPIIPEADA-----STGIAVPALEFKRMIELVAFSASK-EENKPVLAGILTRM-EGNTLIMAATDGYRLSECRAVLETTSFQVIIPARALFELSRIISDADEDVLISLPE-----GRRQVMFHLNNVDVVSSLIDGTFPDYERAIPKNFQTITTVYTEDLLRSARRAAIFARDNADTT-QMHIRPGEVVLSSSSAEKGSNESLIDA-SVEGAPLEIALNVRYLLEVLGVVGDDQIEICTNTSSDACLIRPYHNDEYRHVIMPMR 378
362 0.000e+00UniRef50_UPI000B839B13 DNA polymerase III subunit beta n=1 Tax=Aliicoccus persicus TaxID=930138 RepID=UPI000B839B13  ali  21  1MKISINRQYFIDQLNHSLKAISP-TTTTPILHGIKLEVTEDELILVSSNSEISIEITIPTEIEIHQTGAVVILGRFFVEIIKKLDGDFVHIETSGNTTTISSGKSKYDLQTYDANQYPLLPDVNNE-----NAVTFPASILKNIINHTVFAVSTS-ETRPVLTGVHLESHEDG-LNFTATDSHRLSFRKLEDSSGELTAVIPGKSLIELNKIIADSDETVEVYFS-------QNQVLFTYRNIRLISRLIEGKYPDTSRFIPTNFETSFTVSKQEFYHAIDRVSLLARESRSNQVKLIVQDGQVRVSSQSAEIGFADEDVNVNNLEGNDFKIAFHAKYMLDALKSIQDDEVSVQFSGEIRPFIITPIESDEITQLIVPIR 376
363 0.000e+00UniRef50_A0A2M8DI83 Beta sliding clamp n=1 Tax=Nitrospirae bacterium CG_4_9_14_0_8_um_filter_70_14 TaxID=1974059 RepID=A0A2M8DI83_9BACT  ali  18  1MRFTIERGDFLAPLQRIQGIVGTR-TSMPILANCLVEAGSAGIEVVATNLEIGVRDRTACAV--AEPGRVCVAGRKLYELVKAFPEGEVTLESDESRLKLRSGRITAHLLGMEPAEFPVLPEI-----PAGNGMTLAAATLGELLAQTFFAMSTDI-TRQTLGGVLFAHDGEGHLEVVATDGHRLACRRLAVAGTAFREIVPRKAVAEIRRLVEEGDGEVNLTFGD-------KHAVLRRADLTLITRLIEGRYPEYQRAIPATCRNLVVVDREALTTACRRVAIFA-NEKTNQVELEVSADSLVIVAQNPELGDAREEIEA-KLEGDGVRIAFNARYLLDILGGMAGASVRMEMNDGNSPSLFTSGEAADYRCVLMPMR 397
364 0.000e+00UniRef50_A0A1D2R541 DNA polymerase III subunit beta n=1 Tax=Candidatus Altiarchaeales archaeon WOR_SM1_86-2 TaxID=1849364 RepID=A0A1D2R541_9EURY  ali  18  1MEFQIEKKNFLKSLSILQSIADKHSSII-ALSNILIESEKNFVRLITTDLETTIISSVPCNIK--EDGKICISARKIYEIVRELPEAEISIQIENHWAKITCKNAIFNLSGIDPNEFPTLPPYSEKDL-----IEIKDINLREMIEKVIFTAST-EESRYNLNGIFLELEDMNVVRMVATDGHRLGLIDRELLDIKSGAIIPKRGLNEVKKIIGEYPDELKISIGENNF-------IVKANSYIIIIRLIDGEFPDYKQVIPKENDKIIKLNNRDFSSCLRRVSTISAD-RVEGVKFTIKKGAIELYSSNQDLGNAMEEFPAM-YDGTEMNIGFNGRYIIDALSAIDEDEFLLELKDETSAAIIRPAEMKNLLYVIMPMR 369
365 0.000e+00UniRef50_A0A2E6VNN9 Beta sliding clamp n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E6VNN9_9DELT  ali  17  1MELRIPVNELSKSLSKVLGIIPKRNTN-PILNNVLLETRQGQIVFSATDLNVSVRLINSC--EVLTPGTVAIGARSLADMVRVLSGPDVTLKLDNQHVEVRCGSTKARLVALSGEEYPPFPESDT-----SASFSLDKKQFCEMVQRTIFCASSD-ESRYNLTGVYLEPQKENKIAMVATDGHRLSKVDRVFADADFSVILPRKGLGELLRLLSDGENDQ----PSFTFSIADNKAIIQSEDVTLIMRLIDGTFPDYKQVIPNVADKIVRSSRSEILNSLKRVSVLAS-EKTQDARLDIAGDNLTVSCTNPDTGEIKDNVP-VEYNGPDIQIAFNARYLIDAISALNDHNLHFKMTDALSPGLWVGAEDPQHLCVIMPMR 377
366 0.000e+00UniRef50_Q3A8P3 Beta sliding clamp n=4 Tax=Carboxydothermus TaxID=129957 RepID=Q3A8P3_CARHZ  ali  19  1MKFTCPTSILSENISLAQKAVSTKSP-FPVLTGILFEAQNSTITLTATDLQMSVETSFPAKI--IEGGSVVLASKFLGDIIKKLPETELMFEYNEGKCVIKYGASEVSVATYRPEEFP-----KNEEVIDGESFYISGEEFSTFIKQVLFATGTD-ESRPVFTGVLFEIV-GQELRLVASDTHRLAFRKREDTGKNINVIIPSRTLHEAVRIFGTVDELL--------IKISEGQVEFSGNGIKLTSRLIEGQFPNYQQVIPTAFKSNILINKKYFLDSLERAALLPRDKDKTPVKFYLERENMIITSQS-ESGSIREELP-ISLEGEEFTVAFNTRYLIDVLKVLETEEIYLSLTGPLNPGVVKPVNDENYLCLVLPVR 369
367 0.000e+00UniRef50_A0A2N2E0L8 Beta sliding clamp n=2 Tax=Firmicutes TaxID=1239 RepID=A0A2N2E0L8_9FIRM  ali  21  1MRITATKDNLVLGVTAVQKAVSSK-TALPILSCIRIEAKDNFLYFTGTDLDIGIQCYVP--VDIISEGIAIVTARHFSEIVRRLPDVPIEIHNNENEITIKYEDSQLVIKTLQDNDYPNFPEVIGE-----NKIQVKAAVLRNMIKQTTFAAGND-EGRPLFTGILFEYEE-KIIRLIATDTHRLALRQGTVENETGSCIIPAKILNELARLMHDDDDICLINITKNL-------ISFKIANILIISRLLEGQFPNYRQVIPNKYNLKIKTRSKKFQESVERISLFALNDNSNTLQIQINENMLVISSQS-ELGQGYEQLS-IDAVGEPVNIAFNARYLLDAFKVIDADIISIEFTGPLSPCIIRPAESENFICLLLPVR 366
368 0.000e+00UniRef50_A0A1V6J019 Beta sliding clamp n=2 Tax=PVC group TaxID=1783257 RepID=A0A1V6J019_9BACT  ali  17  1MKIKVKKEAMLASLQKVQSVINPRNTLA-VLANVLFRAQDGKLELTATDMALTLRTTMEA--EVLQPGSTTIPAKRILGVFRELAVAEVELEVNDQNITIHAGSSHFKIHGISENEYPNLP-----ELADAKTYTLDQGDFKNMLKLTSFAASLDT-NRQLLNGVLLSFKNGK-LSVVATDSRRLAHVEQEVEDAALDLIVPLKTVDELLKTLGDS--------GPLKIMATPKQVGFDFNSVFIVSKLEEGKYPNYQQVIPQASNQRIDLEREVFLSAIRRTSQLVIDVVS-GVKLTFSKNQLEILAQAPEVGEARETM-AVKYKGPEISISFNPHFLMDPLKVLTDDEVQLHLTDDTSPGVIRST--VNFIYVLMPIR 362
369 0.000e+00UniRef50_A0A2H0BV12 Beta sliding clamp n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0BV12_9BACT  ali  17  1MHVACTQENLLQGLSLVSH-IAGKNSNLPILSHVLLKTDGGGLKLSATNLEMAVSAQVRGKIEAT--GEFTVPVKLLQDYITLLPSGKVELVVQDDVLEIVSDGKKTTIKGMPSSEFPLLPKLVGDGG-----YKIEAEVLREAIDQVAFAVS-SSESRPELGGVYFNVFGPGALVMAATDSYRLTERIVKLPTGELRCIVPAKAMQEAARILSIYKDEVA-TPEEVVWTMNESQLVMNYGSVELISRLIEGSFPDYRQIIPTETATTAVVARRELAKAIRAAALFARQGIF-DVHLELADGRLKIASSDSGTGTHSDAIQA-SVDGGENAVTVNFKYMMDGLSALRGNEVVIKLIDAMNPVLLQEKDGEDYRYIVMPIR 375
370 0.000e+00UniRef50_A0A2M8G6V1 Beta sliding clamp n=5 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2M8G6V1_9BACT  ali  19  1MKVKILQESLNRGLGLASRIVQT-HPSLPVLGNVLLEAKDNKLFLSATNLEVGMILKLKAQV--LEEGKISVPARLLAEFINSLPPAEIKLELQGKTLEISTQTHRSTLNGIEAGEFPPLPQIQGEAV-----LKIKNTIFDTAINQVVFAAATD-EGRPVLSGVLLT-GEADNLVLVATDGFRLSHKIVPLASGQLKYILPARGLLEVGRVLGEKEFLGEASEVELGLTQDQNQMIFKLSSAEISCRLLEGQFPDFKKIIPKMFVSRAILEREEISKAVKLASIFARD-SANVIHFSFDPKKVSVDAQTKELGQSRTEIEG-SLEGDPLEIAFNARFITEILAVLDSEQVSLELSGALSPAQIKAVGEQTFFHILMPIR 375
371 0.000e+00UniRef50_A0A0G1QTP6 Beta sliding clamp n=4 Tax=candidate division WWE3 TaxID=422282 RepID=A0A0G1QTP6_9BACT  ali  16  1MKFTCLSENLNKGLSTVSKAVPIKSAL-PVLTNVLLSTHDGRLQLSATNLDMAITTYVGASV--VQDGSITIPARILGEFVSHLSPVTLVCHLKGGVLHVDSERAKSKFNGTAATDFPELPAMPQE----GAVIELAPKDFAAAVNSVVFSASID-ENRPVLTGVFLSLI-GDVLTFAGSDGYRLSERVLSVTSSDFSVVVPAKTLSEIARVLGASEDPIKMAISP-----QDNLVLFEGGNVLISSRIIDGNFPDHKKIIPAEHTLSAEFASSDLLEAVKLANVFAKKDAGSVVKLTFDPGKVSVASAREEVGENNTEFLA-TVKGDALELSFNSKYLLDLLNNVKAEKLRFETNGGLSACVLKPAGQQEYLHIIMPMR 368
372 0.000e+00UniRef50_Q7NGD9 Beta sliding clamp n=3 Tax=Gloeobacter TaxID=33071 RepID=Q7NGD9_GLOVI  ali  14  1MKIVCSQAVLNQNLSLVGRAVPSRPT-HPILANILLEADGGTVTLTGFDLDLGIDTRFAAE-QVEGSGRTTLPARVLSDIISRLPNESLTMEVEDNAISLVCGSSQYQVQGASAEEFPKLP-----ELPDSAAHVLPVSEFLEGVQRSLFAASTD-ESKQILNGVSVKAL-KEGMEFVATDAHRLSFYRTDFTLPEAGAVLPVRSVRELEKILGAQAGD------SVEVRFDEKQMIFQFPNQTLTTRLLGGRYPDYQQLLPKQFQQTADMERKRLIGCLERIAVLA-DQKNHIVKLDFAPSEMTVSVDAPDVGRGRESVP-VQYSGQDFSVAFNVRYLLEGLKAMDATDVSFCLNGASDPAVLKPVGDGNYQYLIMPV. 372
373 0.000e+00UniRef50_A0A1V5HDV0 Beta sliding clamp n=3 Tax=unclassified Lentisphaerae (miscellaneous) TaxID=641407 RepID=A0A1V5HDV0_9BACT  ali  19  1MKVTIGKDALASVLRKVLSAVSTKTTI-PVLNNILLEAQDGALTLAATDLEVYVKSSLDAGVE--RAGSTTLPAKKFAQIVAGLPDGEIRLVTNEQQTEITCGKAFYRIMGLDGQEFPR-----EGALEGGWVFSIKGSDLRRTLNKVAYATSTD-ETRHVLNGVLISVR-GGVMTAVGTDGRRLALVEKTLDGDDCDAILPQKVIGELVKVLDSD--------AAVSVHLSESRAAFLVGRTLITSRLVEGSYPNYRQVVPASFTHSAVIPRETFSSAISRMAMVVTD-VSGGVAVKLEKALMTVSASSTDVGEGNETFE-VSYEGTPLDISFNPQFLLEPLRALEADQVVLQFNDAFSPVSI--SGDDGFLYVIMPMR 362
374 0.000e+00UniRef50_A0A1F2XQA3 Beta sliding clamp n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A1F2XQA3_9ACTN  ali  18  14...TCARDDLANALGIVARGLSSRSAVQ-VLTGILVQVEEKKLTLAATDMEVSLRVSVSGEVSGG--GAIVVPGRLLTDLVRLLPDEVVSLEIGDGVLTIASGSYSSRVNVFSAEDFPRLPTLDVSLH------TIAAPALLGTIEKVARAASRD-ESRPVLTGILVRF-EGDTLIMAATDSYRLAVKETSLSGPELDAIIPARALQELARLAAGTEE--------VSLGVHENHVIFGAGDVWLTSRRIDGQFPNYKQLLPEAFELEVTTLREPLLNVVRRAAVMAQ--RNAPLRLRFDEGELTVSAQSQDVGEARESLQ-LDYAGEPLEIGFNPDFLRDGLEAVGGETVQLKLINPLRPGLIVAP-DESFWYLIMPIR 371
375 0.000e+00UniRef50_A0A2M6WP91 Beta sliding clamp n=8 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M6WP91_9BACT  ali  17  1MTFISLQENLKQGLAIVSRIVS-KNINLPILNNILFKVNKSNIELIATNLEIGITHQVRGKID--SEGEFTVDSKIITDYINLLPGDKVECEQDGSEIKIKCQNYKTKINIQDASDFPLIPKVNKDSF-----YSVPIDDLRSALSEVIFAVANN-ETRLELSGVLWLFT-GDSLILVGTDSYRLAEKKIKIESPINKVIVPARTLQELIRVLSSFKDDEQLEAGEIKICLSDNQILFIFGSTELVSRLINGGYPDYQQIIPLNYKTRALINKNELMRAIKASAIFSKAGV-NDVALDFKSGKITISSASSQVGESSVELNS-EIEGDNNEIIINYRYFLDGLNNISSDIIRLDLVNSGTPCVLRPEKTDDYLYIVMPIR 375
376 0.000e+00UniRef50_A0A1F7S8H7 Beta sliding clamp n=1 Tax=Candidatus Schekmanbacteria bacterium RBG_13_48_7 TaxID=1817878 RepID=A0A1F7S8H7_9BACT  ali  16  1MKINVKQNTLAKYLQMLQGIIERKHTI-PILSNILIDATDKGFFLIATDLDVGMKIQCEAKIE--ENGSITIPGKRLNDIFRELPQGEVEIMVEGNNLVISSGTSLYRVVGLPSEDYPSFPSFETIEFYP-----FPVNEAIEMVSQTLFAASLD-EGRSVLNGVLMEVGKD-FLKMIATDGHRLSIRKKESKTKGESMIIPRKALRELIKILADTQKECSIGFNE-------NKIIFQTEIVQLFSRKIEGKFPNYNNVIPKSNDKEFKINKDVFISSIKRVSLMS-DIKSRGVLFHLQNNLLTMKSSNPEIGDGKEDV-VIDYKGEEIDIMFNANYIAEGLAVIPEKEVLILLGGKKSPALIKIINSEDFTYIVMPM. 368
377 0.000e+00UniRef50_A0A251X7P6 Beta sliding clamp n=3 Tax=Thiotrichales TaxID=72273 RepID=A0A251X7P6_9GAMM  ali  18  1MHFSIPRKELLTPLKMAVSVVEQR-QVIPILSNVLVSVENDVLSLIATDSEVEILCRVPLEISTEDDGDITIPAKKFLEICRSLPEQAIDVNTDGDRVVIRAGRSRFTLATLPAEDFPS-----SSENPDMLTISVPQRQLRELIAQTAFCAAVN-DVRYYLNGLLFDLMP-NQLAVVATDGHRLALATTDFESDPLQVIIPRKA-------XXXXXXXXXXXXXXXXXXXXXTHVRFEIENLTITSKLIDGRFPEYQGVLPRNPDKVVVALCDPLKQALARVAILS-NEKHKGVRLMVKPGTLSLSARNPEQ-EEAEEELEIDYDGEAFEIGFNVTYLTDTLNAISTEEVELCFSDPNSSCLVKPRHTEQQRYVIMPMR 369
378 0.000e+00UniRef50_G4D1R1 Beta sliding clamp n=3 Tax=Peptoniphilus TaxID=162289 RepID=G4D1R1_9FIRM  ali  25  1MKLKVSRKEFIKAIQIAQRAISPRSTIQ-ILEGILLKAKNNEIVLISSDTEITIKTSIAAIV--MEEGEIVVNSRLFGDIIRKFQGDTIDINLDGTSMNLKCEKSNFHIQCQLPDEYPMLPIVEKN-----NTFNISSQELSDSIKKTSFAVSMD-ETRMVFTGVLMDLSPAK-INFVALDGFRMALKTVNNPNENTSAIIPARTLNELIKVLENED---------VNVCISRNMALFRTKTTEVYTTLLSGEFFKYQGLITESHTTICTISRVNLQSALERASLLAKEDRANLVKFEIEEGFIKISSNS-EIGNV-EEIVESKVEGGNLKIAFNSKYLLDGIKIMESEEVRLYFTDSVNPCIIR-EDDEDYLYLVLPVR 359
379 0.000e+00UniRef50_A0A1G2DYA5 Beta sliding clamp n=25 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2DYA5_9BACT  ali  17  1MKLIIPQEKLKQGLNIVER-ISLKSLTLPILNNILISTEKNFLNLSATDLEIGINWWILGKIE--EQGQITIPSRLFFNFISLLPNKNVILEVKNNNLSIECENYKTQIKGLGAEEFPIIPKI-----TQGESVSIDSPSFCYNLNQVAD-VAIPSTTRPEISGVYFLF-QKNLITIAATDSFRLGEKKIFLKTEEYSLILPQKTVKEIVNIFAEKQGQLRLYFSPNQVMFQYPMPETPHSQVEVISRLIEGEYPNYKEIIPKKYTTQLVLKREEFLNQIKTASLFSGKINEVRIKVDVKEKRINISSQSPDIGQYQSFIDG-KIKGDPIDISFNHRFLLDGLLSVKSSEIIFELNSDSGPGVLRPMGDESYLYVVMPIK 374
380 0.000e+00UniRef50_E3HLR6 Beta sliding clamp n=1436 Tax=root TaxID=1 RepID=E3HLR6_ACHXA  ali  16  1MQLVTTRDALLKPLSTVAGIVERRHTL-PILANILMRKEGNKVAFIATDLEVQITTHADFGVGQDNE-STTVAARKLLDILKALPDGDVRLALASNKLSVQSAKSRFALQTLAASEFPTVAQPEQWDV----SLTMPQRTLRHLFNMVHFAMAQ-QDIRYYLNGMLLVFEPG-RVRAVATDGHRLAHCSTEADGERHEVIVPRKTVLEMQRLLEDSDEPVSIDVAP-------GQIRFRFGDVELVSKLVEGKFPDFTRVIPTNYTRHFLVNREALQGSLQRAAILTTD-KFKGVRLQLAQNQMKISSSNAEQEEAQEEID-IDYGHEALDVGFNVGYLLDVLANVKVDNIQWSMPDANASALITLPEDDQFKYVVMPMR 368
381 0.000e+00UniRef50_A0A2M7UIV4 Beta sliding clamp n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_10_14_0_2_um_filter_43_11 TaxID=1974776 RepID=A0A2M7UIV4_9  ali  18  1MRLTCSQKNLAAALVITSKAIATNNTL-PVLGNVLLKAEGKKLFFTTTNLEIAIHYWIEADVKN--EGEITIPSRLLTNYVNYLKDEKIDLTVEDGEVIIKSSDSTTRIKGIPAAEFPPIPTVEKE-----SEVVLSVSDFKNAINQVVFAASLNT-TRPILSGVYFNV-EKDTLKMVATDSYRLAEKTLHVKSGEISCIIPARTLMEIAGVLDAGGED-----NEITVVISKNQVLFVFGETQITSRLIDGQFPNYQQIIPTESKIKIDFNVHDLSMVLKRINIFAK-ENNNKIILRITKEGVVVTTDTTQYG-GGEVVLAVETKGGEGEIALNSQYILDVLSNIGGNAVVFEVNEKTNPVVVKAIGKKDYTHIIMPLK 366
382 0.000e+00UniRef50_A0A2N6A2J5 Beta sliding clamp n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2N6A2J5_9BACT  ali  22  1MKIVCTQENLNKGLGLVSH-IANKNSNLPILNNVLLKAKKDGLTLITTDLEIGIKVFVRAKIE--EEGEFTADAKLLNNFVSLLPKENINMDLDEDNLKIKSVNQETNIKGLEAEDFPLIPEVEKE-----NEIELSAIEFKKSLNQVLFAASLDT-SRVEINAVNFEFKQGK-LILAATDSYRLSEKRIKIENNTKEAIIPLKTLQELSRILNETDKNIKIYFNE-------NQIMFVFDGVELISRVIDGKYPDYSQIIPKEFTTDAKVDINKLVPAIKSVALFCKTGI-NDIKISFKKNEIVIATASSTVGTSVAKVEA-DISGGDNDIVFNYRYLLDGLNSLSNTQVLMKINNNSSPGLLKPTSDEKFIYLVMPIR 366
383 0.000e+00UniRef50_H6LEA2 Beta sliding clamp n=20 Tax=Firmicutes TaxID=1239 RepID=H6LEA2_ACEWD  ali  20  1MKFNCSKESLMAALTIAQKAVSSKTTLT-ILEGILFSAADNKLLLRSTDLEIGVEVTIPAEVE--KEGEIVLTASIIGELIRKMSGSDIFFESNENQIKIECLLSNFTLKGLSSEEFPAFPEIIDDHI-----FSIDAGVLKELIKGTLFSVATNENI-PVLTGVKIELHADD-INLIALDGYRLALKSGKIKNEDLSVIIPSKSLSEINKVLSNYSGDVTVKFSK-------NQIFFEMDNTQFTSRLLEGDFINYKQIIPVEKATQVKINRRLLLESSERAALLAREGKNNLIKMDFNQDQLILTS-NADIGDVFEVIP-IENSGESLKIAFNSKFLIEALRVIEGDELMIDMTTSVGPGVLLPIEGNNFIYLILPVR 365
384 0.000e+00UniRef50_A0A2A2GD92 Beta sliding clamp n=5 Tax=Bacteria TaxID=2 RepID=A0A2A2GD92_9BACT  ali  18  1MKFNVSSSELVKALSAVSGAVPNKATL-PILETILFESDGDKLRLTATDLEISILESMDADID--EGGAVAIPAHRLIETLRQLPDIPVSFQVDEKNIKFRTDKGTYKLVGEDPDEFPEVPNLE-----EGHTIETDKGVITTAIDKTLFAVSND-DLRPAMMGVYFDIGTEES-KFVATDGHRLVKYIKETSDKEVDFIVPEKALNLVKKALHDEECALTI---------TEDHARFKSGNTIVITRLINEQYPNYESVIPKDNEKTLIINKEQMLATVKRVAIFSSS-TTRQIRLQLNSDQLTIRAEDIDMSSEAKETIACEYSDDDMEIGFNAKYLADVLGNVDDEEVYFEFSTPNRAGIVKPEENERILMLVMPV. 365
385 0.000e+00UniRef50_A6NQE1 Beta sliding clamp n=74 Tax=root TaxID=1 RepID=A6NQE1_9FIRM  ali  16  1MKFTCEKALLQSAISTSSRAVSPKSSI-PALEGILLEA-GSELRLTGYNLETGIRTVVPADIQAK--GSLVLSARLFGEIIRKLPDDTVIFTAENYMVNIKCGMSEFNILGTDPEEFPELPTVE-----YQNSFVITQERLKAMIGQTLFAVS-DNESRPIHTGSLFEV-DENGLTVVSVDGYRLALRHEPIDKKEFSFVVPGAALSEVEKICSQVDEPASVT-------QGARHVMFKVGDTMLVARRLEGEFLAYRQAVPRNNPIHIEGDTRALLSSIDRVSLIISDKLKSPLRCIFEENLLKISTKTA-IGDARDECP-VSGDGKGLEIGFNNKYLMDALKAAPADRVRLELSTGVSPCVILPDDGDNFLYMVLPVR 365
386 0.000e+00UniRef50_A0A1F6CRI8 Beta sliding clamp n=1 Tax=Handelsmanbacteria sp. (strain RIFCSPLOWO2_12_FULL_64_10) TaxID=1817868 RepID=A0A1F6CRI8_HANXR  ali  17  1MRFTIDQSQLLQALDAVSDVVPSKTAI-PVLSHLLVVGAKGHIALSATDLDISITASL--SVSLSEPGRFTVPARKFIEIVRELPEGPLSIQAEDHKVTLCSGKSIYILMGLPPEDYPELPAIEGTLLQFGENNGFDGNIFKNMISKTAFAVSRD-ETRPVLNGVLCQIRP-EGITMVATDGHRLVRHSKSFDSEQTEVIIPPRALQHLVKLLSGTNTLTRCVIGE-------NHILFDLDQTKLFSRLIEGPYVDFEQVIPQNNTHRLNVSNSAITPSVRRVSILS-NTQTHQIRLRLGQHELELSAVSQDVGEARESIPA-DYTGQEMEVGYNSVYLLDILKRIDSEDVVFDLNTPVTAGIVRPPEGEDYLCLLMPLR 407
387 0.000e+00UniRef50_A0A2E6P5S5 Beta sliding clamp n=18 Tax=root TaxID=1 RepID=A0A2E6P5S5_9GAMM  ali  17  1MKFQLKRDDAINPLALTTGVVERR-QTLPILSNILLETIDGVLRLIGTDLEVETQIEIPVDMDGLIAGKSTVSARKLLDICRALPEGSLKISQQQSKVNIQCGNSRFSLQSLPAEDFPRLDDTERWE----ERVRLNQGALRALLDKTSFSMAH-QDVRFFLNGVLLELSETE-LAAVATDGHRLARSAMLLSEPSRQAIVPRKAAQELNRFLDNTDDPVTVEMNP-------SHLRFSRAGAVLTTKVIDGKFPDYRSVVEQNLTRTVLADRVELYEVLARTAVL-TNEKYRGIRMEVESGGLKVTAHNPDQEEASDQI-AVDYSGEKIEIGFNVAYLMDAIRAIHEEKIEILLEDENSGCLLRGPGVENTQYLIMPMR 369
388 0.000e+00UniRef50_A0A0K6IT54 Beta sliding clamp n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A0K6IT54_9PROT  ali  15  7.....TRDQLLQPLLAASGVVEKRQTM-PILANVLLERDAGRLGLTATDGEMQLAVRIDASELPGEEGRLTVNAKKLLDILRSLPEGVIRLERDDSRLVLRCGRSRFTLQALPAEEFPRLVAPQGEDAP----MRLTQRELRRLIALTSYAMAQ-QDIRYYLVGMLF-AAEGDRLDVVTTDSHRLAHCAQPLSEPAREAIVPRKAVGELQRLLADSDETVEVRIAD-------KQIVFRFKDTEFLSKIIDGRFPDFRRVIPKDHPIRVSFVRTELQQSLQRVAILASD-KIRPVKLSFSPGLVRLSSHNAEQ-EEAVEEIEIAYDGQPLEIGFNVGYLLDVLGALTNEVVHLSLKDGNAATLITVPEDEGFEYVVMPMR 370
389 0.000e+00UniRef50_A0A1J5AQ22 Beta sliding clamp n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A1J5AQ22_9CHLR