current user: public

If you have questions about the server, please let us know.

Query: gi|108885077|ref|NP_072673.2| methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase (MG_013) [Mycoplasma genitalium G37], from M.genitalium

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# E-value Template Links and tools%idFirst MSFDGKLKAQSILETYKNFDWSKCKLVIIQANDDDSSDSFIKQKLIACNTVGAKSELIKLSNQITQAELIEKIISLNHDVNVTGIILQLPVYPHLDKNSLLEAINPLKDVDGLTTNHLAEIKPCIVEAIITLKELFNLEFNNQKIVVVGLGITGGKPIYEFLKTSGYKVQACDKDTPNTFELIKSADIVFTAIGKSHFFQAKNFKKGVILFDIGVSRNKQNKLCGDINPEGIEKKARWWTKTPGGVGPFTVLAIIKNLWILHEKNKRCLQSSILast
1 0.000e+00UniRef50_A0A097ATL2 Bifunctional protein FolD n=88 Tax=Bacteria TaxID=2 RepID=A0A097ATL2_THEKI  ali  26  4.ILSGKEVAEALKESLIKEVGYTPCLKIVIVGDRPDSVAYIKGALKRCSEIGIEASVLELPGDISEQEFIKKIHELNNDESVNGMLIMRPLPSQISEDRVKYEISPEKDLDCFSPINVAKVMPCTPQAVIEILDHFKIDPAGKKVAVVGRSMVVGRPLAMMLLQRNATVTICHSKTKDLAEETKRAEILIAAVGKAKMVKKDMVGEGAVVIDVGINVDENGKLCGDVDFDDVKDKVAMITPVPGGVGSVTTTVLAKHVIKALKQQK....... 282
2 0.000e+00UniRef50_A0A2U8BRW2 Bifunctional protein FolD protein n=1 Tax=Candidatus Fokinia solitaria TaxID=1802984 RepID=A0A2U8BRW2_9RICK  ali  28  6.IINGTSYAEEIREEIRKKLNIVPCITAIMVGDNPSSDTYVRIKKAKAKELGIEFHILKFGEDASLKQLSDTISEVNENSKVNGIIVQMPLPQHMDSHMLLNMISPHKDIDALNTYNISHISPCTPQGIIYMLKKFHSNIQGMNAVIIGRSKIVGLPLSHMLLRENCTVSILHSNTKDIVQHTKNADILIAAIGKKHFVKSHMIKEGACVIDVGITRY-NSKLYGDVDFDDLYQKVSFISPVPGGVGPMTVACLMKNAITLTKLQHNLAIKS. 291
3 0.000e+00UniRef50_A0A267H0D7 Uncharacterized protein n=5 Tax=Opisthokonta TaxID=33154 RepID=A0A267H0D7_9PLAT  ali  29  72.LISGKDISADVKSAIKTKINFTPGLAIVQVGDRQDSNVYIGQKLKSATEVGITAKHVKLGTDISESALLTIVNQLNEDPNVHGIIVQLPLDCNIDSDLVTNAIAREKDVDGLGVVNLDCFVPCTPRGCLELIQSPRGSLAGVSAVVVGRSKIVGSPMAELLTWHHATVTLCHSRTKDLAQVCRQADLLVVAIGRAQYVKSDWIKPGAIVIDCGINSLPDYRLVGDVDFSEAKSVAGAITPVPGGVGPMTVAMLLRNTMEAA........... 360
4 0.000e+00UniRef50_A0A2H0NBA1 Bifunctional protein FolD n=2 Tax=Candidatus Komeilibacteria TaxID=1817908 RepID=A0A2H0NBA1_9BACT  ali  27  4.IIDGKALALEIQNKLAKEIKLTPSLAVLLVGNDPASKIYIELKKTACHQVGIEFHEYCLAEETGNEKVLEVISFLNNDDDIDAILVQLPLPEHLDTNQIIQAIDPAKDVDGFHPENIQKFVPGLPLGIIKLLESTGEKLENLTAIIIAKNEILYQPLAKLLQDKKIKTQVFKPEDKNIKNKCQKSDILISACGQPFFITTDMVKDKVIVIDVGTNKVGDY-VVGDVDYSGVFEKAGHITPVPGGVGPMTVAMLLCNTVKLSRVKNKIKST.. 282
5 0.000e+00UniRef50_A0A1S1V742 Bifunctional protein FolD n=4 Tax=Firmicutes TaxID=1239 RepID=A0A1S1V742_9FIRM  ali  28  4..IDCKAIAKKLREEIKEKYGEKPFLEIVQVGAHPSSVSYVKSIIKTCDNMNVNHKFSQYDENITEDELVAEIEKLNADSSVHGVIVQYPLPAHIDSDRIANVLSPAKDVDCVTSENLGKMVPCTPKGMMRILKESGVDLVGKDVVVVGNGRTVGRPITQLLLQQNATVTVCHSKTKDLAAHLSNADVVVGAAGRAGLIPGAAVKEGVVVIDAAINVLEDGSIVGDAEFDAVSEKASLITPVPGGVGTTTNAMLMENLLELF........... 277
6 0.000e+00UniRef50_A0A0S7ZCJ1 Bifunctional protein FolD n=1 Tax=Parcubacteria bacterium SG8_24 TaxID=1703768 RepID=A0A0S7ZCJ1_9BACT  ali  26  5.IIDGKAIADRILEEVAQEVGFVPGLAAILVGDDPASHLYVRLKGRACARVGIRFERLALPERTDEPTVLETVRRLNTDPETDGIIIQLPLPGELDETKIVEELDPEKDADGFHPQNVEKFAPVLAAVMMELLRSTGVDLSGKTALVIANSETFYRPLERLLTSAGSTFLKAAENEARIVEAVREADLLIVAAGRPSWIIGDWLKPGCVVIDVGTSRV-GGNLTGDVDHDTAKEVAGHLTPVPGGVGPVTVAMLLRQVVSLARRRR....... 279
7 0.000e+00UniRef50_R5HUP3 Bifunctional protein FolD n=1 Tax=Acholeplasma sp. CAG:878 TaxID=1262686 RepID=R5HUP3_9MOLU  ali  33  14LILDGKKVSLEIKQNIKDKNNINPKLVVIQVGNDEASNVYVNSKRKACEEVGISFKHLKYD-NVKEEELANKIIELNNDNSVSGILIQLPLPSYLNENRLLDLISPNKDVDGLTTTNMGNLFPCTSLGVIKLLKYYNVKLDC-NVVIIGRSNLVSKPLGQLFLQENATVTICHSYTKNLREYTKDADILVSATGVKDLITKDMVKEDAIIVDVGITRFQ-GKLYGDVKKDGILN----YSPVPGGVGPMTVAMLLNNVYECFMKNK....... 282
8 0.000e+00UniRef50_A0A2K9LTI3 Bifunctional protein FolD n=4 Tax=Spiroplasma TaxID=2132 RepID=A0A2K9LTI3_SPISQ  ali  30  4.IIDGKQFAQELNTNLKIEGKRKPKLVILQVGDNPASNKYIKNKLNACAKVGIIGELKKFEEEISQKKLENEIIKIIDDNEVDGIIVQLPLPKHIEEQLIIDLIPAGKDADGFNPQNNSKIFPATPYGILKLLEWKKIDLIGANVVIVGRSNIVGKPLANMLINKSATVTICNTKTKNLKDICKEADILISAAGVANLITKEFVNNNMTIIDVGANFV-DGKYCGDVDFDNVLEEVKHITPVPGGVGPMTIACLLQNTFTLYKEKENL..... 281
9 0.000e+00UniRef50_A0A2B4REV1 Lysine--tRNA ligase n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4REV1_STYPI  ali  33  821...DGKKTAATIKQEITKEVQKTPHLAAIIVGDNGASRTYVNAKVKACEAVGFDSTLVELPLEISQKQLLEKITELNTDKKIDGFIVQLPLPKHIDEQEVLMAVAPEKDVDGFHPVNVGKMAPATPYGILELLERYDISTAGKEVVVIGRSHIVGRPMSILMSQKHATVTLLHSRSEHIQHFTKRADIVIVALGKPHFLTADMVKEGVVVVDVGITRVDDPKLLGDVDYETVSKKASHITPVPGGVGPMTIAMLLKNTLRARK.......... 1104
10 0.000e+00UniRef50_M7U3E5 Bifunctional protein FolD n=11 Tax=Euryarchaeota TaxID=28890 RepID=M7U3E5_9EURY  ali  31  3IVVDGKTIAQEIKEQLKKEHGKTPTITTVKIGSNPESDVYLRLRDKACHKVGIQSQHVTFQNNVSKESVIKAIDELNKDKNIHGIILQFPLPDHLSQNELLSSIEPRKDVEGLTPFNMGRTVPCTPRAVITILEHEKTKLHGMNVVIINHSNIVGKPLAVMLLNRNATVSVCHIFTGDLKQYTLGADIIITAAGVPKLIQREHVKKEAFVIDVGIIKTKDG-ICGDVDFDSIKEKAGKITPVPGGVGPVTVACSLKNMVQTFKN......... 279
11 0.000e+00UniRef50_A0A1G3QN18 Bifunctional protein FolD n=18 Tax=cellular organisms TaxID=131567 RepID=A0A1G3QN18_9SPIR  ali  29  30...................HNIQPGLVTILVGGNPASVSYVTAKQKTSKDLGFYSIQNDQQADIAESDLLKLISTYNKDPKIHGILVQLPLPKHINENKVLYAIDPDKDVDGFHPVNEARFYPCTPYGIQQLLIRSGTKIEGAEVVVVGRSNIVGKPIAMMLVQKNATVTICHTKTKDMKTHTLRGDILIVAAGAPKSVTADMVKPGAVVIDVGVNRVPEGKLQGDVDFEEVKDTASAITPVPGGVGPMTITMLMLNTVRAAKM......... 290
12 0.000e+00UniRef50_A0A0C5B6B3 Bifunctional protein FolD n=14 Tax=Bacteria TaxID=2 RepID=A0A0C5B6B3_9MOLU  ali  34  29....................KRVPKLVVILVGDDESSKVYVSHKTRACRLVGIDSETLKLDANISKQELYKIIDKLNNDPTVDGVLLQLPLPDWFDEESYLQAIDVSKDVDGFHYMNQGKMYPCTPLGVINLLKAYDIEIKSKDITMVGTSNIVGKPLAIMLSNMGATVTMCNKNTVDITKYTKNSDIVISATGQKFIIKKEMIKQNAVVVDVGIIRDATNKLVGDVDFENVKDLTSYITPVPGGVGPMTVVTLLENTLKLYKRH........ 281
13 0.000e+00UniRef50_A0A261ET28 Bifunctional protein FolD n=61 Tax=Actinobacteria TaxID=201174 RepID=A0A261ET28_9BIFI  ali  28  5..LDGRAQAERIKQDLKQRVGRQPGLGTLLVGNDPGSVKYVEGKHRDCAEVGIRSIRRQLPADASSESILEQVHLLNQDPACTGFIVQLPLPSGIDETAVINSIDPSKDADGMHPYNLHSPLPCTPRGIIALLKAYDINLSGKHVCVLGRGLTVGRTIGLLLSSKNATVTLCHTGTRDLVEQMRKADVIIAAVGHAGLVKQTDVKPGAVLVDVGVTRVWDEHIRGDIEP-TAREYASAYTPNPGGVGPMTRAMLLTNVVEAAERNLK...... 292
14 0.000e+00UniRef50_A0A2V1GWH1 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD n=1 Tax=Flavobacteriaceae bacte  ali  29  5.IIDGKAIAANVKSQLKQQHQKVPHLACVLVGENADSASYVRSKLKTANDLGMQVSDLHLPAEISQDQLLQKIQQLNLDQNINGILVQLPLPKHIDENLIIETINPEKDVDGLHPANQDGIKSCTPLGCMILIDSVLSDLSGKNALVIGRSTLVGKPMAAMLLNADCSVQIAHSKTKNLAALCQQADIIIAAAGAPKLVKADWVKAEAVLIDVGLTWDGKGGLVGDIDFASVSEKAAAITPVPGGVGPMTIAGLMLNSFEATCRQNNL..... 290
15 0.000e+00UniRef50_A0A0K9Q8D7 Translation factor GUF1 homolog, mitochondrial n=2 Tax=cellular organisms TaxID=131567 RepID=A0A0K9Q8D7_SPIOL  ali  32  572...DGKLVSEKIKEQIATQTGRKPHLVAILVGNDGGSETYVASKMRNCQLVGFESTNIRYDETITEEELIAKVKEINKDDSIDGLIVQLPLPKHIDPDKITEAIDYRKDVDGFHPVNLGRMQPATPYGIMLMLXY-KIETAGKHAVVVGRSNIVGSPMSILLARNNCTVTLTHSRTKDLKTEVLRGDIVVAAIGRKNFVTADMVKEGAVVIDVGINRESGFKLYGDVDFEHVAPKASWITPVPGGVGLMTIVGLLKNTLEAAK.......... 854
16 0.000e+00UniRef50_A0A0L6CJS3 Bifunctional protein FolD n=168 Tax=root TaxID=1 RepID=A0A0L6CJS3_9MICO  ali  29  5.LMDGKATLATIKNELRERVGITPGLGTVLVGDDPGSHWYVGAKHKDCASIGITSIRKDLPASATQAEVEAVIDELNADPACTGFLVQQP--TGLDEFALLSRVAPDKDVDGLHPVNLGKPLPCTPIGAIELLRRYDVPIAGADVVVVGRGLTVGRPLGLLLTRRNATTTLCHTGTRDLAAHVREADIVVAAAGVPGLITHDMVKPGAAVLDVGVSRV-DGKIAGDV-ADDVAEVAGFVSPNPGGVGPMTRAMLLTNVVAAAERQ........ 279
17 0.000e+00UniRef50_R7HCX7 Bifunctional protein FolD n=3 Tax=Terrabacteria group TaxID=1783272 RepID=R7HCX7_9MOLU  ali  34  1MILDGKKVRNELLEKIKEE-NIKITLAIIYVGSDEPSKIYINNKIKYCEKVGIKTLLYEMDEKTKEKEVIDLIEKLNDAPDITGIILQSPVPKQIDFAKVSGMINPLKDIDGFTKDNLYKLMPCTSKGIIKLLKYYNIKIASKDVCVIGRGDIVGKPLIFELLNNNATVSICHSQTKNLKKYTKNADIIISAVGHPKLITSDMIKDDAILIDVGISVI-DGKIVGDIDFESVKDKCLYITPNPGGVGPMTIAMIIENLVKAYEMQK....... 275
18 0.000e+00UniRef50_E4UD58 Bifunctional protein FolD n=8 Tax=Rhizobiales TaxID=356 RepID=E4UD58_LIBSC  ali  29  4.LIDGKSIASALTKKLRQKTGIQVGLAVILVGNDPASSSYVSAKKSMAKSCGFHSVQYNFSIDISQDELKKTILELNQDDAIHGILLQLPLPSTLSDRFLIQSIAPEKDVDGLHIVNAGKLMSCTPAGAILLIKFKGSDLSGQHAVVIGRSNLFGKPMGQLLLARNATVTMAHSKTKNLPEICRMADILVVAVGQPYMVKADWIKTGSLIIDVGINRVGKSILVGDVAVE-CQSIAGAITPVPGGVGPMTIAMLMANTVIAAYR......... 287
19 0.000e+00UniRef50_A0A2E3VXE9 Bifunctional protein FolD n=19 Tax=Oligoflexia TaxID=1553900 RepID=A0A2E3VXE9_9PROT  ali  28  10.IVDNKKLAKRV-QKLKERT-IRPKMKVVLVGENSASLVYVGIKEKTCKKLQCDFELLRLPHDVTRKEFLNEVDSMNNDPSIHGCFVQLPVPEHLQDIDVTSLINPEKDVDGFGGATIVDIYPCTPMGVLELLNHNQIEALGKRVVIIGKSLIVGRPLSLLLQNMGATVTVCHSKTQNLESHTLQADIIISAVGSPKFLTKDYFNKDQVVIDVGINRDHNGKLCGDVDFENVKNIVSAITPVPGGVGPLTVISLMENLVKSAERATK...... 285
20 0.000e+00UniRef50_Q9HPY4 Bifunctional protein FolD n=260 Tax=cellular organisms TaxID=131567 RepID=FOLD_HALSA  ali  25  4.IIDGDAVAAQLRADLTETAGVTPRLATVLMNDKQASETYVSMKQQDCEEVGIAAEDVRIDPEASADTLFDTVAELNAREDVHGILVQDPTPDHVPDERVLSAVDPAKDVDGFHPENVPRFKPCTPHGVQKLLAHQGVDPDGAEVVVVGRSNIVGKPLANLLAQKNATVTICHSHTDDLAAHTRRADVVVAACGVPELIDGDMLSGDPVVIDVGINRVKGYELVGDVDYDSAEAAASAITPVPGGVGPMTRAMLLYNTLAAASEQ........ 289
21 0.000e+00UniRef50_A0A143PSV8 Bifunctional protein FolD n=2 Tax=unclassified Acidobacteria TaxID=458031 RepID=A0A143PSV8_9BACT  ali  27  1MILDGAALARQIREQLQPQVGRPPGLALVLVGDDPASHVYVGSKKTQGTDVGFRVDLHQRPATTSLDEVLALVRGLNADPAIDGILVQSPLPAAMAARRVFETIDPAKDVDGFTAENREGLVACTPAGIIELLEQDGVTIAGKRAVVIGRSDIVGKPMSLLLLHRHATVTIAHSKTPDLPAVAREADILVAAIGRAGFVTPAFVKPGATVVDVGMNRVSGSVLMGDVHP-AVADVAGALTPVPGGVGPLTIAMLMKNTLTAASRRVR...... 308
22 0.000e+00UniRef50_A0A2A5HZU0 Bifunctional protein FolD n=11 Tax=Bacteria TaxID=2 RepID=A0A2A5HZU0_9ALTE  ali  32  4LVLDGKALAKKTEAELKQKTGSAPILATILVGGDPASATYVKMKGNACKRIGMESLKVEMPDTTTTEELLAKIHSLNENPDVHGILLQHPVPEQVDERQCFDAIALSKDVDGVTCLGFGRMSCATPKGIMRLLEAYEIPLAGKHAVVVGRSPILGKPMAAMLLNANATVTICHSRTTDLASHIKLADIVVGAVGKPEFIKAEWIKEGAVVVDAGYHPGG----VGDIELGPLSEKASAITPVPGGVGPMTINTLIYQSVDSGEKK........ 278
23 0.000e+00UniRef50_M4V654 Bifunctional protein FolD n=1 Tax=Bdellovibrio exovorus JSS TaxID=1184267 RepID=M4V654_9PROT  ali  33  2LLLKGKPVAEQIYHDIRQRSQKAPHLAVILVGNDPASEVYVGIKEKTCIDIGFKSSLYKLAANITEHELAKKIHELNTDTAVDAILLQLPLPAHLNARKLTNLIAVQKDADGLTAQSQAQVASCTPSGIMAMLRYYQLSVAGKKVLVIGRSLIVGMPLFHLLNQSNATVTLAHSKTTGLKDLVKDFDFVFVAAGQPHFLKATDFKKNAVVIDVGMHRKTEG-LIGDVDPDGAEGHLSAMTPVPGGVGPMTIVMLMYNTLILSEKNR....... 276
24 0.000e+00UniRef50_A0A2H0T8A0 Bifunctional protein FolD n=1 Tax=bacterium CG10_big_fil_rev_8_21_14_0_10_33_18 TaxID=1975569 RepID=A0A2H0T8A0_9BACT  ali  29  4.LLDGRSLACRIREVLKKRAGIIPTLAVILVGNDSASQIYVSKKQEEGKRIGISVKVFRYSKDMNTAGLISQIEKLNSDKNIHGIIVQFPLPKKISQEKVIEAISPKKDVDGVHPLNWGMLMPCTPAAVMELLRYYKIPIKGKEVVIVGKGVIVGKPLSILLLNEDATLTVAHKETKNLKLHTKMADILISAVGYPGLIKADMVKRNAVVVDVGITRKRN-KAVGDVDYKSVLKKVSYITPVPGGVGPVTVAMLLENVIKIAK.......... 277
25 0.000e+00UniRef50_E4TSD6 Bifunctional protein FolD n=19 Tax=cellular organisms TaxID=131567 RepID=E4TSD6_MARTH  ali  30  30....................GKVPHLSAILVGTDGASQTYVEAKVRDCQEIGFESSKLLFDDSITEAELLQEVDKLNNDERVDGFIVQLPLPKHIDVNKVLNAIKPEKDVDGFHPVNYGRMVPATPFGVMELIKRYDIQTKGKHCVVVGRSHIVGSPVSILMGSANATVTLTHRYTVDLAKYTKQADILIVAVGKPGLITADMVKNDVVVIDVGTTRVPDESLKGDVLFDEVSKKATHITPVPGGVGPMTRAGLLMNTWLASQK......... 290
26 0.000e+00UniRef50_UPI000D56062B bifunctional 5,10-methylenetetrahydrofolate dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase n=1 Tax=Solobacterium s  ali  29  8.LLYGSLLSEKLKRQMKEEVERVPRLDTILVGDDPSSLSYIRGKKKACEVVGIENVVHHLPADISQKGLEDVIFACNQNDACDGILLQMPLPDHLDANHAIFCIDVGKDVDGLTPLNEPCFAPCTPLGILSILDAMGCAIDGARAVVVGRSRLVGNPVARLLQDRNATVTICHSHTRRLRQITKEADILVAAVGVPEMIDHTYVKEGACVVDVGINRREDGHLCGDVNTEDVLPYVHMVTPVPKGVGPMTICALLMNTMRSYRLK........ 285
27 0.000e+00UniRef50_A0A0A0D0R1 Bifunctional protein FolD n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A0A0D0R1_9PROT  ali  30  6..LTGRAVADAILAEVAAEVQAPPKLVSITVGDESAVDVYVRNQRRTAEGVGIAFETRRLPERITQEELRAAIAALNADPQVSGIILQRPVPKHISIKAMQTAIHPLKDVEGMNPYNELELAPCTALAAVEMLKRTGLTLAGLEVVVIGHSEIVGKPIAFLLMSEGATVTVCHHMTRSVSMHSRRADAVFVAVGKPKLVTGDMIKPGAAVIDIGINEVLDSRVVGDVDYDSVAAVAGWITPVPGGVGPVTVAVLMRNTIVATRRQKAHYEARL 293
28 0.000e+00UniRef50_Q5RIH2 Methylenetetrahydrofolate dehydrogenase (NADP+-dependent) 1a, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthet  ali  26  54....................GFRPGLVVLQVGDREDSNLYISMKLKAAAEIGINANHIRLPETATENEVLRNIVAVNENPAFHGLIVQLPLDSPINTEKITNAVAPEKDVDGLTSINAGKFIPCTPNGCMELISQTGVSVMGKNAVVIGRSKIVGAPMHDLLLWSHATVTTCHSKTPDLAEQVGKADILVVGAGRAEMVKGEWVKEGAVVIDCGINHIPDKRVVGDVHYPSAKQRAGFITPVPGGVGPMTVAMLMKNTVESAKRFLQTHTPG. 322
29 0.000e+00UniRef50_A0A0B5HDT4 Bifunctional protein FolD n=9 Tax=root TaxID=1 RepID=A0A0B5HDT4_ARCG5  ali  30  34.....................VEPGLAIVQLGSVPESSIYVNKKIEKAKSLGINALKVSLNDNVSLDHLAEKIVSLNNDRRFHGIIVQLPLPEHLDPVKVMELINPEKDVDGFSSVNQGRFVPATAKGIMALLKSTKQKIAGKKAVVLGRSSTVGRPVAALLMKENATVTVCHSKTKDLEKETMQADILVSAAGKPGLIKAEMVKKGAIVIDVGITM-QGKKLVGDVDFESVKNRASFISPVPGGVGPMTVASLMQNTVLAAKRS........ 283
30 0.000e+00UniRef50_D0N1T3 Bifunctional folD protein n=19 Tax=Oomycetes TaxID=4762 RepID=D0N1T3_PHYIT  ali  29  4.LLDGKACSKEIEAELKELVNVTPTLALLLVGTDQDSKTYVRLKKNACTRVGITPQVHELAESIEFAELLALIQSLNADNSVHGILLQLPLPDHLKLHEEELAVSPLKDVDGLHSHHFARLQPCTPAGCLEILARNGIELAGKDVVVIGRGQLVGLPLSLMLLAANATVTTCHSKTKNLADKVRQAEVVFVGTGQPELVKGDWLAEGAVVVDVGISYVDDYKILGDVDFAAASERVSAITPVPGGIGPMTIAMLLKNTVECA........... 291
31 0.000e+00UniRef50_Q0VQ92 Bifunctional protein FolD n=627 Tax=root TaxID=1 RepID=FOLD_ALCBS  ali  33  5.ILDGKTLAQQFEQEMRKANGHTPILATILVGADPASATYVKMKGNACQRVGMESVAIELSEETTTAQLLAKIDELNNNQDVHGILLQHPVPAQIDERACFDAISLEKDVDGVTCLGFGRMSCATPKGIMRLLEHYQVELEGKHAVVVGRSAILGKPMAMMMLEANATVTICHSRTQNLPELVKQADIVVGAVGKPEFIKADWIKDGAVVVDAGFHPER----CGDIELAPLVDRVAAYTPVPGGVGPMTINTLIFQTLQSGEK......... 278
32 0.000e+00UniRef50_D8SCR1 Uncharacterized protein n=6 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8SCR1_SELML  ali  29  1..MDGRLIAQEIKDDIAEEVGFRPGLAVLQVGDSPQSQAYIHNLRTACTEVGIKSFASQLPETATLQAIIQALRTFNGDESVHGIVVQLPLPKKIRPETVLQEISLEKDVDGLHPLNQPSFVPCTSRACLELLTRYKFQVERRKVVVIGCSNVVGLPTALLLQRHNATVTIVDKHTPKPAEIARTADILVAATGNANLVRRNWIKPGAVVIDIGMNQVKDPRFVGDVCYEEAEKVATAITPVPGGVGPITIAMVLSNTLLAAQRRDHAKRKPL 294
33 0.000e+00UniRef50_A0A1F5VJJ8 Bifunctional protein FolD n=1 Tax=Candidatus Fischerbacteria bacterium RBG_13_37_8 TaxID=1817863 RepID=A0A1F5VJJ8_9BACT  ali  32  10..LDGTLLAEKLTEAAKNEVNIVPHLEVILVGNDPASRIYVNNKTKACDKTGIFHNTNLLPENVSNEELLKFIQELNSKKEVNGILVQLPLPPQIKKDKIIDAIDPIKDVDGLHPYNMQQWNPCTPGGILSIFKEHSIPLEGKNCVIIGRSDIVGKPLSLLLMQQNATVTICHSKTKNIPELLKKADIVCAAIGKAAFVKPDFIEQNTIIIDVGVNRISEEKLCGDVHPQ-AYTKSSYYTPVPGGVGPMTIATLINNTITAAKVQKNSQ.... 310
34 0.000e+00UniRef50_A0A1H9FAX4 Bifunctional protein FolD n=13 Tax=Bacteria TaxID=2 RepID=A0A1H9FAX4_9FIRM  ali  32  31....................GINITLAVIQVGNDKASSIYVNNKKKACEYIGINSVSYELEENVSEEELLEIIKKLNNDDNINGILVQLPLPKHISEDKVIETIDPKKDVDGFHPMSKKGFISCTPYGIIELLKRMNIEIDGKECVIVGRSNIVGKPMEMLMLRENATVTIAHSHTKNLKEVAKRADILIVAIGKPKFITSEYIKEGAVVIDVGIHRNENNKMCGDVDFLDVAPHTSAITPVPGGVGPMTIAMLMKNCVNAVEIQK....... 283
35 0.000e+00UniRef50_A0A2G6PWK5 Bifunctional protein FolD n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2G6PWK5_9BACT  ali  25  6...SCKATAEKLFQKARQGVSVTPHLVVILVGENPASQVYVSKKTEGCKAIGMKSTCIRLGADVSEEVLLREVQRLNEDASVHGILVQMPLPKHISTDKVIQAIDPNKDVDGFHPVNQPGLIPCTPMGVMALIAESGYELKGKRAVVVGRSDIVGKPMVQLLLREHATVTVMHSRTQNPEQVCSEADLIVAAVGVPGLVKGDWIKEGAHVIDVGINEVTDRMLYGDVHYSSAIKKAERVTPVPGGVGTLTIGQLMCNCVEAAKLILK...... 304
36 0.000e+00UniRef50_A0A0S8E0H1 Bifunctional protein FolD n=14 Tax=root TaxID=1 RepID=A0A0S8E0H1_9BACT  ali  27  30...................YNLTPALASIQVGENPAAAAYLRGQQKNASLLGIDFKTHILKDETSQQELIDLIKGLNKDESITGILLQLPLPKHMNSKEISKFVDPLKDVEGMHPENMGQCVTCTSLAVMELIKATGIDLYGKEAVVVGHSEIVGKPVSLLLLDKFATVTVCHIATGQLPEHVKRAEILVVSVGKPGLIKGEWIKEGAVVIDVGINRVGD-KIVGDVEFEKAVDVAGYITPVPGGVGPLTVTMLMRNLVEAFKLQK....... 285
37 0.000e+00UniRef50_A0A2M7H7T9 Bifunctional protein FolD n=1 Tax=Chloroflexi bacterium CG15_BIG_FIL_POST_REV_8_21_14_020_46_15 TaxID=1973944 RepID=A0A2M7H7T9_9C  ali  29  5.ILDGRKTSAEIRKELKKEKGITPGLGGILVGEGPGSVTYVGLKSKACQEVGIREEVARLPESVKEEELLQNIERFNQDAKIHGIFIQLPLPSHLSEEKALAAILPEKDVDGFHPLSVGKAWPAVVVAIHEMLIRGGYNPANKEVVIVNVDNMVGKPMASLLEKARANITLCYPSTPDLASYTRRADILIVSVNKPNFITADMVKKGVIVMDFGSNWVEDRKTIGDVDFEAVEEKAEAITPVPGGVGPMLVTMLLANTVMAGERQ........ 290
38 0.000e+00UniRef50_B8GC39 Bifunctional protein FolD n=9 Tax=Chloroflexi TaxID=200795 RepID=FOLD_CHLAD  ali  24  5.ILDGRVLAQALRAELRERIDRAPVIAVVQVGEDPAATRYVRSIDRLSQSLGAACRTIILPDVVTQAELEATVSRLSADDRVDGILLQLPLPAGLSLDGVLSRLIPEKDLDGIHPINRPALIPNTPAGGMELLRRYEIEVRGKRAAVVGRSAIVGRPMALLLLQADATVTICHSRTSDLGAVLRECDIIVAAAGRPQLITAEMIKPGATIIDFGTNVLADGSMVGDVDFAAAVEVAGAITPVPGGTGPVTNVMLIQNLIKATRSR........ 282
39 0.000e+00UniRef50_A0A2P6VUI8 Bifunctional protein FolD n=1 Tax=Thermoplasmatales archaeon SW_10_69_26 TaxID=1919232 RepID=A0A2P6VUI8_9EURY  ali  26  4.ILDGKAQAKHVRDAVREEHGFGPRLDAILAGDREASEIYVTKKQEDCEEVGIASHLHRFPEDVTTDELVDHIEQLNAD-DVDGMIVQLPLPDPVDENRVLETVDPAKDADGFHPVNRSPLTPATPTGILHLLEAHEADLEGADVAIVGRSTIVGKPMALLFLQRDATIAVTHSRTEELAERTGNADVIVAAAGVPELVTADMVSEDATVIDVGINRTDEGELVGDVAYDEVEAKVDRITPVPGGVGPLTRAFLLVNVVRCACKRR....... 283
40 0.000e+00UniRef50_A0A2K2FJM7 Bifunctional protein FolD n=8 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2K2FJM7_9FIRM  ali  26  4.ILKGKDVIASMKERMLKQVGVTPCLAIVRLGAKADDLAYEKGAVKRCEGLGIKCVVMEYDESISQKELEDEIRKLNEDTGIHGILVFRPLPKHIDENAIKYVISPDKDVDCFSPVNVAKVFPCTPEAVMEMLEHYGVDVSGKRVVVIGRSLVVGKPLSMLLLRKNATVTICHTKTRDLGGTARTADILIAAAGKARMITKEFVSPGQIVIDVGINMDKDGNLCGDVDYDNVEKTVAMITPVPGGVGTVTTSILAKHVLAAAWR......... 280
41 0.000e+00UniRef50_A0A0R1UKU4 Bifunctional protein FolD n=1 Tax=Lactobacillus equigenerosi DSM 18793 = JCM 14505 TaxID=1423742 RepID=A0A0R1UKU4_9LACO  ali  26  4..LDGRAVARKLKADALRQQGIIPSLAIIMVGTNPASLVYTRNKERLATELGIQVEMKTLPATATEPEVAAAIEDCNQDPQIDGIILQSPLPNGLPEDQLSQLILPAKDVDGLHATNLGKPIAATPQGIMGLLASYDLAVTGKRVVIIGRSRLVGLPLAALMQNAGATVTVAHRQTQDLTTLTRQADILVVATGQPELVTVPMVKDGAIVIDVGINRVA-GQLVGDVDYESVAPLASWITPVPGGVGPMTVASVLSQTVQLAQRR........ 280
42 0.000e+00UniRef50_A0A1Z9AWX0 Bifunctional protein FolD n=14 Tax=Bacteria TaxID=2 RepID=A0A1Z9AWX0_9PROT  ali  28  28...................YKKVPGLTVILIGEMTPSQIYVRNKEKSANEIGLKSEVIKYPESVEEKIVLDKIKELNNDDTVSGILVQLPLPKHIDKQKVIETISPNKDVDGLHPINYQGSIPCTPLGCYLLIKKIESNLTGKKAVMIGRSNLNGKAMAQLLLQEDCTVTITHSKTKNLKEECLVADIIVAAVGIKELVRGDWVKKDAIVIDVGINKTEKG-IVGDVAFNEVSKVAKALTPVPGGVGPMTIACLLKNTIECFKRFQN...... 281
43 0.000e+00UniRef50_A0A1C7D4U6 Bifunctional protein FolD n=20 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1C7D4U6_9SPHN  ali  27  4.LIDGRALARSLDEETRAGVAERPGLAVVLVGSDPASEVYVSHKIRACARVGIVSYEHRLPESTSQDALLTLIARLNVDPTVHGILVQVPLPPHIEAGVILGAIDPAKDVDGFHPVNVGRLVPCTPLGVMKLLDTVIDDLTGMNVVVIGKSNIVGKPIAMLLLEREATVTVTHIETRGLPEIARRADVIIAAAGAPRLVRGFWVKQGAVLIDVGITRDGGENLVGDIAIDE-MEHAKAVTPVPGGVGPMTIACLLANTLKAARNAGKGQDGR. 291
44 0.000e+00UniRef50_A0A1R2CTZ4 Uncharacterized protein n=1 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2CTZ4_9CILI  ali  28  5.IFDGRALSKVILQELKQEVTSVPKLAYVYMGTNKSVLTYLGIKHRACDFLGIQAKGYQFKENAPVQEVMAQINELNQDKTLSGILIQLPLADGIDTQQVMDCIDVTKDVDGLHSMNIGKYYPCTPLGCIEILKRNNIQIQGKHAVVIGRSNLAGTPLALLLQKQNATVTICHKYTNDVSLFTKQADILAVAVGKPEFIKRNMVKPGAIVVDIGINEY-NGKLVGDVHSD-VAEVSSFFTPVPGGVGPMTVAMLMTNLVKSW........... 281
45 0.000e+00UniRef50_A0A1Z5LDJ2 C1-tetrahydrofolate synthase (Fragment) n=1 Tax=Ornithodoros moubata TaxID=6938 RepID=A0A1Z5LDJ2_ORNMO  ali  29  39.IINGRRIAKQIEGEVRTAVKRRPHLSVVLVGDDEASTVYVKNKVKATERTGITSETFRLPSCTSETQLLDVIGRLNGNPLVDGILVQLPLPPHIDESTICNSIFPQKDVDGFHALQMGRLCPCTPLAIVEILNRIGVEPYGKHVVICGRSAIVGLPISIMLPYGNATVSVCHSRTKDLCALTKMADILVTATGSPGLITANMVKPGVCIIDVGITRMPDTKLVGDVDFDDVAPRCSYITPVPGGVGPVTVAMLMRNTYFAHIGRIK...... 360
46 0.000e+00UniRef50_A0A1F5URS7 Bifunctional protein FolD n=1 Tax=Fraserbacteria sp. (strain RBG_16_55_9) TaxID=1817864 RepID=A0A1F5URS7_FRAXR  ali  25  7.LIDGRAVAQTLRAELQKEIGIVPALAVLWVGDDPASGIYFRAKEKLARELGIEFRGEKLDAGISLDSLLDELDELNCDSEIDGIFVEFPLPDHISPEAVRNAIAPEKDVDGITPVNQEGLIPATPYGVMMLLRASGVELRGANAVMVGRSEVVGKPLALLLLNADATVTLCHSKTRNLREHTLRADVLCVAVGQPRMITADMVQDGAAVIDIGLNWTP-GSIVGDVDFERVKERSSLITPVPGGVGPMTATVVMKNTVEATKRR........ 282
47 0.000e+00UniRef50_P07245 C-1-tetrahydrofolate synthase, cytoplasmic n=212 Tax=cellular organisms TaxID=131567 RepID=C1TC_YEAST  ali  28  5.VLDGKACAQQFRSNIANEIGFAPNLAIIQVGNRPDSATYVRMKRKAAEEAGIVANFIHLDESATEFEVLRYVDQLNEDPHTHGIIVQLPLPAHLDEDRITSRVLAEKDVDGFGPTNHPFFLPCTPKGIIELLHKANVTIEGSRSVVIGRSDIVGSPVAELLKSLNSTVTITHSKTRDIASYLHDADIVVVAIGQPEFVKGEWFKPKTVVIDVGTNYVADPKCVGDVEFNEAIKYVHLITPVPGGVGPMTVAMLMQNTLIAAKRQMEESSK.. 305
48 0.000e+00UniRef50_C1CVC4 Bifunctional protein FolD n=15 Tax=cellular organisms TaxID=131567 RepID=C1CVC4_DEIDV  ali  29  5.ILAGAPAAQAILAQASQRAVKRPHLVLVRAGTDPASLSYVRGKQRHADIAGLRSTVHALPESVTLPELLALIATLNADRDVHGILIQLPLPAHLPVALLQEAVDPRKDVDGFHPLNVGRLWPCTPLGVLALLRHYEIPVAGRRAVVVGRSDIVGRPMAAVLLGADATVTVAHRQTSDLGAVTREADVLVVAAGQPWLMTPDMVRPGAAVVDVGIHRIPGDHLTGDVHPE-VANVAGALTPVPGGVGPLTVAQLMLNTVIAAERQ........ 286
49 0.000e+00UniRef50_A0A2A5A7T9 Bifunctional protein FolD n=4 Tax=root TaxID=1 RepID=A0A2A5A7T9_9BACT  ali  29  4.IIDGKARAKELRKSLKERVGHAPGLGVLLVGEDPASAVYVRNKERACEKTGIRSFHHQLAIDISQQQMEECIDKLNADPQVHGILLQLPLPAQLDAAPLLERILPEKDADGFHPVNQPTFVPXTPLGCIDLLLWSGVTLEGADAVVVGRSNIVGKPIAQLLLAEGATVTICHSKTRDLAEQVRRAEVLIAAVGRPEMIRGDWIRPGAAVIDVGINRLDDGSIVGDVEFEAAAARAGYITPVPGGVGPMTVVKLLENTLEGAIR......... 280
50 0.000e+00UniRef50_A0A0R2C4J8 Bifunctional protein FolD n=3 Tax=Lactobacillus TaxID=1578 RepID=A0A0R2C4J8_9LACO  ali  29  26.............ASLTNQLGRKPKLVVVAAGDDPASAIYIRNKQRRANTVGIDAVTEHLPVTARTADVLAVVRRLNADPTVDGMIVQLPLPSGVDTEAIRNAVDPEKDVDGFTDVNLGRLWPCTPRGIMKLLAFYNVSVAGKRAVILGRSNIVGKPMAALLLHANATVTIAHSRTTNVQAILGDADIIVAATGSAGLVTDADVKPGAVIIDVGMNRVADGKLVGDVDFDSVQHLASAITPVPGGVGPMTVNMLIYQTLEAAQRR........ 293
51 0.000e+00UniRef50_A0A1Z8ZBQ6 Bifunctional protein FolD n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Z8ZBQ6_9PROT  ali  27  3.IINGKKIAEELKDRLKKNKNIVPTLVVILIGNNPASKTYVKNKQIKADEVGIKSTVKMLSTETTEKDLLDIIDSYNNDNDIDAILVQLPLPSHINANKITDAISYEKDVDGFNSKNRPYIVPCTPLGCLKLL-RTVVNLTGTKAIIVGRSNIVGRPMSYLLTNQNSTVTLAHSRTKNLKELCLDNDIIIAATGIPKMIKSDWVKEKAIIIDVGINQIDDKILVGDVDYSDVFSKVKAITPVPGGVGPMTIHCLMENTFKLSLLRRNLKYN.. 289
52 0.000e+00UniRef50_G2KWA4 Bifunctional protein FolD n=6 Tax=Lactobacillus sanfranciscensis TaxID=1625 RepID=G2KWA4_LACSM  ali  26  9.IIDGRKVAKQLNESTKQKVGVTPGIAVILVGNNDASRRYVHMKEKKANELGINSIMKTFSEDVSEKVVIDTINKLNSNPKVNGILVQSPLPKHINEQKVINTISPEKDVDGFNPINIKYPVACTPKGIMTLLEKYQVNLDGAKVVIVGRSSIVGKPMLALMLNANATITVVHSHTKNLKAYTQAADIVISSVGKYKTLEDKDFKPGAYVIDVGQNLDSNGKLVGDVNYDPKTSKIGYITPVPGGVGPMTIATLMQQTVEMCEW......... 286
53 0.000e+00UniRef50_A0A0G4FQS0 Uncharacterized protein n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4FQS0_9ALVE  ali  27  112.VIDGKAVAADIEARLRNKFYRNPSLAVVLVGNRTDSATYVRMKDRAASEVGIESNVYRMPESASQDDLMALVRRLNANLTVDGLLIQLPLPDHMDENVCLSAIAVEKDVDGLHPSNVCMFKPCTPFGSVELLKRCGVQLEGKSAVVLGRSRHVGLPTALLLGQENATVSLLHSRSSEHKMLIREADIIVAAMGRAGFVKGGMVKEGAVVVDVGINPVPDYRLVGDVEFEEVKAHAGLITPVPGGVGPMTVAMLMVNTLTSSKRRQ....... 425
54 0.000e+00UniRef50_A0A0T5ZWN6 Bifunctional protein FolD n=1 Tax=candidate division WWE3 bacterium CSP1-7 TaxID=1576480 RepID=A0A0T5ZWN6_9BACT  ali  30  1MLIDGKKISAEIGSRLAKEIRRKPRLAVVLVGNNPASRIYVRKKGEAASRVGIGFTLYEL-LNPSQKEVLILIGRLNADREVNGIIVQLPLSKKLDEELIISHISPDKDVDGLNPFS--DFTPATAGAVLEVLQRQKIKIAGARSVVVGRGKVAGMPVALALLANDATVTIAHSKTKNLAELTKQADILVSSVGRPMMIKPAMVKKGAAVIDVGISRM-GGKLRGDVDP-AVERRARFLTPVPGGIGPLTVVKLLENVIRASQLQ........ 263
55 0.000e+00UniRef50_Q6F1V0 Bifunctional protein FolD n=18 Tax=cellular organisms TaxID=131567 RepID=FOLD_MESFL  ali  34  2IILDGKKVASRRKEELTAKISRKPKLVVIMVGNDPASEVYVSHKIKVANEVGIYSELLRFDKDIKKEELYNKINELNNDQNIDGILLQLPLPIDFIEEDYLQAITPSKDVDGFHYINQGKMYPCTPLGIINLLEEYNISVKNKDITLIGTSNIVGKPLGMMLLNNQATITMCNKNTKNIKNHTINADIIISATGKQFIITEDMIKKDAVIIDVGIIRDPTNKLVGDVDFEKVKLKSSYITPVPGGVGPMTVITLMENTFVLYEKHINKSK... 286
56 0.000e+00UniRef50_A0A1G0SJI3 Bifunctional protein FolD n=7 Tax=Bacteria TaxID=2 RepID=A0A1G0SJI3_9BACT  ali  29  29....................KKVPGLVTILVGNNPASEIYVSSKGKACEEIGMITKSEQHPDNISEKGLLDLVESYNENPDYHGILVQLPLPKHIDEDKVIETISPKKDVDGFHPISIGKFASCTPAGIQELLIRYRIETEGKHVVVLGRSNIVGKPIANIMLQKKKFVTICHSAAKDVSYYTKQADILIAAIGKANFVKEDMVKDGVVVIDVGINRIEDYKVCGDVDFKNVSKKASYITPVPGGVGPMTIAMLLKNTYKAYLM......... 289
57 0.000e+00UniRef50_A0A1G1WTA4 Bifunctional protein FolD n=1 Tax=Candidatus Woykebacteria bacterium RIFCSPLOWO2_01_FULL_43_14 TaxID=1802605 RepID=A0A1G1WTA4_9BA  ali  31  4.VFDGKAYAQNITARLKQEAGLAPHLAIVMIGEDQASRIYVDKKVEAAREIGAEAEVLDFPEDVPEGEIIRHLRNLNDDKSVTGIIVQLPLPKGLKKERVLSQIERTKDVDGLTKGSQFVG--ATPRAVMEILTSSNQTLVGKYAVVVGSSDLVGKPVANLLLDENATVTVTNDKTKDLASFTRAADILVSCAGVGHLITAEMVKDGVVVIDVGITRQRDGKIVGDVEFEGVCSKSSFITPVPGGVGPMTVAMLLSNLVLASQK......... 267
58 0.000e+00UniRef50_A0A218UYM3 C-1-tetrahydrofolate synthase, cytoplasmic n=1 Tax=Lonchura striata domestica TaxID=299123 RepID=A0A218UYM3_9PASE  ali  28  6.ILSGKIVSGQVRERLKQQVGFRPGLAILQVGNRDDSNLYINMKLKAAAEIGISANHIKLPNTATEADVLKCIASLNADPAVHGFIVQLPLDKPINTEKITNAVAPEKDVDGLSSINAGKFIPCTPKGCMELIRQTGVQVAGKRAVVIGRSKIVGAPMHDLLLWNNATVTTCHSKTSTLAEEVGKADILVVAAGRAEMVKGEWIKPGAIVIDCGINHVPDKRVVGDVAYSSAKEKASFITPVPGGVGPMTVAMLMQSTVESAQRFLEKFQPG. 316
59 0.000e+00UniRef50_A8IFV5 5,10-methylenetetrahydrofolate dehydrogenase (Fragment) n=3 Tax=Chlorophyta TaxID=3041 RepID=A8IFV5_CHLRE  ali  22  3.ILDGRAVAAAWERELTELLGRPPGLGVVLVGSRPDSMLYVTKKQEACQKAGMNTYVHHLPDTVSQSQLEAALAHVCADGRVDGVLIQLPLPRHLSEEAVMEVLDPRKDVDGFHPLNMGRMVPATPLGCIELLRRSGVDVQGKNCVVLGDSNIVGTPLAAMLRDKAAAVTICHRRSYQLPDLTRSADILVVAVGHPELVRGDWVRPGAVVIDVGINVVSTPRVVGDVAFDEVSRVAGAITPVPGGIGPMTIAAVLHNTLKAAKYR........ 295
60 0.000e+00UniRef50_A0A2E6BMA6 Bifunctional protein FolD n=2 Tax=Bacteria TaxID=2 RepID=A0A2E6BMA6_9RICK  ali  27  3.IIDGKKTANNLNADLKEKFSLIPCLAVILVGNNKASEIYVRNKEAKAKEIGIKSKVIRIPIDVKENELITTIKECNENENIDGILVQLPLPTQIDPDKIIECINPNKDVDGFHPENRPKVIPCTPLGCFKLLNSV-TKMEGKNIIIVGRSSIVGRPLSYLLTNKNATVTLCHSKSKNIKDLCSNKDILIAAVGVPHLIKKEWVKPGAIVLDVGINSVKHSKLAGDVDYHDVLSKVSAITPVPGGVGPMTIHSLLENTIRLSILRRSINYN.. 289
61 0.000e+00UniRef50_R5A898 Bifunctional protein FolD n=2 Tax=environmental samples TaxID=2231195 RepID=R5A898_9CLOT  ali  30  3.IMDGKNLSNIIKDDLRKEISQTPILAVITIGDDEASKVYVNNKRKSCEQVGISFMHFDYLSEVKESVVINKIKELNKDVSVNGIIVQLPIPDHFNVDKIINTIDVSKDVDGLTNESKIRRMPCTTKGILELLDYYKINIESKRVVVVGRSELVGTPTYQECLKRNATVTICHSKTIDLGSITKEADILIVATGHKYLIDKNMIKEGCVIIDVGISRD-NGKLYGDVNP-NVSDKCSYLTPVPGGVGPMTVVMLLKNTFIAYKSQH....... 275
62 0.000e+00UniRef50_A0A1F7WFU8 Bifunctional protein FolD n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1F7WFU8_9BACT  ali  27  3.ILDGKQTAAYYREELKKNGIAAPRLAAFLIGDNIASAMYIKMKEKACAEVGILTRTHVLDAKTPEAEIIKLIKDENADPQTSGILVQLPLPKHYDEKKILSYIEPSKDADCFLPQNIGHMFPCTPLGVMKLLKYYKIDVASKEVCIIGRSNIVGKPLAFLMLKDNATVTMCHSKTRDLKEVAKRADILVAAIGRAKMIDSSYVKPGAVVVDVGINHIEDGKTCGDCDFESVSKIASYMTPVPGGVGPMTIAMVLYNTLYNYVLIKKLDIK.. 291
63 0.000e+00UniRef50_A0A258X8N2 Bifunctional protein FolD n=1 Tax=Alphaproteobacteria bacterium 16-39-46 TaxID=1970490 RepID=A0A258X8N2_9PROT  ali  30  4.VFNGKKTASRFLVKLQSDYKIRPCLGIIRIGENPSSALYVKNKLKIFKSLGLEAQEYWFDETISYLELCSKIDDLNHDVSVHGIIIQLPLPPHFNVQEICNQINPLKDVDGLTLHNQSGLVPCTPLGCTFILKSLFKDLSGKRTLVLGRSLLVGKPAALLLLHENATVTIAHSKSENLPELIENTDVLISAIGHPHCIKGSWIKKGAVVLDVGITKSMSSQFFGDVEFEEARQNASFITPVPGGIGPMTVACLVYNTYKAAKR......... 284
64 0.000e+00UniRef50_H2U4F9 Methylenetetrahydrofolate dehydrogenase, cyclohydrolase and formyltetrahydrofolate synthetase 1 n=144 Tax=Opisthokonta TaxID=33154 Re  ali  27  6.IISGKEVSAQVRECLKKDVNFSPGLVVLQVGDRDDSNLYISMKLKAAKEIGINATHMRLPKTATEDEVLHSIKEVNENSSVHGLIVQLPLDSKIDTEKVTNAVAPEKDVDGLTSINAGKFIPCTPNGCMELIKQTGVSVAGKRAVVIGRSKIVGAPMHDLLLWSHATVTTCHSKTADLPGEVGKADILVVGIGKAEMVKGEWIKKGAVVIDCGINHIPDKRVVGDVHYASAKEQAGFITPVPGGVGPMTVAMLMANTVLSAKRFLESHQPG. 303
65 0.000e+00UniRef50_G8PFX3 Bifunctional protein FolD n=3 Tax=Pseudovibrio TaxID=258255 RepID=G8PFX3_PSEUV  ali  29  7..ICGKTLATVIDGEVKEAIGKTPKLTVVVVGDDPASAIYVNNKVKRCRKVGIESEKLALDANITQAGLTQVIRDLSADPENHGILLQLPLPNGMNAREILHEIAPEKDVDGFHPLNFGSFMPCTPQGCLRLLKTVIDDFHGKDATVIGCSNIVGKPMAELLLQQGCSVTSVHHLSHDIKGKVRAADIIVAAAGSPHLVKAEWVKPGAVVIDVGINRLRDGKIVGDVDFDAVSKIASAITPVPGGVGPLTISYLLVNTVRAFAHQ........ 289
66 0.000e+00UniRef50_A0A1B7T9A6 FTHFS-domain-containing protein n=5 Tax=Opisthokonta TaxID=33154 RepID=A0A1B7T9A6_9ASCO  ali  30  28.VLSGKDLAKNMRVELAQKIAKNPNLKILQIGSRSDSSTYVKAKLNASTESGVACTVEKLPENISEIELLQKIEAINDDDSIHGLLIQLPLPRHLDETLITNAVSAFKDVDGFHRYNEPYFIPCTPNGCMRLLEETKIPLKGKNAVVIGRSDIVGTPVSSLLKKKDCTVTMVHSNSVNVPEIIKNADIVVAACGVPKYVKGDWLKKGAIVIDVGINYIPDRKLVGDVDYESCKEKASFITPVPGGVGPMTVGMLTKNVYEAALKAFK...... 316
67 0.000e+00UniRef50_A0A1V9ZCL9 Uncharacterized protein n=2 Tax=Saprolegniaceae TaxID=4764 RepID=A0A1V9ZCL9_9STRA  ali  27  6.VINGTFIAAKMRAQVKAKISVKPALGVIMAGERKDSKLYVEAKGRACREVGIQSVNRFFSSSVTQEEVLHQVHLFNNDHAIDGILVQMPLPSTIDEKVIIDAVLPTKDVDGLHPFNMRGRTPCTPEGVVQMLDEEGVEINGKVAVVLGRSDLVGNPVGMLLRKRNATVISCHSKTINIPHFVRQADIVISACGVPHIVRGEWLKPGAVVIDVGINFINDSKMVGDVCFDEAIGVAGAITPVPGGVGPMTIAMLMRNVCTSFERRINLK.... 294
68 0.000e+00UniRef50_A0A1V9XYV6 Bifunctional protein FolD-like n=1 Tax=Tropilaelaps mercedesae TaxID=418985 RepID=A0A1V9XYV6_9ACAR  ali  26  42.ILDGRSVARVREGALRHHVKPPPSLAVFLVGHNPASEVFVRKKQMACARVGILFHLIRMHDSVKQEDLVHEIHRLNQNPSIHGVIVQLPLPAAMNANQVCSEVLPLKDVDCFTPENVGKLCPCAPKAVLTLLEEADTALESTNTLMIGRSNLVGQPLSMMLGHRGATVATAHSLTPPLLDLCRWANLVVSAAGVPHLVRGGMVRPGAVVIDVGINRLPEGGVVGDVHFDEVRQKASVLTPVPGGVGPLTVVSLLENTFLAYELQN....... 318
69 0.000e+00UniRef50_A0A0P5U802 C-1-tetrahydrofolate synthase, cytoplasmic n=2 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5U802_9CRUS  ali  30  7.LLSGTEIAKNLRAGLNEQVGFTPGLNIIQVGAREDSNVYIRMKMKAAEEIGIKASHVVLPSSTTQAELIRVLNKINLDPSVHGIIVQMPLDSKIDSTLITDSVLPSKDVDGLNTINQGKFLPCTPNGCMELIKRTGIKIEGSQAVVIGRSKIVGTPAAELLKWHHATVTVCHSKTKNLPQLVANADILVVGIGQPNMVKGEWIKQGAVVIDCGINSISDYRLVGDVDFEGAKTKASWITPVPGGVGPMTVAMLMKNTVLA............ 291
70 0.000e+00UniRef50_A0A1V5MP55 Bifunctional protein FolD n=1 Tax=Firmicutes bacterium ADurb.Bin419 TaxID=1852892 RepID=A0A1V5MP55_9FIRM  ali  29  7.IIDGKAIAGKIREEIKEKIGIKPGLAIILAGDNPASRIYVDRKKKACKEADIESFEYLFPGDCKEEELLQTIEKLNKDVNVHSILVQLPLPDHISEENIIEALHPGKDVDCLHPYNKDHFFPCTPHGIYRMLRDSDIEIERKHVVILGRSKIVGKPMADIFLRKDATVTVCHSKTVNLSHYTLQADILIAALGTY-----------QSLIDVGINRIPHKSIVGDVAFEEVAEKASYITPVPGGVGPMTIAMLLHNTLKSAEKTVRSVK... 286
71 0.000e+00UniRef50_A0A1I7H5G2 Bifunctional protein FolD n=1 Tax=Clostridium sp. DSM 8431 TaxID=1761781 RepID=A0A1I7H5G2_9CLOT  ali  32  4.IINGREIAKAVKEEIHKNNKSVPKIASILVGNDGGSIYYMNNQEKVATSLGLLFEKIILNEVTTEEELIKLIERLNKDESVSGIILQLPLPKHINEKKVVNYIDESKDIDCLSIKSQGKFIPCTPNSVVTLLKMLNINLSGKEAVVVGRSNIVGKPAAQLLLNENCTVTICHSRTKNLQEVCKRADILVAAIGKPKFINENFIKEGAIVIDVGTSSV-DGKICGDVDFEKVIEKASFVTPVPGGVGALTTTLLIKNACEALKKNEN...... 282
72 0.000e+00UniRef50_A0A0B2QXP6 Bifunctional protein FolD (Fragment) n=5 Tax=rosids TaxID=71275 RepID=A0A0B2QXP6_GLYSO  ali  27  8......EVADEIR-RMKSGIGKFPRLAVVLVGDRRDSHTFIHIKLKACDQVGIETVTSQLPENCDESELLDVVSGFNEDPDVHGILVQLPLPQHLDEEKIINVVSLEKDVDGFHPLNKPFFVPCAPKGCIELLPRHGVEIKGKRAVIIGRSKIVGLPTSLLLQRHHATVSVLHAYTKNPEHITSEADIVVVDVGVPNIVCGNWIKKGAVVIDMGTNQVKDPSVSGDVCFEEAVKVASAITPVPGGVGPVTISMLLSNTLDSAKR......... 278
73 0.000e+00UniRef50_UPI000370F165 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase n=1 Tax=Meiothermus timidus TaxID  ali  27  1MLLAGPPVAEAVYEELKAQLAHVPHLRVVRVGEDPASVSYVRLKDRQARKIGLSSQVDVFPEDTSEQALLEHIARLNADDGIDGILVQFPTPRQIRQQAVLEAIDPAKDVDGLTPVNAGRLWSCTPAGIMRLLGHYGITVAGKEVVIVNRSNLVGKPLAAMMLRENATVTIAHSRTQNMAEITRRAEILVTAVGRAGFITPEMVRPGAVIIDVSVNRVGRNILAGDCVPE-VARVASALTPVPGGVGPMTVAMLLFNTVKAAVRRR....... 281
74 0.000e+00UniRef50_A0A2K6CBJ0 Methylenetetrahydrofolate dehydrogenase, cyclohydrolase and formyltetrahydrofolate synthetase 1 n=14 Tax=Bilateria TaxID=33213 Re  ali  31  49.ILNGKEISAQIRARLKNQVGFIPGLAILQIGNRDDSNLYIKVKLKAAEEIGIKATHIKLPRTTTESEVIKYITSLNEDSTIHGFLVQLPFDSEINTEEVINAIAPEKDVDGLTSISNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTANLNEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLI--FYKSSENAKRFLEK.. 340
75 0.000e+00UniRef50_F8I0G7 Bifunctional protein FolD n=2 Tax=Weissella koreensis TaxID=165096 RepID=F8I0G7_WEIKK  ali  26  4.IINGKEIAQQVRNEVTNQVGIIPGLAVIIVGDDPASQIYVRNKEKAAAKAGINGQTISFPADVVEEDVLNKIQELNQDDTIDAILLQSPVPKQIDEQKMQSAIDPSKDVDGFNPLNIGKPIANTPKGIMRLLAETQVELSGKFIVILGRSILVGRPLFALLEAQNATVALLHRYTPDRHNLLQQADVVIAATGVPGLVQGVDLKAGAVVIDVGITRLPDGHLTGDVDFTTAQEVASAITPVPGGVGPMTIATLLQTTVELAVQHHQME.... 288
76 0.000e+00UniRef50_A0A2P6KCS9 Translation factor GUF1 homolog, mitochondrial n=1 Tax=Nephila clavipes TaxID=6915 RepID=A0A2P6KCS9_NEPCL  ali  32  924.LLDGKEVSAKLKEDIKRELGRKPHLVAILVGNDGGSETYVASKMRNCEQVGFDSTNLHYEDSITEEALLAKIAEINQDDSIDGLIVQLPLPKHIDPEKVTEAIDYKKDVDGFHPINLGRMQPATPYGIMLMLEHYQINTSGMKAVVVGRSNIVGSPMSILLARNNCTVTLTHSRTQNLKEEVLQGDIVVAAIGRKNFVTAEMVKEGAIVIDVGINRESGFKLYGDVDFEEVSKKASWITPVPGGVGLMTIIGLLKNTLEAAK.......... 1209
77 0.000e+00UniRef50_A0A0S7Y6J8 Bifunctional protein FolD n=2 Tax=root TaxID=1 RepID=A0A0S7Y6J8_9BACT  ali  28  3IWLEGKTLAGKIREEVKEQVKKVPGLVGILVGENPASKVYLRTKERTSEKLGIHSEILKFPADIEKASLKAEIEKLNERDDVDGILVQLPLPPSFNPFEIIAIISPEKDVDGFHPWNQEGFKACTPMGIIELLKSNNIPILGKRVVIIGRSLIVGKPLAAMMTNEHGTVTTCHSKTANLSQVASEADILVAAIGRTAYVNTDFVKPGATVVDVGMNQLKDYTLIGDVDP-RVIEKAAYLTPVPRGVGPLTVAMLMRNTLEAFKRRKKLK.... 306
78 0.000e+00UniRef50_Q14NV1 Bifunctional protein FolD n=21 Tax=cellular organisms TaxID=131567 RepID=FOLD_SPICI  ali  31  6.IIDGKMVSELIKAKIKAKKQRVPALTIIQIGNNKASTTYIKNKKIACEKVGVTCKVLNYPDIITESALIKIINDLNNNSKIDAILVQLPLPSHINSEKVINTIITKKDVDGFTPKGHYNLLPSTPKGIIALLKHYQIQLAGQHVVIIGRSNIVGKPLANLLINASATVTVCHSQTKNLSDFTNQADILISAVGKAKFVTAEMIKENVIVIDVGINRDEDNNLCGDIDFHNVFSKVKMITPVPGGVGPMTIAALLENILYFYQLNQKI..... 286
79 0.000e+00UniRef50_B4KD13 Uncharacterized protein, isoform A n=86 Tax=Opisthokonta TaxID=33154 RepID=B4KD13_DROMO  ali  31  7.VISGTAVAKNIREELRQQVNFVPGLRIVQVGGREDSNVYIRMKIKAATEIGINAVHVQLPRSITESELLDKLSDLNADPQVHGIIVQMPLDCEIDAHRITDAVSPAKDVDGLHTVNEGRFLPCTPWGCLELIRSTGVEIAGARAVVLGRSKIVGTPAAELLKWANATVTVCHSKTRNLEEITRSADILLVGIGVPEMVKGSWIKPGAVVIDCGINVKPDSRLVGDVDYEQAKLVAGYLTPVPGGVGPMTVAMLMKNTV.............. 288
80 0.000e+00UniRef50_A0A2P2IFS6 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial n=1 Tax=Hirondellea gigas TaxID=1518452 RepID=  ali  29  33.VLDGKKLAKQLQAECAREVKTAPHLVLVQVGQDPASTIYLRNKTRAANEVGVNSTTHRLAENVTLTELLHLLQSLNDDPAVNGVLVQLPLPPQLEEKVVCNAVHPSKDVDGFHATNIGRFCPCTALAVGELLRRYDIATFGLNAVVCGRSKNVGLPIALLLHGDDCTTTICHRYTPPLRQHLSNADIVVTAAGVPNLIRGEHLKPGCCVVDVAVNRIKNKKLVGDCHFESCVEVAGHISPVPGGVGPLTVAMLMRNTILATKQQRQLT.... 328
81 0.000e+00UniRef50_Q8RDM4 Bifunctional protein FolD n=103 Tax=Bacteria TaxID=2 RepID=FOLD_FUSNN  ali  30  1MLMDGKELARDIKVKIKAEININPMVATILVGDDPASQVYLNSQVKSYQDLGIGVQKYFFSEEISEAYLLNLIDKLNKDTEVDGIMINLPLPPQINATKVLNSIKLIKDVDGFKAENEGFTSPSTPAGIMALIEKYNIDLEGKDVVVVGSSNIVGKPIAALILNSRGTVTICNIYTKNLAEKTKNADILISAVGKAKLITEDMVKEGAVVIDVGINRV-NGKLEGDVDFENVQKKASHITPVPGGVGALTVAMLLSNILKSFKANR....... 280
82 0.000e+00UniRef50_C9M869 Bifunctional protein FolD n=7 Tax=Bacteria TaxID=2 RepID=C9M869_9BACT  ali  30  5.IVDGKALAAKLKEDLKAR-GVEPKLAVLMVGDDPASEVYAGQKKKNCEKLGIAFEMDRLSASSTEEQVLAALQTLNDDPTVTAIMVEMPLPKGLDNNKVQAAICPEKDIDGANPVNLPCMRACTPSAAIALAEEAGVDFKGKKVVVLGRSVTVGKPAALIALEKHATVTVCHSRTVDLAGETRQADVLIAAIGKPKFVTADMVKPGAVVIDVGINSTPDG-LVGDCDTEALMSVASAITPVPGGVGPVTNAKLIGNIVEAASRR........ 280
83 0.000e+00UniRef50_A0A2K8P3P6 Bifunctional protein FolD n=17 Tax=cellular organisms TaxID=131567 RepID=A0A2K8P3P6_9MOLU  ali  34  2IILDGKKVALKRKNELALKISRKPKLVVIMVGNDPASEVYVSHKIKIANQVGINSELLRFNYDIKKEELYNKINELNSDINIDGILLQLPLPDDFIEEDYLQAITPLKDVDGFHYINQGKMFPCTPLGIINLLEEFSIDVKNKDITLIGTSNIVGKPLGMMLLNKQATVTMCNKNTKDIKKHTVEADIIISATGKQFIISEDMIKNDAIVIDVGIIRDPTNKLVGDVDFDNVKLKASYITPVPGGVGPMTVITLMENTFNLYEKQLNKIK... 286
84 0.000e+00UniRef50_A0A1Z9LSH3 Bifunctional protein FolD n=6 Tax=Bacteria TaxID=2 RepID=A0A1Z9LSH3_9PROT  ali  27  2MILDGKKEAAILREEIKKEINKVPGLTVILIGDFVPSQIYVRNKEKNSREVGMNSNVIRYSKNVTEQEVLKKIEELNAXKEVSGILVQLPXPXQIDQEKIINSIXPSKDVDGLXPINYDAMXPCTPLGCLLLLKKXXKNLSGKRVVIIGRSNLNGKPMAQLLLKENCTVLITHSKTINLKMECQKADIVIAAVGKANLVKKDWVQDGAIVIDVGINKQGN-KIVGDVSYDEVKDKVKAISPVPGGVGPMTIACLLQNTLKCFKAR........ 279
85 0.000e+00UniRef50_A0A1F3VIA4 Bifunctional protein FolD n=1 Tax=Bdellovibrionales bacterium RIFOXYC1_FULL_39_130 TaxID=1797396 RepID=A0A1F3VIA4_9PROT  ali  27  1MSLNSKEVKSNLISKLRQEVEIVPGLAVVLVGDDPASAVYVKNKIKTCAELGINSIQKILPHTTSQTELLAVIEQLNSNPEIHGILCQIPLPRHLNEEEIIHSITPLKDVDCFHPFNLPRYIPCTPFGILQILKYNQIAISGKNVVILGRGHTVGRPLSILLSAKDATVTLCHSKSTQVQSICKSADILIAAIGIPKLVNRDYVKAGATVIDVGINRISDGILAGDVDFDDIKEIAYAATPVPGGVGPMTITMLMANTINAARIN........ 287
86 0.000e+00UniRef50_A0A2V1AK58 Uncharacterized protein n=2 Tax=Clavispora/Candida clade TaxID=1540022 RepID=A0A2V1AK58_9ASCO  ali  28 1745.VVSGTKLAKSIKHQVAQKVTFKPQLTIIQVGSRPDSSAYVRSKLKAAQISNIQSKLVQFDEDFTEEELLEEVDRLNKDPKVNGILIQLPLPKHINETLVTNAVATEKDVDGFDRFNNPKFRPCTPNGIMELIKTTGVQLRGKSAVVIGRSDIVGTPVAAMLRNEDCTVTVCHRYTYDLPSVVRSADVIVAAVGIPEYVKADWVKDGAVVIDVGINYKEDKRLVGDVAYEEVAKKASYITPVPGGVGPMTVAMLCSNVYDAAIAQAK...... 2050
87 0.000e+00UniRef50_A0A2G7FV82 Formyltetrahydrofolate synthetase n=1 Tax=Aspergillus arachidicola TaxID=656916 RepID=A0A2G7FV82_9EURO  ali  29  6..IDGTQIAKNIRAGLKNEIQFKPSLVIFQVGSRSDSSTYVRMKLKAAEEAGIICKIVNLPETAIESELLQDITKANNDPSVHGILVQLPLPQHMSEHTITSAVADEKDVDGFGAVNRPLFVPCTPQAVMELLRVSGVNPAGKKAVVLGRSDIVGSPVSYLLNKADATVTLCHSKTPDVESIIKTADILVAALGKTEFVKGEWLKPGVVVIDVGINYKPDPRLVGDVDFESAVQVASQITPVPGGVGPMTVAMLMQNVVNSAKSYFEKQKDR. 298
88 0.000e+00UniRef50_A0A1Q3P751 Bifunctional protein FolD n=1 Tax=Alphaproteobacteria bacterium 33-17 TaxID=1895704 RepID=A0A1Q3P751_9PROT  ali  30  4.IIDCIGLAKKIVARLK-DSAIFPKLSVLLIGDNPASTIYVNNKVKKCHELGIESSVHTLSINATQEEVESLIDTLNNDNKVHGILVQLPLPNHLDSFRITQKVSPEKDVDGFTSYNKATLIPCTPLGITKILDSLNLDLTGKKVAVIGRSNIVGRPLVNLLINKDFTVVCLHSKSLNLEEELKTADIVIPAIGSPEFIKGHMIKEGSIVIDVGISKVNNG-IVGDCHFESCSQKASYITTVPKGVGPLTIAMLMQNTLKATCIQN....... 280
89 0.000e+00UniRef50_A0A2G6BUQ1 Bifunctional protein FolD n=1 Tax=Candidatus Cloacimonetes bacterium TaxID=2030808 RepID=A0A2G6BUQ1_9BACT  ali  27  1MILKGKAVTRKIYDKIKADQQRQPKLAVLVIGYDPASDFYVKNLQKNGKKNGIKVEVINLSSEISQDDFIKEIERFNIDPGTDAVMLQKPFPEHFDDEYIAEKINPEKDVDAFHPVNMPGFIPCTAAAVLEILDYYEIETSGKNVVVLGRSNIVGKPLANLLLRKNATVTVCHSRTENLPSCIRKADILIAAIGQPEFVKGDWIKEGTVVIDVGINLKEDSRYTGDVLYDECEGKSGAITPVPGGVGSVTSAMLLMNVYKAFKNRAEKE.... 286
90 0.000e+00UniRef50_A0A212KQE6 Bifunctional protein FolD n=1 Tax=Chlamydiales bacterium SCGC AB-751-O23 TaxID=1871322 RepID=A0A212KQE6_9CHLA  ali  31  2ILIDGKASAAKVKIRIKTELKQKPGLAFILIGQHGPSITYVTMKQKACKELGFSSFLHHLDEKVSEKDLKILIESLNKNPDIHGVLLQQPLPPHLDSLKFLTAIDSEKDVDGFHPINMGKFIPCTPKGVLQLLKDYDISVAGKEVVVLGRSNIVGKPMAALLMQKNATVTVCHQRTKNLSEHLKRADILISATGQPNSVGAENLKKGVIAIDVGLSRVEDYRIAGDLKFDEVSKVASYVTPAPGGVGPMTIAMLLENTFISFLKKH....... 290
91 0.000e+00UniRef50_A0CFN1 Uncharacterized protein n=1 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0CFN1_PARTE  ali  31  1MIFNGNQLANSILQTLRVTSKIKPKLGICLVGDSPASKSYVNRKLKACQEINVDAEVFNFSENVEQEQLIKHIQQMNHD----GILVQLPLPPHLNKLDIIHSIPYEKDVDCLHMHNLQRMLPCTPAAVLQILDYYDVNVIGKRVTMIGRSFLVGMPLSLLLQKRNATVTVCHRETLNLDQHIMNADIVISAAGHPKLVR--NVKQGAIVIDVGISQGEKGKIVGDVDFDVVKNQASLITPVPGGVGPMTVCMLMRNLCNIWKKKQ....... 270
92 0.000e+00UniRef50_A0A1F5AMF1 Bifunctional protein FolD n=4 Tax=Bacteria TaxID=2 RepID=A0A1F5AMF1_9BACT  ali  28  3IWLEGKPLADKIKEDVKQQIGLVPGLVAVLVGDNKASQVYVRSKEKACQALGLFSEVQAYPGNISQAFLVGKIGALNRREDVDGILVQLPLPAQIDSYAIICSLSPDKDVDGLHPANKAGFRPCTPLGVVELLKEHKIPIEGMDVVVIGRSLLVGKPLAAMLTNENGTVTVCHSKTRDLDKVCSRADILVAAMGKEAFVKPEFVRPGATVIDVGINSVSDYTLVGDVHP-AAFERAGAMTHVPGGIGPLTIAMLMKNTLEAFKRRR....... 303
93 0.000e+00UniRef50_Q21JE9 Bifunctional protein FolD n=506 Tax=cellular organisms TaxID=131567 RepID=FOLD_SACD2  ali  32  4LILDGKALAKKTEDELKASSGHTPILATILVGDDPASATYVKMKGNACSRIGMESLKVEMPTSTTTEQLLAKINELNANPAVHGILLQHPVPEQIDERACFDAIALEKDVDGVTCLGFGRMGCATPKGIMRLLEAYNIELNGKHAVVVGRSPILGKPMAAMLLNANATVTICHSRTQNLEAHIKQADIVVGAVGKPEFIKAEWIKDGAVVVDAGYHPGG----VGDIELAPLADRAAAITPVPGGVGPMTINTLIYQTVDSAQKK........ 278
94 0.000e+00UniRef50_UPI0008D96186 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase n=1 Tax=Hyphomonas sp. Mor2 TaxID  ali  29  6..ISGAETSRQIRERLSKAVRKQPTLAVILVGDDPASAVYVKSKVRKTEEIGMRSVQRVLPANCAQTELEATISAQNEDPNIDGILLQLPLPAGLDSSSAIECIDPNKDVDGLTEVSAGRLRPCTPSGCVILAKQAGEDLSGLNVTVVGRSILVGKPAAQLFTAENCTVTLAHSRTRDLGQVCHTADILVAAIGKPEFVKSNWIKPGACVIDVGINRVPKTKLVGDVDFDPACAVAGSITPVPGGVGPMTIACLLQNTVIAACRRR....... 287
95 0.000e+00UniRef50_A0A1Y6FKA3 Bifunctional protein FolD n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y6FKA3_9MICO  ali  29  5.IIDGAAVARDVLESLRERTGRQPGLATVLVGEDPASEVYVRNKRRSAERLGIADHHRHLPADTTQARLLEVIDELASDDAVSGILAQLPLPGGLDATTVIDRIPWYKDVDGLTTTSRPGLRPCTPSGVITLLDSAGVEIAGREVVVVGRSELVGRPLAQLLLQRDATVTTVHSRTRNAREVTLRAEILVVAAGIPHLIGRDDTRAGATVIDVGIHRSAEG-LIGDVRFEELLGHASHMTPVPGGVGPMTIAALMRNTLQAA........... 278
96 0.000e+00UniRef50_A0A2A3T1Z8 Bifunctional protein FolD n=3 Tax=root TaxID=1 RepID=A0A2A3T1Z8_9EURY  ali  32  5.LIDGKKIAEEIENELKAKVSKPPKLSVIQVGDDPASTSYIKAKSNAAKRVGIELTHHHLSTDTTESDLCSLIGRLN--SSVDGIIVQLPLPKRL--ESALNEIEPENDVDGFHPANLGRMKPCTPAGIVELLYRSGNDPKGKNVVIVGRSTIVGKPLSLILSQKDATVTLCHSRTSNLQSFCKEADVLIVAVGSPDTVTGAMVKPGAIVVDVGVNPTDSG-LVGDVSSD-VKEIAGQLTPVPGGVGPMTVAMLMSNTVDSASKN........ 274
97 0.000e+00UniRef50_A0A0G0BYL8 Bifunctional protein FolD n=3 Tax=Candidatus Dojkabacteria TaxID=74243 RepID=A0A0G0BYL8_9BACT  ali  33  3.ILDGKLTALDINDSIKEDIYRVPRLDIILVGDDFGSKKYVEMKSKKAQELGIKGVVHTFDGDISQRELSDLIVELNKDEEVDGIMVQLPLPNHIDEKYVLENINPEKDVDGLTSTNLGKLFPATAKGIMKLLEDYMIQIEGTNAVVIGRSDIVGLPTAAMLQNENATVTVCHSHTKNLKEICKMADILVVGIGKPEYIDMEYVKEKSIVIDVGTNKNSDGKLVGDVNFNSVKDIVEYITPVPGGVGPMTIACLLDNLMEIYIKN........ 281
98 0.000e+00UniRef50_A0A2D9J832 Bifunctional protein FolD n=4 Tax=Rhizobiales TaxID=356 RepID=A0A2D9J832_9RHIZ  ali  29  11.IIDGKIISGLLVEKVSAKKDIXPTLAVVLIGDDPASQVYVRNKKIMCEKVGIQSVEYKFGEDIKETELLSLIDSLNRDKGINGILVQFPIPPHISKQKTINAISPDKDVDGXHPINAGKLMPCTPQGSMIMINSIAEDTSGMNAVVLGRSNLVGKPMSQLLINANCTVTQVHSKTKDIQSFTSQADILVAAIGIPNFVKSDWVKKDAIIIDVGINRVESDKLVGDVDFEDVFDKVSAITPVPGGVGLMTVACLMNNTLIATKAQH....... 295
99 0.000e+00UniRef50_A0A0X8GXW4 Bifunctional protein FolD n=4 Tax=Bacteria TaxID=2 RepID=A0A0X8GXW4_9FIRM  ali  29  4.ILYGNTVASTVKDNLKTKVKRVPHLAVILVGDDPASQTYVNSKAKQCEQVGFKSTVQHMKTDSTQQEVLDVLEHLNKDDGVDGILVQLPLPKHIHEQTIIEALDPSKDVDGLHPINQPRFVPCTPKGIMTLLKSYDIELEGKRALVIGRSRLVGKPVSTLLLGANATVTIAHSKTKNLKALIKEHDIIVVAIGKQEMFSAEDFDEHHIVIDVGIHRTESG-LRGDVC-NDVYDKVTAITPVPKGVGPMTIASLLENTYEAYSQK........ 279
100 0.000e+00UniRef50_A0A2X0P453 BQ5605_C003g02400 protein n=2 Tax=Microbotryum TaxID=34416 RepID=A0A2X0P453_9BASI  ali  28  90.VIDGTAVATSLRADISQRISFTPHLAIIQQGSRSDSSTYVKMKLKAAEQAGIKCTLVLVDQAASEDEVMAEVQRLNDDDSVHGLLVQLPLSEQVDERRITEAVSPEKDVDGFHAYNIPLFSPCTPSGVMHLLKEAGVEISGKHAVVLGRSDIVGSPVCALLRRQDATVTQCHSRTKNLEQIIKQADIVVAAIGQPQFVKGDWLKSGAVVIDVGTNFIPDSRLVGDVDYDSAVGVASHITPVPGGVGPMTVAKLMENTLIAAQRFLEKSQKRV 387
101 0.000e+00UniRef50_A0A1Q7HB97 Bifunctional protein FolD n=7 Tax=Bacteria TaxID=2 RepID=A0A1Q7HB97_9CHLR  ali  27  5.VLDGRAVAKQIYEEVTAAVSSRPRLATVLVGEDPASAKYVELKQRNAHSVGIESEDHRLPSNTTTDELLSLVEQINRDENVSAILIQQPTPKQIDMRQIVFALDPVKDVDGFHPLNPGGVEPCTPAGIIELLLRSGIAIEGANAVVVGRSNLVGKPTALLLLKRHATVTLCHTRTKDLASHTLTADILVAAAGRAHLVGKEMVKAGAVVVDVSTNWV-DGRQVGDL-GAGVETVAGWLTPNPGGVGPMTRAMLIRNTFEAEVRRQ....... 282
102 0.000e+00UniRef50_A3PDH3 Bifunctional protein FolD n=34 Tax=cellular organisms TaxID=131567 RepID=FOLD_PROM0  ali  34  5..LDGKKLSLEIEERLKEIAKRAPGLAVIRIGEDPASGVYVNNKEKACSRVGIKSFIFHLKDNIEQKEVEQLINKLNLDKNIDGMLLQLPIPKKFDEQKLISHINPSKDVDGLNEINIGKMRSCTPAGIINLLRSQNIKIEGKKIVVVGRSLLVGKPLSLMLLNLNGTVTMTHSKTLNLNKVCREADILIAAAGKPNLIDSSFVKEGAIIIDVGIHRLKSSRLCGDVLLEDVISKVFAYTPVPGGVGPMTVTMLLVNTIFSWQKQ........ 286
103 0.000e+00UniRef50_A0A101F8V0 Bifunctional protein FolD n=32 Tax=root TaxID=1 RepID=A0A101F8V0_9FIRM  ali  28  5.LLLGKPLAEKIREEVSKEVGVEPFLVAVQVGENEASRVYTNAQRKNAEKCGIKYELQELPADTTQEQLLKHIADLNADPKVTGIILQMPVPPHIDAKVCQWSIAYEKDVEGVTPTNMPRLAPCTAVGAYELIKSTGVDIYGKEVVVVGHSDIVGKPAALMLLNSFGTTTICHIATGHTEMHVRRAEILVVAVGVPHLIKGDWIKEGAIVVDIGINTTKDGKIVGDVEFDVAKERASWITPVPGGAGTATTAILMRNTVEAAKWQLEKKNK.. 290
104 0.000e+00UniRef50_O83714 Bifunctional protein FolD n=27 Tax=cellular organisms TaxID=131567 RepID=FOLD_TREPA  ali  27  5.LIDGKQAAHERVQALRAAVGTAPFLAAVLVGDDPASCTYVAAKQRALARAHLRGETHRLPAHASHAQVLELIARLNEDARVHGILIQLPLPAHLDAARVCRAVAPEKDVDGFHPLNQPGFVPCTPAGIVHLLRRAQVPLAGARVVIVGRSAIVGRPLAVLLPGCDATVTLCHSHTRGLADICVQADILVAALGKARFIGAPFVRTGAVVIDVGIHHVPDRRLCGDVDFDAVAHKVQAITPVPGGVGPMTIAMLLHNTLCAAE.......... 288
105 0.000e+00UniRef50_A0A1Z9RR16 Bifunctional protein FolD n=1 Tax=Gammaproteobacteria bacterium TMED257 TaxID=1986754 RepID=A0A1Z9RR16_9GAMM  ali  29  5.IISGREVAENILTNLKNKVNINPKLIVILVGDMKASASYVAQKEKFAVKAGIESDILRFESTVTEEQILQEINKINNDNSIHGVIVQLPLPDHISVAKVLNSIDPSKDVDGFTPTNVGKLFSCTPKGIMQMLDSTGTDLNGKNVTVVGRSNIVGKPAAILCLQQNATVTMCHSRTKDLDAKLSDADVIIVAVGIPKFIHGDQIPENCIVIDVGIHNIE-GKLCGDVDFESASKKATAITPVPGGVGPMTVCALIENTIIAAER......... 280
106 0.000e+00UniRef50_E5V180 Bifunctional protein FolD n=2 Tax=Gemella morbillorum TaxID=29391 RepID=E5V180_9BACL  ali  30  4.IISGTDLAKKLRAEIKEERGITPTLAVVLVGDNKASKSYVNSKHKACLENNINSVKIELDENISTASLLNEIEKLNNDDNVHGILVQLPLPKHIDAEQILNAVSPQKDVDGFHPINEAKLIPCTPLGILEMIKSTGDEIDGKLALVIGRSNIVGKPISTLLLQNNATVITAHSKTKNLDSLLEQADIIVSCVGSAHFLTGEEVKETVTIIDVG-NNYKDGKLVGDVNLENFIGKVKYISPVPGGVGPLTITMLMRNTLVA............ 276
107 0.000e+00UniRef50_A0A2P1P8K2 Bifunctional protein FolD n=1 Tax=Candidatus Phycorickettsia trachydisci TaxID=2115978 RepID=A0A2P1P8K2_9RICK  ali  33  2IIIDGKKIAQEILDDLKSKVHIKPKLAIILIGDNPASQIYVGIKIKQAANIGIDAELIRLPAEVDQEVLFTIISELNIDPKVHGIIVQLPVPLHLNVQEIFNTIHPAKDVDGLNPINIGKFIPCTALGILRLIREVSPNIGGLHIAIVNRSNLIGKPLAGLLMQRDATVTICHSYSKNLSDITSAADIVVCAIGKKDFFDRKYFKKGAIVIDVGINKGLDGDVTGDVNFDDVKSQDGFITPVPGGVGPLTVAYLLSNTYWAASNQ........ 289
108 0.000e+00UniRef50_M1PV81 Bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/ 5,10-methylene-tetrahydrofolate cyclohydrolase n=1 Tax=uncultured organis  ali  30  7.IIDGRTIADEGEAELKKKIEEPPRLDTIFAGDDEGSKVYLGVKNRGCERVGIETETHRYPSDVSQGELLDKIEELNEDDRVDGVLIQMPLPGEMDSRPLIERIDPVKDVEGLHRSNMGRLMPCTPKGILTMLEYEGIDLKGKEVCIVSHSTIVGKPMVVTLLNRDATVEVVHEFTKDLESHTKKAEILITAAGKAHFITEDMISEGVVLIDVGMNRLENGDLVGDAVYEKCKEKASKITPVPGGVGPTTVLSLLQNTYRAAVRRR....... 281
109 0.000e+00UniRef50_Q6ALZ5 Bifunctional protein FolD n=276 Tax=root TaxID=1 RepID=FOLD_DESPS  ali  27  5.IISGTEIRKEILGEIKDKYGTVPGLVTILVGESPASMSYVSLKIKTALSLGFYEVQESLSVETTEAELLALIEKYNNDDSIHGVLVQLPLPKHINEQNIITAIDPDKDVDAFHPVNIGRLMPCTPAGIQEMLVRSGVETAGAEVVVVGRSNIVGKPIAMMMAQKNATVTIVHTGSRDLATHCRRADILIVAAGVPNLVKPEWIKPGATVIDVGVNRVETGKLRGDVDFEAVKEIAGKITPVPGGVGPMTIAMLMKNTLASA........... 291
110 0.000e+00UniRef50_A0A1Q3RRL0 Bifunctional protein FolD n=1 Tax=Clostridiales bacterium 38-18 TaxID=1895746 RepID=A0A1Q3RRL0_9FIRM  ali  26  1MIIDGNAIAKKIKDKARNDCYRKPNVVAIMLGENPSSEAYLRMIERTCNSVEFGYRLDRFDTTLSEQDLLEHIRALNEDEEIDGILVQMPLPKQISEEKVIMAIAPEKDLDGFHPINAGRTRPCTPLAVITMFKELDIDLEGKYIVVIGRSNIVGKPLAVMLMENNATVTICHSRTVDLEEHTRKADIIIVAVGIANFLKKEMVSEKAIVIDVGMNEV-DGKLVGDVDFDSMKDYVQMITPVPGGVGPVTNAVLLLNVIEHFK.......... 272
111 0.000e+00UniRef50_A0A0L7NBL5 Bifunctional protein FolD n=10 Tax=Bacteria TaxID=2 RepID=A0A0L7NBL5_CLOBO  ali  32  5..IDGKKLAEGIKEELKKENQIPICMANILVGNDGGSKYYVNNQNKLCNKLGVKVKSIYLDDTVKENELLHIINGLNEDKEVHGIILQLPLPKHLDEAKITSAIDVRKDIDGLSSISEKCFVPCTPRGIIEIIKSCNVKIEGSNAVVIGRSNIVGRPVAQLLLKENATVTICHSKTKNLKEICSKADILVAAVGKPKFITKEYIKEGAVVIDVGTSSV-DGKLVGDVCFDEVIEKSGFVTPVPGGVGAMTTTMLIKNLCE............. 275
112 0.000e+00UniRef50_R7K8Y7 Bifunctional protein FolD n=1 Tax=Subdoligranulum sp. CAG:314 TaxID=1262970 RepID=R7K8Y7_9FIRM  ali  28  4.ILDGKALSQRLMGEYKARINDSICLAMVIAGGDPSSLQYVKANEKKCVSIGINVKIIQLDYDVTQEALEKTISELNDDASVNGVLIQMPLPKHIDKQRVVNLLSPDKDLDCQGYNNTEGFCPCTPSGAIELLKGYGISLSGKNVCVLGRSSVVGKPLALMLLNENATVTVCHSKTRSLKEECLKSDIIISCTGRAGLVTADMVPDGAVVLDIGTNFV-DGKLCGDVDFQAVEKVAGAISPVPGGCGPMTVTMLIKNLLAAYDRQHK...... 280
113 0.000e+00UniRef50_A8LWI0 Bifunctional protein FolD 1 n=456 Tax=Bacteria TaxID=2 RepID=FOLD1_SALAI  ali  28  5.LMDGRTLSRQLLESTAERVGRRPCLATVLVGEDPASHTYVRIKVNRCTEVGIDSRRFDLPTLTTTEQLVRVLRDLSSDSAVDGILLQHPTPPQIDEHAAFEAIDPSKDVDGVTGTSFAAMASCTPAAIMRLLDAYDVPLSGQRAVVVGRSAILGKPIGMLLLARDATVTYCHSRTTDLAAHVAEADLVVAAVGVPHLVRGEWIKPGAVVVDAGYNAGN----VGDVQAATAANRASLITPVPGGVGPMTIAVLLAQTVDAAERH........ 278
114 0.000e+00UniRef50_A0A068DH76 Bifunctional protein FolD n=18 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A068DH76_9RHIZ  ali  27  4.LIDGKNVADDVVADLAAKGHGKPGLAVVLVGSDPASQVYVASKSRVAKECGFHSVECTLPADTTEAEVLRIIRGLNADPAIHGILVQLPLPSHIDEGSVIQTVAPEKDVDGFHFVNVGKFVPCTPAGSMLLIERHGRDLSGLNAVVIGRSNIVGKPMANLLLAANCTVTVAHSRTRNLPALARTADILIAAVGRPELVKGDWIKPGATVIDVGINRIPDGKLVGDVAFAEAAEAAGAITPVPGGVGPMTIAMLMGNTIASAYR......... 290
115 0.000e+00UniRef50_UPI000B908DDD C-1-tetrahydrofolate synthase, cytoplasmic-like n=2 Tax=Pomacentridae TaxID=30863 RepID=UPI000B908DDD  ali  25  26.VVSGNKTSKLVRDRLKIEVGFRPSLVVLQVGDRDDSNLYISTKLKAAAEIGINAKHVRLPKTATQDEVLQSIMSVNENASVHGLIVQLPLDSRIDNELITNGVSPEKDVDGLSCINNDCFIPCTPNGCMELIRQTGVSVAGKHAVVIGRSKIVGAPMHDLLLWNHATVTTCHSKTPDLPEQVGRAEILVVGAGRAEMVRGEWVKEGAVVIDCGINYIADKRVVGDVHYASAKERAGFITPVPGGVGPMTVAMLMENTVQSAQR......... 313
116 0.000e+00UniRef50_T1EDP4 Uncharacterized protein n=3 Tax=Protostomia TaxID=33317 RepID=T1EDP4_HELRO  ali  29  4.VLSGKEVACELYAKLKDDINFCPGLAIVQVGNREDSNVYIRMKVKSAEELGMRATHVKLARETTEFELKNVIHSLNADAKTHGIIVQLPLDTNIDSDKILNEIAADKDVDGLTDANTNCIIPCTPNGCMQLIKKSGIEVKGKRAVVLGRSKIVGSPMAQLLTWNHATVTVCHSRTVDLPSVVREAEILVVAIGQPEFVKGDWIKPGAVVIDCGINSIPDPKLVGDVLYEEAKQVASHITPVPGGVGPMTVAMLLANTVESAKKDIKQQTSS. 299
117 0.000e+00UniRef50_A0A2E6YIZ0 Bifunctional protein FolD n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E6YIZ0_9CHLR  ali  29  5.LVDGKAVAEDIRDNLKKQIGISPKFAVIVVGQNPASKIYVKNKRLAALECGMMADVIELPARSNYEEIKKCIHTLNRDKNTHGILVQLPLPNDINKDLLVQEIDPIKDVDGLHPISLGKFVPATPGAIQQILRYIDYDVSGKHVVVCGRSDIVGKPVAALLVQKNATVTLCHSQTKNLEQITSQADVLIVAIGRPEFITENMVSGGTVVIDVGINRVKGYKLVGDVQFESVSKIVSAITPVPGGVGPVTVSMLLLNTYKAAMLQ........ 292
118 0.000e+00UniRef50_A0A1G5S4J6 Bifunctional protein FolD n=1 Tax=Acidaminobacter hydrogenoformans DSM 2784 TaxID=1120920 RepID=A0A1G5S4J6_9FIRM  ali  29  3.LLEGKKTAEAVKKEILAKVSIEPKLDVIIIGEDDAAMAYVGMIARSSQKYGVASEVVALPATITEAELLEKIREINGDKSVHGLIVQMPLPKGIDEKRVIETIDPLKDVDGFHPMNEDGFVPCTPYGIYKMTEIEELDFTGKNVVVLGRSNIVGKPAAMLMLRKNATVTICHSKTKDLAEVTSKADVLIAAIGKKKFVKANMVGDGAIVIDVGIHS-EDGKIVGDVDFEDVKDKVSMITPVPGGVGTTTIAMLMHNAVKAAHKQN....... 279
119 0.000e+00UniRef50_A9WJ10 Bifunctional protein FolD n=4 Tax=Chloroflexi TaxID=200795 RepID=FOLD_CHLAA  ali  24  5.ILDGKALAQELRAELRTQIDRPPTIAVVQVGDDPAATRYVRSIDRLCQSLGAACRAIALPAETAQADLEATVATLSADDRIDGILLQLPLPAGLTLDGVLSRLAPEKDLDGIHPINRPTLTPNTPAGGIELMRRYGIDIRGRRAAVVGRSAIVGRPMALLLLQADATVTICHSRTPDLGAVLRECDIIAAAAGRPGLITADMVKPGATVIDFGTNVLADGSMVGDVDFAAVAEVAGAITPVPGGTGPVTNIMLMRNLITATRTR........ 282
120 0.000e+00UniRef50_A0A0P5QCR5 C-1-tetrahydrofolate synthase, cytoplasmic n=3 Tax=Opisthokonta TaxID=33154 RepID=A0A0P5QCR5_9CRUS  ali  31  7.LLSGTEIAKNLRAGLNEQVGFTPGLNIIQVGAREDSNVYIRMKMKAAEEIGIKASHVVLPSSTTQAELIRVLNKINLDPSVHGIIVQMPLDSKIDSTLITDSVLPSKDVDGLNTINQGKFLPCTPNGCMELIKRTGIKIEGSQAVVIGRSKIVGTPAAELLKWHHATVTVCHSKTKNLPQLVANADILVVGIGQPNMVKGEWIKQGAVVIDCGINSISDYRLVGDVDFEGAKTKASWITPVPGGVGPMTVAMLMKNTVLAAEK......... 294
121 0.000e+00UniRef50_A0A1Q9NLE2 Bifunctional protein FolD n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_3 TaxID=1841598 RepID=A0A1Q9NLE2_9ARCH  ali  31  5.ILDGKATSLEVKERLKKRVEKLPKLSIVYVGNDPASAVYTRNKVKTSKEIGIDATLHRF-EKISEEALIDFIEALETD---DGIIVQLPLPNGMDEEKILDTIKPEQDVDGLHWKNIGKFWPCTPLGIIEILDRYKIEIEGKHAVVIGRSNLVGKPIASLLEKRNATVTQCHSRSKPISRYTLDADIIITAIGITKFLKADMIKEGVIIVDVGINRDENGKLCGDVDFKNVKDKCSYITPVPGGVGPMTVVELMFNTVLSAEKKLN...... 278
122 0.000e+00UniRef50_A0A2G6GCH6 Bifunctional protein FolD n=1 Tax=Candidatus Gracilibacteria bacterium TaxID=2044595 RepID=A0A2G6GCH6_9BACT  ali  29  162.LLSGRTASDYFLETLKKDIAKKPKLAVVLVGNNSSSQSYIRMKQKKAEFVGIESFVKRLPESIDQESLIQEVEKLSNNPDIHGIIVQLPLPDRINPKKILGAIDPQKDVDGFTKVQIANFFSCTPKGIMNLLDFYTIPVSGKNITIIGRSNIVGKPLSLLMMNAGATVSVCHSQTKDIPKYTKTADIIVVAVGKPLFLKKEMVHKDAIVIDVGSTFV-DGKFCGDADFENLKDFVFALTPAPGGVGPMTVSVLLQNTWKSYRKLQNII.... 440
123 0.000e+00UniRef50_A0A2D8IQ33 Bifunctional protein FolD n=25 Tax=Bacteria TaxID=2 RepID=A0A2D8IQ33_9GAMM  ali  30  4LVLDGKAVAQQTEAELRERVGKTPILATILVGDDPASATYVRMKGNACKRVGMESLAVELPSSTTTEQLLAKIDELNNNPDVHGILLQHPVPEQIDERACFDAIALEKDVDGVTCLGFGRMGCATPQGIMRLLEHYQIEIEGKHAVVVGRSPILGKPMAMMLLQKNATVTICHSRTRDLPGLVAQADILVGAVGRPEFIKAEWVKPGAVVVDAGYHPGG----VGDIELAPLVNKASAYTPVPGGVGPMTINTLIMQSVESGEKS........ 279
124 0.000e+00UniRef50_A0A0U9HEE3 Bifunctional protein FolD n=10 Tax=Clostridia TaxID=186801 RepID=A0A0U9HEE3_9THEO  ali  25  4.ILDGKEVAAALKDELVAEVGITPGLCLVMAGSRPDSQSYINSAVKRCSSIGIDCRVKKLPEDVTQGDFLKIIDDLNTDPKINGIMVMRPLPQYISENTIKYKISPEKDVDCLNPINVSKFAPCTPAAVIEILDYYGIKVEGKRTVVIGRSMVVGRPLAMMLLARNATVTICHTRTRNLAEETKKGEILIAAAGKAKMVTKDMVSNGAVVIDVGINFDESGKMCGDVDFDSVCPIASSITPVPGGVGAVTSTVLAKHVIEALKLQK....... 282
125 0.000e+00UniRef50_A0A1F4VSL7 Bifunctional protein FolD n=1 Tax=candidate division WWE3 bacterium RIFCSPLOWO2_01_FULL_53_14 TaxID=1802628 RepID=A0A1F4VSL7_9BAC  ali  31  1MLIDGKKIAAEIEARLAREIRRKPRLAVILVGDDPASAVYVRKKQEAAARVGVDFSLYVLPSSTNPSGLMKQVRKLANDPYVHGIVVQLPLPKQFNIDEILALIPPEKDVDALNNANPSGLIGATAGAVLEVLNRQKVKIAGSLTVVVGRGKVAGLPVAMALLANDATVTIAHSKTKNLVELTKQADILVSAVGKPAMITPAMVKKGAAVIDVGISRVE-GKLRGDVDP-AVEKKARFLTPVPGGIGPLTVVKLLENVFLAHKLQN....... 267
126 0.000e+00UniRef50_J8V9A0 Bifunctional protein FolD n=49 Tax=Fusobacterium TaxID=848 RepID=J8V9A0_9FUSO  ali  30  1MLMDGKELAKDIKAKIKAEINVSPTVASILVGEDPASQVYLNSQIKSYQDLGIGVQKYFFSKEISEAYLLNLIDKLNKDTEVDGIMINLPLPPQISATKVLNRIKLIKDVDGFKAENEDFISPSTPAGIMALIEGYKIDLQGKDVVVVGRSNIVGKPVAALVLNSHGTVTICNSHTKNLASKTKDADILISAVGKPKFITEDMVKEGVVVIDVGINRV-NGKLEGDVDFENVQKKASYITPVPGGVGALTVAMLLSNILKSFKANR....... 280
127 0.000e+00UniRef50_Q8FRU9 Bifunctional protein FolD n=1912 Tax=root TaxID=1 RepID=FOLD_COREF  ali  35  4IKLDGNLYRDEIFADLAQRVGIVPGLATVLVGDDPASHSYVKMKHRDCEQIGVNSIRRDLPADISQEELFAVIDELNADDSCTGYIVQLPLPKHLDENAVLERIDPAKDADGLHPVNLGKPLPCTPNGSISLLRRFGIELNGAKVVVIGRGVTVGRPIGLMLTRRNSTVTLCHTGTKDLAAETRAADVIVAAAGQPHMLTADMVKPGAAVLDVGVSR-KDGKLLGDVHPD-VWEVAGAVSPNPGGVGPLTRAFLVHNVVERAEK......... 280
128 0.000e+00UniRef50_UPI000938ACCC bifunctional 5,10-methylenetetrahydrofolate dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase n=1 Tax=Fusobacterium m  ali  27  1MLMDGRETAKELKKKIKMEIGVTPTVASILVGNDPASEVYANSQIKSYQDLGIETQKYFFSGEISEAYLLNLIDKLNKDTEVDGIMINLPLPSQISATKVLNKIKLVKDVDGFKAENEDFISPSTPAGIMELIKAYEIDLEGKDVVVVGRSNIVGKPVAALVLNSHGTVTICNSHTKNLSEKTKMADVLISAVGRPKFITEDMVKDGAVVIDVGINRV-NGKLEGDVDFENVKNKTSYITPVPGGVGAMTVAMLLSNILKAFKANR....... 280
129 0.000e+00UniRef50_A0A2H9QTX2 Bifunctional protein FolD n=2 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A2H9QTX2_9EURY  ali  30  1MIIDGKKIASKIQEELKARYHQSPCLATVVAGTDEPSKLYVKKRGKICDEIGIISKMHSLPDDSKEKDVLELIGKLNNDKNVHGIIVQLPLPKHIDKRKISEAVSPEKDVDCLNPLNIGRATPCTPKAVILILEKLGIKIKGKNVVIVGRSKIVGRPLALMLINRDATVTICHTKTKNLKEHTRKADILIAAAGSPLLIKNEMVKENAVVVDV-GINVVGSKIVGDVDFENIKNKASFITPVPGGVGPVTVAMLMKSTVEAFKQQ........ 278
130 0.000e+00UniRef50_A0A2E7GE69 Bifunctional protein FolD n=1 Tax=Bdellovibrionaceae bacterium TaxID=2026715 RepID=A0A2E7GE69_9PROT  ali  29  16..........RIREELKNNHGITPGLSVILIGNDPASQIYTSSKGRAAEELGMKHETLTFDKSVSVEEVHQTVKKLNEDPSVHGILIQRPVPPQFKESDLIEWITPEKDVDGFHPMNIGKLHPCTPTGIIRLVKHYGFPLSGKHVVIIGRSSIVGKPASALFLRENSTVTTVHSKSQRIKEICKSADILVVAAGKPHLVNSEWIKPGAIVIDVGIHR-QNNKVIGDVDFEDIKEKASAITPVPKGIGPMTIMELLNNTLISAKLSQKVLEEK. 286
131 0.000e+00UniRef50_A0A2E3C0T2 Bifunctional protein FolD n=1 Tax=Magnetococcales bacterium TaxID=2026759 RepID=A0A2E3C0T2_9PROT  ali  33  25........AVDVVAKLKKK-GVTPTLHVVLVGDDPASEIYVDAKMRAANKVGINAELKQLPSTITQVELDTALEALSKDEGVHGILLQLPLPKGLKKRQALNKIAPHKDVDGLTTHNMGGIRPCTPLGIMRLLKSYNIDFMGKQAVVVGRSQLVGRPVAELLAQAGATVTTCQRHTPDISEYTKQADILVVATGVPSLITSDMIKPGAAVVDVGITRLETGEVVGDCDL-NCRDVAGLLSPVPGGVGPMTVATLMTNTIDAALKQN....... 288
132 0.000e+00UniRef50_A0A1F7BVS9 Bifunctional protein FolD n=5 Tax=cellular organisms TaxID=131567 RepID=A0A1F7BVS9_9BACT  ali  34  4LILLGKPVAEKMLQDLKKDVKLDPKLVVVQVGDDPSSDSYIRQKLKSCEAVDMRNEHRHLDKKTTLKQLLSVIDELNKDPDVTGFIVQVPLPGDLNDHEITRAINPKKDVDGFGAYNLGKMFPATPAGIFEMLKYYEIDVAGKHSVVVGRSNIVGKPLAVMLINRGATVTVCHSRTDDLAFYTTQADLLFTAVGKPKLITKEMVKPGAVVVDIGVSRTDKG-LKGDVDFENVKEVASAITPVPGGVGPLTVASLIRNCVTAKKRQ........ 279
133 0.000e+00UniRef50_UPI000A1C612D C-1-tetrahydrofolate synthase, cytoplasmic-like n=2 Tax=Percomorphaceae TaxID=1489872 RepID=UPI000A1C612D  ali  25  27.VVSGNKTARQVKQRLQVQVGFRPGLVVLQVGDRDDSNLYISSKLKAAAEIGINAKHIRLPSSSSQDEVLRTVLGLNEDPEVHGLIVQLPLDSDMDQDLITNAVSPLKDVDGLSCVNRDCFLPCTPQGCMELIAQTGVSVAGKQAVVIGRSKIVGAPMHDLLLWNHATVTVCHSRTRDLPDQVGRAEVLVVGMGRAEMVRGEWIREGAVVIDCGINHVPDKRVVGDVHYASASQRAGFLTPVPGGVGPMTVAMLMQNTVISAQRFLQSQ.... 319
134 0.000e+00UniRef50_A0A2W7C274 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase n=1 Tax=Mesorhizobium kowhaii TaxID=  ali  25  5.IIDGNAIAAEVRREVATGVGEQPGLAVVLVGNDPASHVYVANKVRQTDTVGMRSFRYDLPADVSERDLLSLIGRLNADDAIHGILVQFPLPQHIDSRRVVATINPEKDVDGFNPLNVGRVTPCTPLGVMRLIRSVHDDIAGLGALVIGASNVVGRPMAQLLLEAQCTVSIAHIRTTDLAARCRQADILVVATGVPDLIRGADVKPGATVIDVGITRVGKSRLVGDVIFDEAVKVAGAITPVPGGVGPMTIACLMANTL.............. 281
135 0.000e+00UniRef50_A9TNY3 Predicted protein (Fragment) n=11 Tax=Embryophyta TaxID=3193 RepID=A9TNY3_PHYPA  ali  30  1..IDGRAVAQDIKDQLRDQVGAVPGLAVVQVGHHKASDLYSRSKQLACDEVGIASFAAYLPATTPEDEVLELVNVLNADDRVHGILVQLPMPPHIQLDRVLRAVSLDKDVDGLHPINHPTFIPCTPLGCLEILRRSRVQIENKHAVVIGCSNVVGLPTALLLQRQNATVTVIHEHTPNPAEATKRADIVVSATGVAQLVRGHWLKKGAVVLDVGTSAVQDYRLIGDVCFEEAEFVASAITPVPGGVGPVTVAMVLSNTLQSALR......... 284
136 0.000e+00UniRef50_A0A1S4E9W5 C-1-tetrahydrofolate synthase, cytoplasmic n=1 Tax=Diaphorina citri TaxID=121845 RepID=A0A1S4E9W5_DIACI  ali  30  46.ILSGTAVSGDIREGLKERVKKEPGLAIVQVGGREDSNVYIRMKMKAAKEIGIDAQHVKLPRSITEIELLSRLKKLNEDPSVHGIIVQMPLDSDINAMLVTDSVSPEKDVDGLNTINMNGFIPCTPNGVLELIKRTNVTIAGTNAVVLGRSKIVGTPAAELLKWKHATVTVCHSKTKNIQDVVKSADILVVGIGQPEYVKGDWIKPGAVVIDCGINSVPDQKLVGDVQYAEAKNVASWITPVPGGVGPMTVAMLMNNTVLSAER......... 332
137 0.000e+00UniRef50_A0A1Z8P897 Bifunctional protein FolD n=3 Tax=Synechococcus TaxID=1129 RepID=A0A1Z8P897_9SYNE  ali  28  5..LDGKALSTQLEQRLGNRVERPPGLALLRVGDDPASGVYVANKEKACARVGVLSTGIHLSAGCSSDDVLLELQRFNTDPLVDGILLQLPLPNGLDEGPLLTAIDPDKDADGLHTLNLGRPRSCTPAGVMALLRSNGFDPAGKRAVVVGRSILVGQPMALMLQSAHATVSVAHSRTRDLAALTRQAEILVVAAGRPGMIGAEHVSPGAVVVDVGIHRKPEGGLCGDVRADEVSEIAAALSPVPGGVGPMTVTMLLVNTVLAWCRRH....... 282
138 0.000e+00UniRef50_A0A133NEZ7 Bifunctional protein FolD n=13 Tax=Fusobacterium TaxID=848 RepID=A0A133NEZ7_9FUSO  ali  30  3.LLDGKKVAAEIKEELKRKIGKIPGLGIIQIGHNEAASVYVQSQIKGSKALGIQAFLYAFEDDVKEEVVLQKIEELNQTEKIDGIILQLPLPEQISRSHILQAIDVNKDVDGFKTENMGRFNPCTPEGVITLLKKYDIEIAGKNVTIIGRSNIVGKPMLGLFVNHDATVTICNSLTKNLKEHTLKADIIVVAVGKEKFLTADMVQEGAIVVDVGINRTVTGKIVGDVEFEEVSKKTSYITPVPGGVGSMTVAMLFQNIWKAFIKNRRI..... 283
139 0.000e+00UniRef50_A0A0R2DUI2 Bifunctional protein FolD n=10 Tax=cellular organisms TaxID=131567 RepID=A0A0R2DUI2_9LACO  ali  28  29....................GVTPSLRVVLVGNSGPSEIYVRNKARRAKELGLDFNLIRFDETVSEKELIEFIDSLNHDKTVDAILVQLPLPQHINEEKVVQTVSPNKDVDGFSPINFGYLWPSTAGGIMTLLEESDITTTAKHVVIVGRSNIVGRPLGALMLNSDATVTMAHSKTKDLKSITKQADILISAVGKAHFITADMVKKGATVIDVGMNRDENDRLVGDVDFDDVSSVAGAMTPVPGGVGPMTILTLMEQTIEIAKKR........ 280
140 0.000e+00UniRef50_A0A2E1HYB8 Bifunctional protein FolD n=6 Tax=unclassified Euryarchaeota TaxID=33867 RepID=A0A2E1HYB8_9EURY  ali  28  6..LDGKACAADLEERLKQRIGVXPHLAVVIVGDDPASHVYVRNKIRSCERLGXKSTHIEXPDDASEXDVRXAIISLNNDSSLHGILIQSPLPKHMDEESLTDLXDPSKDVDGXHPANLGRMIPCTPAGVMEMLRWADVEMSGKKAVVIGRSFXVGMPQALLLAAKDATVTIVHSRTKDAKAECLSADIIIAAVGRPEMVMPDWVKPGAVVVDVGXNRVDDDXLAGDVHPD-VANTASLLSPVPGGVGPMTVAMLMANTVTSAESQH....... 287
141 0.000e+00UniRef50_A0A0A9WVB6 C-1-tetrahydrofolate synthase, cytoplasmic n=30 Tax=Opisthokonta TaxID=33154 RepID=A0A0A9WVB6_LYGHE  ali  31  9.ILSGTEVSKEISQHLSERVKFTPGLAIIQVGNREDSNVYIRMKIKNAAAVGVNATLMKLPNTITQVELLNKIRALNDDPSVHGILVQMPLDSKIDSHLITDAVSPEKDVDGLNTINEGRFVPCTPNGCMELIKRSGVTIAGSNAVVLGRSKIVGTPAGELLKWHNATVTICHSRTKNIEEHVSKADILVVGIGQPKFVKGSWVKKGAVVIDCGINSIPDQRLVGDVDYDEARTKASYITPVPGGVGPMTVAMLMTNTVISAERS........ 296
142 0.000e+00UniRef50_A0A2E8HXL8 Bifunctional protein FolD n=1 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2E8HXL8_9PROT  ali  32  5.LIDGREISNDIKDSLKARARRKPLLVVVLVGDDPASHSYIKIKQKACEYVGIETQMKHFSADCKQVELEDCITELNKDETVDGILMQLPLPADLDADYLLNMIDPSKDVDGLSPINQGLLCPCTPLGIMAMIKAINIPVQGKVAVIIGKSQLVGRPIARMLEDSGATVIVLHSRSENLEKFTILADILISAAGRAHMVLGHWIKPGAAVIDVGNSWVGD-QVRGDVEPEGARLKAGFLTPVPGGVGPMTVAFLLVNTVKSWQKS........ 281
143 0.000e+00UniRef50_A0A2G2MQ78 Bifunctional protein FolD n=1 Tax=Alkaliphilus sp. TaxID=1872455 RepID=A0A2G2MQ78_9CLOT  ali  29  5.LIDGRAVAAAIYKTIKQEHNIIPTLAVVVAGDDLASHRYVNMIEGKCREIGVSSQIHRLPSSCSQEELIELITSMNQDDQIHGVLLQLPLPALIDEKEVNSQVKAEKDVDGFHATNDNTIYPCTPKGIMRLIKSTGIEIKGKNAVVIGRSNIVGKPAAIMLLNENATVTICHSRTKNLKEHVIKADILVVAVGKTDLITSDMIKEGAVVIDAGTNIVS-GKITGDVEFDKAREIASFITPVPGGVGPMTIAMLIENTVEIAKKKCK...... 283
144 0.000e+00UniRef50_A0A1M3H6N8 Bifunctional protein FolD n=1 Tax=Alphaproteobacteria bacterium 41-28 TaxID=1895706 RepID=A0A1M3H6N8_9PROT  ali  25  5.IIDGRKVAEELKQDLEKKTGIKPGFAALRVGDNPASQLYVQLKGSQASELGYHFEEHVFPAWTPAEVLEAKIVELNQSSHIHGIILQLPLPEQLDKFHFLSLIDPAKDVDGLHPLNAGKFIASTPLGCLALIRTIHSYLEGLTVGVVGCSLLVGRPMALLMLQQDCTVWLAHSKTLNLPLLCETADILIVAIGSPRFIKGDWIQRGATVIDVGINRLPSGEIVGDVDFSSAQTRAGAITPVPGGVGPMTIASLLRNTLEAAFR......... 282
145 0.000e+00UniRef50_A0A2Y9NA26 C-1-tetrahydrofolate synthase, cytoplasmic isoform X1 n=3 Tax=Odontoceti TaxID=9722 RepID=A0A2Y9NA26_DELLE  ali  30  6.ILNGKVISAQIRERLKNQVGFTPGLAILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTATESEVLKCITSLNEDLNVHGFIVQLPLDSEINTEALVNAIAPEKDVDGLTSISNDCFIPCTPKGCLELIKETGVQIAGRHAVVVGRSKIVGAPMHDLLLWSHATVTTCHSKTAHLGEEVSKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDRKIVGDVAYKEAKERASFITPVPGGVGPMTVVMLMQSTVESAKRFLEKFKPG. 301
146 0.000e+00UniRef50_A0A068NVL4 Bifunctional protein FolD n=6 Tax=Bacteria TaxID=2 RepID=A0A068NVL4_9BACT  ali  31  5.ILDGLALSKETRARLKERVGVTPRLDVLVAAQDPASVKYVQMKRKWCAQVGIVGESYEITETTSQADLIGKIRELNADPHVHGILLQHPLPGHLDENMALMELGAEKDVDGITPQSLGRFRCATPLGIIRLLEHYGIETVGKRAVVIGRSIILGKPAALMLLQKNATVTIAHSRTQNLADICREADIVVAAVGRPEMVAGDWIKPGAVVVDAGYNRVEGRKGVGDVAFESASQVAGWITPVPGGVGPMTVASLLSNCVEAAE.......... 280
147 0.000e+00UniRef50_R5FUS5 Bifunctional protein FolD n=3 Tax=Terrabacteria group TaxID=1783272 RepID=R5FUS5_9FIRM  ali  31  1MILDGLRTAEVIRKKIAEEVARQITLAILHIGNDQSSMIYLESKEKACAEVGINTKILKLPENISQREILNIISDLNKDKTVNAIMVQTPLPKHIDTETILNSVDPMKDVDGLSIYNQGKVVPATAQGVITLLKNNNIDISGKNVVIVGRSIVVGKPLAMLFLKENATVTIAHSHTTNLKDITKRADILAVAIGKPRFITADMVKKDAVVVDIGTNRVM-GKICGDVDFENVQTVASYISPVPKGVGPMTTAMLLSNVIKCYQNQK....... 275
148 0.000e+00UniRef50_A0A163JD42 Uncharacterized protein n=1 Tax=Absidia glauca TaxID=4829 RepID=A0A163JD42_ABSGL  ali  32  522.IIDGKAVAQNVRNKVKQDIHFNPHLAIIQVGGREDSSIYVRMKDKAAKEAGIEITTEKLPESISQVELLSKVKQLNDAWNVHGILVQMPLPSHIDETAVIEAIDYKKDVDGFHAVNIGNFLPCTPKGIITLLKSTGVDINGKNAVVVGRSDIVGSPVASMLTSENATVTLAHSKTQNIEELVKKADILVVAIGQTEFIKGDWIKPGAIVIDVGLTDDLGGRWVGDVEYAEASKVASAITPVPGGVGPMTVAMLMENTFQSAKR......... 812
149 0.000e+00UniRef50_A0A2E1WAI3 Bifunctional protein FolD n=12 Tax=Bacteria TaxID=2 RepID=A0A2E1WAI3_9CHLR  ali  30  10.IIDGKLLSSEIRSEIKNIYDITPKLAVILVGNDPASQVYVRNKQRSAISVGMDAIDYKFSSDDNSESVIKLIYQLNNDPLTHGILVQLPLPSNFDKDKIINSIDPLKDVDGLHPFNQPRFVPATPYGISEMLIRNNLEVEGSNIVIIGRSNIVGIPLGNLLKNFNSTITICHSNTKNISEYTKNADIVMAALGRANFLTADMVRENTIIIDVGINRVEDNRLVGDVDYDSMIGHVKAITPVPGGVGPMTIAMLLKNTYKAALIQNK...... 299
150 0.000e+00UniRef50_A0A1S3ZUV9 bifunctional protein FolD 1, mitochondrial-like isoform X1 n=1 Tax=Nicotiana tabacum TaxID=4097 RepID=A0A1S3ZUV9_TOBAC  ali  25  69.IIDGISEAEQIRASIKESTGKVPGLAVVLVGQRQDSLAYVRKKIMACHEVGFRFSLAELPESCTEEEICDALSNYNKDASIHGILVQLPLPQHFDEGKILNVLSLEKDVDGFHPLNIGNFIPCTPKGCIELLLRSDVEIAGKRAVVIGRSNIVGLPAFLLLQRHHATVSIVHAYSENPEMITREADILVAAAGVPNLVRGSWLKPGAVVLDVGINPIEDYRLIGDVCFDEAVKIASAITPVPGGVGPMTVAMLLQNTLEAAKR......... 384
151 0.000e+00UniRef50_UPI000C6CC9AC C-1-tetrahydrofolate synthase, cytoplasmic-like n=2 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6CC9AC  ali  30  7IILNGKEISKEIKNGILEEVNFNPTLAIIQVGNRTDSSVFIRTKSKSANEVGIRAIHIHLPRNITEQELIKKIQELNKDHEIHGIIVQLPLDSSIDTNVIINTVSPEKDVDGIHDQNAGKFIACTPQGCLELIKRTGVQIKGSKVVVIGRSKIVGTPVAQLLTWHHATVTTCHSRTSNLAEEVRQADIVVVAVGKAELVRGDWIKPGAVVIDCGINSIPDYRLVGDINFQEVKKVASYITPVPGGVGPMTVAMIMKNTLQAAIEAAKKYST.. 302
152 0.000e+00UniRef50_A0A1G8IYN8 Bifunctional protein FolD n=4 Tax=Bacilli TaxID=91061 RepID=A0A1G8IYN8_9LACT  ali  28  28....................NIQPKMQVITVGDDPASQVYVGQKEKMAKRIGFDFDWQKLDEKSTQEELMHLIQQTNEDPSIHGVIVQLPLPDHLDSQKVMDGIDPKKDIDGFHPYNVGRLMPCTPRGILNLLDEYNVTIPGADVAIIGRSKIVGQPLANLLINRGATVSVLASRTKDVKYYTKNADIVIVAVGKAHLIDKSHLKEGAVVIDVGINRLDNGKLAGDVDFESAKQVASAMTPVPGGVGPMTVAMLMEQAIICACQQNNLDATAL 287
153 0.000e+00UniRef50_A0A135VP14 Bifunctional protein FolD n=3 Tax=Candidatus Thorarchaeota TaxID=1706441 RepID=A0A135VP14_9ARCH  ali  28  15..IKGRRLSNRIRTEVENEVGVSPKLVTVIVGEDPGSQMYVRMKHKASNKAGILSDHHDLPETTTQAELLRLIKKLNDDASVHGILVQLPIPKHIDEKTIIGSINPLKDVDGFSPANVYRLFAATPHGIVTILDRIGWDLSGKHAVIINRSTIVGKPLIMLLLNRNATVTVCHSRTKDLPFFTRQADVLVSAIGRPFFITTDMVKEGAVVIDVATP-------LGDVDFENVKDKALCVTPVPGGVGPMTIAMLLKNLVSAYRAQ........ 291
154 0.000e+00UniRef50_A0A2I4GSI7 bifunctional protein FolD 1, mitochondrial-like isoform X1 n=6 Tax=Pentapetalae TaxID=1437201 RepID=A0A2I4GSI7_9ROSI  ali  27  64.IIDGNFIAHDIKSRIADEIGKCPGLAVVLVGKRRDSRTFINIKLKACEEVGIATLIAELPETCTESELLHVVSGFNEDTSVHGIIVQLPLPRHLDEEKVVTFVSPEKDVDGFHPLNMGNFVPCAPKGCLELLLRLGVEIIGKKSVVIGRSKMVGLPTSFLLQRHHATVTTVHAFTNNPEQITSKADIVVSDVGIPNMVRGNWLKPGAVVIDMGNNLVKDYRVTGDVCYEEAIKVVSAITPVPGGVGPVTISMLLSNTLDSAKR......... 348
155 0.000e+00UniRef50_A0A2I0TXU4 C-X-C motif chemokine n=77 Tax=Euteleostomi TaxID=117571 RepID=A0A2I0TXU4_LIMLA  ali  30  75.IISGTKLAKQVLKEVQRDVNKRPHLTVILVGDNPASHIYVRNKIKAAAAVGISSEIILRPKDISQEELLDMTVKLNKDSTVSGLLVQLPLPDHIDERTVCNAIAPEKDVDGFHILNIGRLCPATAAAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPISMLLHTDDATVTITHRYTPQLKIHTQLADIVIVAAGIPKLITTDMVKEGAAVIDVGINHIHDPKLVGDVDFEEVKKKAGFITPVPGGVGPMTVAMLLKNTLIVAKK......... 366
156 0.000e+00UniRef50_A0A1T4MIY8 Bifunctional protein FolD n=81 Tax=Bacteria TaxID=2 RepID=A0A1T4MIY8_9BACT  ali  31  84.IVYGSEVAKELKDEMKMKIKRIPTLCVILVGNNPASVSYVTGKEKACKEVGLGSKMIHLDEETTQEKLLSVIKECNEDKSIDGILVQLPLPKHLNEKEVVWAIDPNKDVDGLHPINVGKLHPCTPQGIIELLKRMNVELSGKRAVVIGRSNLVGNPVARLLMNENATVTICHSKTENIQTICKEADILVVAIGKAKYVTKDFVKEGAYVIDVGVNRNDEGKLVGDVDFDDVVDHVTAITPVPKGVGPMTITMLLKNTIEACENS........ 361
157 0.000e+00UniRef50_A0A2A4YCY8 Bifunctional protein FolD n=4 Tax=root TaxID=1 RepID=A0A2A4YCY8_9BACT  ali  29  1MIIDGKKLAKNIMQELKEKIEVXPGLAFILIGENPASETYVRMKKKACEDHGFISHIIKLSEKVSEKDLLTKIEEINSDENIHGLLVQQPIPKHISTKKVMHAVDPGKDVDGFHPINMGKFFPCTPFGITKIFEHEKIETASKHVVIIGRSNIVGKPLAALLMQKNATVTVVHSGTKNIKDICKTADILIAAIGKPLFVTKDFVKNGAVVIDVGINRVKIGKIVGDVDFSSVEGSVSKITPVPGGVGPMTIAMLLFNTYKSFK.......... 281
158 0.000e+00UniRef50_A0A2D7C478 Bifunctional protein FolD n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2D7C478_9PROT  ali  29  1MIIDGKRVSSELKGWIRSEVRIVPKLAVILVGDNPASKVYVRSKSKTAQKMGIEISDYSLSSNISQKDLESLIEELNNDTQINGILLQLPLPDHLNTSFLLSKINPDKDVDALTPYNAGKLVPCTPLGSYILIKTRLEKLSGVNAVVVGRSLLFGKPMGQILLLENSTVTMTHSKTKNIKEHCKKADVLIVAAGRPQMVDASWVNKDSIIIDVGINRVDNYKIIGDVDFENVSKVVKAITPVPGGVGPMTIACLMFNTLTSAQIQN....... 288
159 0.000e+00UniRef50_A0A1G1W563 Bifunctional protein FolD n=9 Tax=Bacteria TaxID=2 RepID=A0A1G1W563_9BACT  ali  31  4.ILDGRKIAGQIRAELKEKVAKKPSLAVILVGDNPASAIYVREKMKAAVEIGAKFRLLKRKANTSQRALERIIQDLNRNASITGILVQKPLPPHIDDEEIDCLVDPAKDVDGLNPIS--PFIPSTALGVFELLSRYAIKVEGKKVVVVGRSKLVGLPTALEFVKRNATVTICHSKTANLAAETKQADILVVAAGKPRLIKRNMVKPGAVVIDVGINRDETHKLVGDVDFENVKKVAGYVTPVPGGVGPMTVAALMSNLVQA............ 265
160 0.000e+00UniRef50_Q74IM0 Bifunctional protein FolD 2 n=38 Tax=Lactobacillus TaxID=1578 RepID=FOLD2_LACJO  ali  32  4.LLEGKTPANEIKENLIEEIGINPTLCVIEVGDDPASKIYLRVKRNLAKKVGIKEIGLHFPANTSQAELLEKIEDLNQDPSINGIMVQLPVPPQIDPRAIFETIAPEKDADGFSPLNLGRLWPATVRSILTLIDYYGIEMAGKNTVIIGRSVIVGKPLAAVLVERDATVTIAHSKTKNLSELTKNADVIISDVGKAHLVTEDMVKEGAVIIDVGMNR-ENGKLMGDVDFDMVAPKAKAITPVPGGVGPLTVASLMKQAVILTRKQH....... 280
161 0.000e+00UniRef50_A0A1Q7ZHY8 Dephospho-CoA kinase (Fragment) n=1 Tax=Acidobacteria bacterium 13_1_20CM_2_68_7 TaxID=1803430 RepID=A0A1Q7ZHY8_9BACT  ali  31  8.LLDGKAVSQAIRSELKRSAGVAPSLAAVLVGDDPASQVYVRNKIIACAEVGMRSVEVRLPPTATQDQLMARLRRLNEDPDVDGILVQLPLPRGLDRMAVILALDPAKDVDGLHPLNAGRPVPCTPAGIIELLERYRLPIAGQHAVIVGRSEIVGRPLGVLLLQRDATVTVCHSKTRELPVITRQADLLVAAIGRPAFLRAEHIREGATVIDVGVNRLGDYTLVGDVHPREAAERAAHLTPVPGGIGPLTIACLLRNTLRAARAR........ 307
162 0.000e+00UniRef50_A0A257IXC2 Bifunctional protein FolD n=54 Tax=cellular organisms TaxID=131567 RepID=A0A257IXC2_9BACT  ali  29  3.IIDGKLISAQVKAELQIEVGKIPHLAAVLIGDNGASETYVASKIKSCEQIGFKSTLIRRDSTSTETEVLEIIDQLNKDEDIDGFIVQLPLPAHIDVDKVIEAIDPKKDVDGFHPINIGRMISATPYGVLELIKRYKIETAGKHCVVVGRSQIVGLPMSILMQRNNCTVTLVHSRTQNLKEICLQADILVAALGKPEFITADMVKDGAVVIDVGLTRVVDSSLKGDVKFDEVAPKTSYITPVPGGVGLMTVAALMYNTLLASRK......... 289
163 0.000e+00UniRef50_A0A195D6R9 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial n=4 Tax=Formicidae TaxID=36668 RepID=A0A195D6R  ali  32  30.IIDGTKIAEQIQEELKNAGKKRPKLVAILVGNHPSSKAYIGRKMKAAKSIGIESYTIHLGENITQADLLKEIDSLNRDPSVDGVLVQLPLPKGINEREVCQAIIPKKDVDGFHLENNNSIAPATALAVKELVLRSKIETFGKNAVVVGRSKHVGLPIALLLHAMDMTTTICHRHTPHLEKYTKLADLVVVAAGVPGLITKEMIKPGACIIDVGITRVKKYRLVGDVDYDGVKEVAGYITPVPGGVGPMTVAMLMKNTVKATMSNQEDTKQS. 328
164 0.000e+00UniRef50_UPI0004250431 bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase n=2 Tax=Bacillaceae  ali  30  5.LLYGQPVAQELKNKISKKVGSIPKLVVIIIGEDQASLTYVSMKKKAADKLGMSSEILRFPPSITEQQLKDEISKLNKDMNVHGILLQLPIPNHINEKNVLEWIDPRKDVDGFHPTNQPGFYPCTPLGIMRILTFYEIPIKGKHVVIVGRSNIVGKPVGQLLLNKDATVTFCHSKTEDLQELTSRADILIIAIGKAHFIKRNAVKKGATVIDIGNTFNEQKQVFGDADMNDLKGHVANITPVPKGVGPMTITMLLYNTVQAAKELNK...... 283
165 0.000e+00UniRef50_A0QSY5 Bifunctional protein FolD n=194 Tax=Bacteria TaxID=2 RepID=FOLD_MYCS2  ali  33  6..LDGKTTRDEIFVDLKERVGRTPGLGTVLVGDDPGSQAYVRGKHADCAKVGINSIRRDLPADITTEQLNETIDELNANPDCTGYIVQLPLPKHLDENAALERIDPAKDADGLHPTNKQAALPCTPRGIVHLLRRFDVPIAGAHVVVIGRGVTVGRPMGLLLTRRNATVTLCHTGTRDLPALTRQADIIIAAVGVPHMVTADMVKPGAAVVDVGVSRV-DGKLTGDVAPD-VWEVAGHVSPNPGGVGPLTRAFLLTNVVEA............ 277
166 0.000e+00UniRef50_A0A182ZBY7 Uncharacterized protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A182ZBY7_BIOGL  ali  30  5.ILDGSSLAKKIKDQIKQEIGFKPKLVVLMVGNNYSSQKYVTHKIKACEYCGIDSEIIRLDENITEEELDIKIDELNNNPSIHGILVQFPLPKPIRKRDIMLKISYQKDVDGFNPLNMGRVQACTPFGIMKLLDEYNISCEGKHAVIIGRSQIVGRPMALMLLNEKAVITITHRYISDLKYFTKLGDIVISATGRPKSITADMIKDGAICIDVGISQNEKGKLSGDFDFDEVSKKASWITPVPGGVGPMTVAMLMYNQLQVYKK......... 281
167 0.000e+00UniRef50_D0J906 Bifunctional protein FolD n=8 Tax=Bacteria TaxID=2 RepID=D0J906_BLASP  ali  32  16.....KEISKEIEKSIRNKKKRLPHLGIILLGTNSSSLTYVNSKIQECKNIGIKSSLIHLPNDSSEKELLKEIQKMNNNPLIDGFIVQLPLQKHINSDKIIMSINPRKDVDGFHPENFGKMFPATALGILTILERYKIEISGKHTVVIGRSRIVGRPISILMSRKNYTVTLTHSQTPNIDYYTKQADIIITAVGRPGFLTGKMIKEGAIVIDVGITKVKNGKLKGDVDFNSVYGKASYLTPVPGGVGPMTRIMLIKNTLIAALNNGN...... 291
168 0.000e+00UniRef50_Q6NIZ6 Bifunctional protein FolD n=49 Tax=Bacteria TaxID=2 RepID=FOLD_CORDI  ali  35  4IKLDGNLYRDEIFEDLKREKGIVPGLATVLVGDDPASHAYVRMKHKDCEIVGVKSIRKDLPADVTQEELLAVIDDLNADPECTGYIVQLPLPKHLDENAVLERIDPAKDADGLHPVNLGKPLPCTPNGAIHLLRRFGVELDGKKVVVIGRGVTVGRPIGLMLTRRNSTVTLCHTGTRDLAAETREADVIVAAAGKAHMLTADMVKQGAAILDVGVSRV-DGKLLGDVHPD-VWDVAGAVSPNPGGVGPLTRAFLIRNVVERAER......... 280
169 0.000e+00UniRef50_S9PR17 C-1-tetrahydrofolate synthase n=1 Tax=Schizosaccharomyces octosporus (strain yFS286) TaxID=483514 RepID=S9PR17_SCHOY  ali  29  25.....KSVAEEV-ERLKRTDGYRPSLAIVQVGKREDSNVYVRMKERAAKRIGITYKHCAFPETISQSTLLHEVRKLNNDQSVHGILVQLPLPHHLNERTITESILAEKDVDGFGAVNIGMHVPCTPMGVMELLHEYNIPIAGKHAVILGRSDIVGNPVSYLLRQENATVTVCHSHTENIQEQIARADILVAALGKPEFVRGEWLKPGAVVVDVGINRNGKRELVGDVHYPSVSQVASHITPVPGGVGPMTVAMLMRNTVKAAEISRN...... 298
170 0.000e+00UniRef50_A0A1H3LN32 Bifunctional protein FolD n=2 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1H3LN32_9MICO  ali  27  5.IIDGKAVAARTNEETAQAVGTRPGLATILVGDDAASAVYVESKRRTSVRLGMADFHRHLPSTASRDDVARLLDELASDDAVSGILLQLPLPESLDTTGLVDLIPPSKDVDGLTTASLPGLRPCTPLGAVELLDSSEVTLSGSRVVVVGRSELVGRPLAQLLLQRDATVTTAHSRTQDLPAVTRDADVLVVAAGVPGLIGAEHVKKGAVVIDVGIHRTETG-LAGDVRFDEVVGVASAITPVPGGVGPMTIAMLMRNTLTAAIMVSEPQQ... 286
171 0.000e+00UniRef50_A0A2E5YJ64 Bifunctional protein FolD n=3 Tax=Bacteria TaxID=2 RepID=A0A2E5YJ64_9DELT  ali  29  8IVVDGMALANQLRDEMKSEIERAPHLVVVLVGDDPASRSYIKGKQRACTRIGADSSEYLLPYSTNQKELLDLLERLNDDDAIDGILVQLPLPKHISAETIAEAIDPAKDADALHPLNFGRLISCTPLGVMAVLEHHGIEIAGQQAVVIGRSNIVGKPVSILLQQQNATVTMCHSRTKDLAGVCRSADILVAAAGNPKMVKGDWIQPGAAVMDVGVSEV-DGKLIGDVDFEAAQGIARLITPSRRGIGPMTITMLLRNTLNAYLARK....... 286
172 0.000e+00UniRef50_UPI0007EFAB8F bifunctional protein FolD 1, mitochondrial-like isoform X1 n=3 Tax=Daucus carota subsp. sativus TaxID=79200 RepID=UPI0007EFAB8  ali  30  52.IIDGKSIANDIKNKMKNCIGKCPGLGIVLVGQRHDSHTFIRLKLRACHEVGIATFLKQLPEDCSQDEVYHVVSKLNDDPDVHGVIVQLPLPRHLNEDKVVEFVSPEKDVDGLHPLNIPFFIPCAPKACIELLLRQGIEITGSRVVVLGKSKISGLPISLLLQSHLATVSTLHAFTDNPEHVTRQADIVVSDVGNPNVVRGHWLKPGAIVIDMGATQVKDSRITGDVCYEEANKVVSAITPVPGGAGPVTISMLLSNTLESAKR......... 335
173 0.000e+00UniRef50_A0A1J4UR69 Bifunctional protein FolD n=1 Tax=Candidatus Micrarchaeota archaeon CG1_02_55_22 TaxID=1805250 RepID=A0A1J4UR69_9ARCH  ali  29  4IILDGKALSSKVLDELKTRVGVQPTLGIILVGEDSASELYVRLKKDACTKIGGEFVLKRLPASAGTRQVLAAIDAFNNDSSVDGILLQLPLPKGTDAAECLAAISPEKDVDGLNPINLARIFAATAKGIMALLHANGVELAGKRAVVIGRSPDVGIPIAGLLLAEDATVTIAHSKTANLAEVCRDADIIVSSVGKAGIVTPEMVKDGAVVVDVGTNFVESGSVVGDVDP-RVCEKASYVTPVPGGVGPMTIASLLENLVEAAQER........ 279
174 0.000e+00UniRef50_A0A172T858 Bifunctional protein FolD n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A172T858_9DEIO  ali  29  37......................PPHLSIVRLGEDPASVSYVRGKDRKAREVGLHSTVYALPEDTSQADLLALVARLNADPDVNGILVQLPLPAHVSEQAVLHAIDPRKDVDGFHPVNVGELWPCTPAGIMYMLGHYSIPVAGARAVIVGRSHIVGRPLAAMLLNAHATVTVAHSRTPDLGAVTREADLLFAAVGRVHLVTPDMVKPGATVVDVGINRVADGKLTGDVHPD-VAAVAGALTPVPGGVGPLTIAQLLANTVTAAERQ........ 289
175 0.000e+00UniRef50_A0A1R1YRI8 C-1-tetrahydrofolate synthase, cytoplasmic n=3 Tax=Opisthokonta TaxID=33154 RepID=A0A1R1YRI8_9FUNG  ali  30  100.LIDGKAIASSIRKDLNAKVSFAPTLAVIQVGFRKDSSLYVKQKQIACEEVGVISKKFNLPEEAQPAELYSLIDSLNDDDSVNGILLQLPLPKHFQEDAMINFIRPDKDVDGFHIENMPRYVSCTPKGIMRLLSTMGVNLNGARAVVLGRSDIVGTPVSALLTKQNATVTVCHSRTKNIEDICRQADVLVVAIGIPEFVKGDWIKPGAVVIDVGINRKSGSRWVGDVDFDQAKQSASMITPVPGGVGPMTVAMLLDNLVDGAIRQFESASK.. 392
176 0.000e+00UniRef50_A0A2I4CH96 C-1-tetrahydrofolate synthase, cytoplasmic isoform X1 n=4 Tax=Bilateria TaxID=33213 RepID=A0A2I4CH96_9TELE  ali  26  34.VISGNKTSKLVRDRLRNDVGFRPSLVVLQVGDRDDSNLYISTKLKAAAEIGIDAKHVRLPSSATQAEVLQSVLSVNENPSVHGLIVQLPLDSRIDTELVTNAVSPDKDVDGLSCINKDCFIPCTPNGCMELIRQTGVSVAGKHAVVIGRSKIVGAPMHDLLLWNHATVTTCHSKTPDLPEQVSRADILVVGAGRAEMVRGEWVKQGAVVIDCGINHVPDKRVVGDVHYASANQRAGFITPVPGGVGPMTVAMLMENTVQSAHR......... 321
177 0.000e+00UniRef50_P09440 C-1-tetrahydrofolate synthase, mitochondrial n=486 Tax=Opisthokonta TaxID=33154 RepID=C1TM_YEAST  ali  30  37.ILSGRKLAQSIREKANDEINFKPTLKIIQVGARPDSSTYVRMKLKASKDSNVDCIIEKLPAEITEVELLKKISDINDDDSIHGLLIQLPLPRHLDETTITNAVDFKKDVDGFHRYNKPYFIPCTPYGCMKLLEEAHVKLDGKNAVVLGRSSIVGNPIASLLKNANATVTVCHSHTRNIAEVVSQADIVIAACGIPQYVKSDWIKEGAVVIDVGINYVPDQKLVGDVDFDSVKEKTSYITPVPGGVGPMTVAMLVSNVLLAAKRQ........ 323
178 0.000e+00UniRef50_A0A1F8Q7E4 Bifunctional protein FolD n=39 Tax=root TaxID=1 RepID=A0A1F8Q7E4_9CHLR  ali  31  30...................HNLVPGLVTVLVGADPASQVYVGQKEKTSKELGIYSERHDLPEKTTQKELIALVNQLNKDPKIHGILVQLPLPKHLNEEEVLYTINPRKDVDGFHPVNVGKLMPCTPAGIQQLLIRSGTPIEGAEVVVVGRSNIVGKPIANMLLQKNATVTICHTKTRDIAFHTRRADILIVAAGKPKSVTGDMVKNGVVVIDVGVNEIGDGKLAGDVDFDTVKEKAKAITPVPGGVGPMTITMLMMNTVRAAK.......... 289
179 0.000e+00UniRef50_A0A1X9MFH8 Bifunctional protein FolD n=55 Tax=Bacteria TaxID=2 RepID=A0A1X9MFH8_9BACI  ali  34  30....................NVIPGLAVILVGEDPASQSYVKAKHKACEQAGIYSELIKKQESISEEELLSEIERLNHDPAIDGILVQLPLPAHISEQAVIEKIAPNKDVDGFHPINIGKMMPCTPYGVVEMLKEAEVELSGKHVVVVGRSNIVGKPVGQLLLNENATVTYCHSRTKNLREMTNLADILIVAIGKPKFISAEDVKPGAVVVDVGINRV-DGKLCGDVDFEGVKDQASYITPVPGGVGPMTITMLLENTVQSARKR........ 280
180 0.000e+00UniRef50_Q74GN1 Bifunctional protein FolD 1 n=49 Tax=root TaxID=1 RepID=FOLD1_GEOSL  ali  29  3.LLDGKKCAESLVAEIARKVARTPHMTIILVGEHAPSESYVKSKIATSGLAGFESTLLRFPETIRESELLAKIKEVNEDPTTDGLIVQLPLPKHINQQHVINAIAPEKDIDGFHPANFGRMRPATAYGICKLLQFYEVPVKAKHCVVIGRSNIVGKPISIMLSNDFATVTLTHIETPRLLDETRRADIVIVAVGIPGFVTADMVKDGVVLIDVGINRLESGKIVGDVDFENVAQKCSWITPVPGGVGRMTVAALMINTLMAYQNNFNL..... 289
181 0.000e+00UniRef50_A0A1I6LM92 Bifunctional protein FolD n=1 Tax=Granulicella pectinivorans TaxID=474950 RepID=A0A1I6LM92_9BACT  ali  28  10.LLDGIAIAAGIKTEVAAEVGVTPGLAVILVGNVAASEIYVRSKVKTCGELGIYSEMLTPPDSITTDEMLELIAKLNDRNDIDGILIQLPLPSHVDTRRLLEAVDPSKDVDGFHPINAGRLAPCTPAGIMEILRRSDIEIAGKNAVVLGRSDIVGKPAASMLINASATVTVCHSRTKDLAKYTREADILVAAIGRPGFVTAEMVKPGATLIDVGINRVTDSVVVGDIHPAAFA-ISGAYTPVPGGVGALTIAMLMQNTVTAAKARR....... 319
182 0.000e+00UniRef50_A0A1Y1W410 FTHFS-domain-containing protein n=2 Tax=Opisthokonta TaxID=33154 RepID=A0A1Y1W410_9FUNG  ali  31  15..LDGKAISEAVRLELKEEVAFKPKLMAIQVGARSDSSVYIRQKSKACNEIGIDFEHVQLDENIQQAELDARLDQVNNDPSVHGIIVQLPVPDHLNTKHIVHSILPEKDVDGFHAENIPHFYSCTPLGCIEILERYNVEIAGKNAVVVGRSDIVGSPISMMLTNLNATVTLCHSRTDDIESKVRGADILVVAIGKAEFVKADWIKPGAVVVDVGMNAKDDYRWVGDVE-ASAIERASYMTPVPGGVGPMTVAMLLRNVVTSAKRYFEETSK.. 305
183 0.000e+00UniRef50_Q9ZD32 Bifunctional protein FolD n=60 Tax=cellular organisms TaxID=131567 RepID=FOLD_RICPR  ali  31  5.IIDGKALANEILADLKEKTKTSPKLAIVLVGDNPASMIYVKNKIKNAHQVGIDTLLVNLSTNIYTDDLILKINELNLDKGISGIIVQLPLPSSIDENKILSAVLPSKDSDGFHPLNNQGFIPCTALGCLAVIKKYAPNLNGKDAVIVGRSNIVGKPLSALLLQENCSVTICHSKTCNLSSITSKADIVVVAIGSPLKLTAEYFNPEAIVIDVGINRISHNKIAGDVDFENVKSKVKYITPVPGGIGPMTIAFLLKNTVKAFKN......... 282
184 0.000e+00UniRef50_UPI0008344C72 bifunctional 5,10-methylenetetrahydrofolate dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase n=2 Tax=Nitrosopumilace  ali  33  6..IDGKIIAQTVKDRVKKKDGINPCLATVLVGNNAASATYVKNKHKACDEVGIITKDHKLEENTTQQQLNSIIDELNQNSSVHGILVQLPLPQHLNEFETTSRISPLKDVDGLTPHNKAVLVACTPSGVMEMFDYHNIELEGKNIVLINRSNLVGKPLYHLLLEKNATVITCHSRTKDIEKFCQEADIIITAVGRTKFITPEMIKEESIVIDVAISRFEN-KLVGDCDYERIIEKASFATPVPGGVGPMTVAMLLKNTITAA........... 279
185 0.000e+00UniRef50_A0A1H9GQ79 Bifunctional protein FolD n=1 Tax=Granulicatella balaenopterae TaxID=137733 RepID=A0A1H9GQ79_9LACT  ali  27  4.ILDGKQLAKEIRQQLIDKAGVTPGLAVVLVGDDPASQTYVKLKERHAKEVGFHSVVRRLDESVSQEEVLAVIRDLNNDQAIDAILVQLPLPQQIDTDIVLRAVEPKKDVDGFHAMNLGNLVPCTPKGIITLLDHYQIDVMGKKVVVVGESLIVGRPMALMCLNRGATVTVCHIHTKDLAAETKQADVLISATGVLGLITKEHLKPGAVVIDVGMVRDSDGSLKGDVCYSEVLPLASAITPVPGGVGPMTIASLLEQTLENTMKLHNID.... 285
186 0.000e+00UniRef50_I4B865 Bifunctional protein FolD n=13 Tax=Bacteria TaxID=2 RepID=I4B865_TURPD  ali  30  25....GKKLAELLRQHIKEETGLKPGLAVILVGDDAASQIYVAGKEKAALELGFDSRIVRLPANTTQEALVAEIHKFNVDASVHGILVQLPLPAHLNESQILQAIVAEKDADGFHYLNQGKTLPCTPAGIALMLRHPAADLTGRHAVVVGRSNIVGKPMAQLLLSLNMTVTICHSKTHNLQRFVADADVLVSATGVRGVIDEKMVKAGAIVIDVGMHRI-DGKVTGDLIMSEIENKASYYTPVPGGVGPMTIAMLLFNTYQNAQR......... 301
187 0.000e+00UniRef50_X0ZVE2 Uncharacterized protein n=3 Tax=marine sediment metagenome TaxID=412755 RepID=X0ZVE2_9ZZZZ  ali  35  4.VLNGKELAERLNSELKNKIGITPKLAAILVGDDPASKLYITIKRKTCVEIGIDSTLVKLNRECTKAELFTKISELNNDTTVHGIILQLPLPMKFKPFTLIEKIDPLKDVDGLHPINKGKLFPATPKGIITLLEYYNVELKGKHVVIINRSNLVGKPLIFMFLKRNATVTVCHTSTSDLENHIKKADILVVAIGQPDFITKDKIKEGVVIIDVGTSRV-NGKTRGDVKFEDVFDTCSWITPNPGGVGPMTVSFLLQNTYNAYKRQ........ 282
188 0.000e+00UniRef50_B1GZ24 Bifunctional protein FolD n=23 Tax=cellular organisms TaxID=131567 RepID=B1GZ24_UNCTG  ali  30  3.LIDGKKISSDKRAEIKEEVAKIPGLATVLVGGDPASRVYIKSKIKACEDAGIKSFHHNLDANSSKEEIIALIKKLNENSEIDGILLQLPLPQNKDAQECLNAVSPLKDVDGLHPFNKNILVSCTPLGVVHILHKSGIIIEGKTAVVIGRSNLVGKPLSMLLLANNATVIMAHSKTRNLKEICKSADIVVAAVGKSKFVNKDFIKTGAVVIDVGINRTSEG-LCGDVDFDAVKDMDIKITPVPGGVGPMTITMLLENTLKAFNNRKRYLSNRM 295
189 0.000e+00UniRef50_A0A077AYX4 Bifunctional protein FolD n=2 Tax=Candidatus Paracaedibacteraceae TaxID=1777752 RepID=A0A077AYX4_9PROT  ali  30  4.ILDGKALAAQQKPSLMAKLGRAPTLAVILVGEDPASQIYVGRKATMCKALGIHSIIHRLASSVTSADLIAVIEGLNDDETVDGILLQLPLPDHLDRYEALQHIDPAKDVDGLHPLNQGYLFPCTPTGCLQLIKSCCEDLTGVNVTIIGTSVLVGRPLALLLMQQGATVTIANSKTRNLALVTQRSDIIVSATGRAHLITADHVKEGAIVIDVGIVKLND-RLIGDVDFAAVEKKAAFITPVPGGVGPMTIINLMANILKAAEERYHALQT.. 286
190 0.000e+00UniRef50_A0A2D4LEU9 Uncharacterized protein (Fragment) n=2 Tax=Colubroidea TaxID=34989 RepID=A0A2D4LEU9_9SAUR  ali  28  67.IISGKTVSAQVRERLKNQVGFRPGLAILQVGDRDDSNLYISMKLKAAAEIGINANHIKLPGTATEAEVLKCINNLNEDPAIHGFIVQLPLDSNINTEKITNAVAPEKDVDGLSSVNSNCFIPCTPKGCMELIRQTGVQVAGKKAVVIGRSKIVGAPMHDLLLWNHATVTTCHSKTASLADEVSKADILVVAAGKAEMVKGEWIKPGSVVIDCGINHIPDKRVVGDVAYASAKEKAAYITPVPGGVGPMTVAMLMQSTVESAQRFLEKYQPG. 362
191 0.000e+00UniRef50_Q2GCV3 Bifunctional protein FolD n=21 Tax=Anaplasmataceae TaxID=942 RepID=FOLD_NEOSM  ali  26  4.LIDGFRIAAGICESLRKNNGLVPSLRVIIVGENPASQVYVRSKQKKAESLGIDAETIALPKDTSEVELIRLVNSLNDDTSINAILVQLPLPPHINPTRIIESIDSKKDVDCFHPENVGRLKPCTPAGSLYLIKSAGDNLSGMDAVVIGRSNIVGKPMAMLLLHENCTITLTHSKTRNIQEKTRQADIVISAVGIPHFVKKDFIKPGATVIDVGMNKV-DGKLVGDVDFEDVLQKVKFITPVPRGVGPMTIAFLMLNTVITTCLQNKLEHQEV 290
192 0.000e+00UniRef50_F7BGW5 Uncharacterized protein n=8 Tax=Boreoeutheria TaxID=1437010 RepID=F7BGW5_MACMU  ali  29  54.ILNGKEISAQIRARLKNQVGFIPGLAILQIGNRDDSNLYIKVKLKAAEEIGIKATHIKLPRTTTESEVIKYITSLNEDSTIHGFLVQLPFDSEINTEEVINAIAPEKDVDGLTSISNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTANLNEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLEKFKPG. 348
193 0.000e+00UniRef50_Q9K3J6 Bifunctional protein FolD n=1946 Tax=root TaxID=1 RepID=FOLD_STRCO  ali  33  5.ILDGKATAAAIKSELTKERGVTPGLGTVLVGDDPGSQKYVAGKHRDCAQVGIASIQRELPATATQEEIEAVVRELNEDPACTGYIVQLPLPRGIDENRILELMDPDKDADGLHPMNLGRPLPCTPNGILTLLRRYGVEIKGAEVVVVGRGVTIGRPMPLLLTRRNATVTQCHTGTRDLAAHLKRADIVIAAAGSPHLVRPEDVKPGAAVLDVGVSRNAEGKIMGDVHP-GVAEVAAWISPNPGGVGPMTRAQLLVNVVEAAERS........ 282
194 0.000e+00UniRef50_A0A1X7AFI6 Bifunctional protein FolD n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1X7AFI6_9GAMM  ali  26  5.IISGTQMRQEILAELQEQHGTVPGLVTILVGENPASVSYVTLKVKTALSLGFHEVQDNQPEDISEQDLLALIEKYNNDPAIHGILVQLPLPKHINEDAVINAISPDKDVDGFHPVNQVRYLPCTPAGIQEMIVRSGTETEGAEVVVVGRSNIVGKPISVMMGQKNSTVTMVHTRTKDLAAHCQRADILIVAAGVPGLVKPEWIKPGATVIDVGVNRIETGKLSGDVDFEAAKEIAGKITPVPGGVGPMTITMLMKNTVKSAWWHLQ...... 296
195 0.000e+00UniRef50_U4KQW8 Bifunctional protein FolD n=1 Tax=Acholeplasma brassicae TaxID=61635 RepID=U4KQW8_9MOLU  ali  33  1MLLDGKNSAKEYIDKIKEKSGRAPHLTVIMVGNNEASKTYVSSKKKACLRVGMTSDIKYLDESIKEDELIALIESLNKNDDIDGILVQLPLPKHINESLVVNTVDPLKDVDGLTILNAGKVFPATPKGIMMLLEKYNINVCGMHAVVVGRSNLVGLPIAKLLNDSDATVTLCHRQTRHLSTFTKSADLLVVAVGKKDMITKDMVKPGAIVIDVGINRM-DGKLYGDVSSE-VSSIASYFTPVPGGVGPMTINALLHNLLELYEVRH....... 278
196 0.000e+00UniRef50_T1JKV3 Enolase-phosphatase E1 n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1JKV3_STRMM  ali  30  8.ILSGTDLAKEIKIRLQEEVGFAPGLAIVQVGDREDSNVYIRMKLKAASEIGIDAKHIRFPSSITEDELLNGINTLNEDINVHGIIVQMPLDSKIDNNKATDAVSPLKDVDGLHTINAGKFIPCTPHGCLELIKKSGITIAGSRAVVVGRSRIVGMPMAELLIWNNATVTTCHTKTKEMDKVISEADILVVAAGRPQMIKGDCIKPGAVVIDCGINSIPDSRLVGDVDFDSAKLKASHITPVPGGVGPLTVAMLMHNTVQAAGRNIRCPRCSL 304
197 0.000e+00UniRef50_A0A0L0DET0 Uncharacterized protein n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0DET0_THETB  ali  27  9..IDGKAIAKQVREELAGEVGKAPHLVVVVVGDRPDSHAYVRMKMKACAEVGIRSTKIEMVGDAPQEEVMAQVAALDADADVNSILVQLPLPDHVDEAAVLECISLEKDVDGFAPANEPAAVACTPKGVMTLLERSGVEIEGKNAVVLGRSNIVGVPMALLLMAANATVTICHSRTADIRDHVSRADIVVAAVGRPEMVKGEWLKPGAVIIDVGMNKKDDYRWVGDVDYASASTVASAITPVPGGVGPMTVATLLCNAFAAAKRQHQA..... 298
198 0.000e+00UniRef50_A0A2D0Q0Q0 C-1-tetrahydrofolate synthase, cytoplasmic n=14 Tax=Clupeocephala TaxID=186625 RepID=A0A2D0Q0Q0_ICTPU  ali  26  26.VISGSKLSQHVTERLKKDVGFRPGLVVLQVGDRDDSNLYISMKLKAAARIGINANHIRLPKTATQDEVLQSIQLYNEDPDVHGLIVQLPLDSHMSTEKVTNAVDPDKDVDGLCSVNQSCFIPCTPNGCMELLKHTGVSVSGKNAVVIGRSKIVGAPMHDLLLWNHATVTCCHSKTPDLPAEVKKADILVVGTGNAEMVKGEWIKDGAVVIDVGINYIPDSRVVGDVHYPSAQERAGFITPVPGGVGPMTVAMLMENTVKSAARFLQTYRPG. 321
199 0.000e+00UniRef50_A0A0K2ZRL7 Multifunctional fusion protein n=4 Tax=Xanthomonas campestris pv. translucens TaxID=343 RepID=A0A0K2ZRL7_XANCT  ali  28  14.ILDGRRIADELLDQLKLRVQPRPGLAVVLVGGDPASAVYVRNKRRAAEKVGIEAFDYDLPAGTGEAELLALIDRLNADPKIHGILVQLPLPGIPDASRLIHRIDPRKDVDGFHPENEFGLRPCTPRGIVTLLGHTDQPVRGRNATIVGVSNHVGRPMALELLIAGCTVSCCHKFTPPLQARVRDADILVVAVGRPGLIPGEWVKPGAVVIDVGINRLDDGRLVGDVSFDAAAQRASWITPVPGGVGPMTVATLMQNTIEAA........... 290
200 0.000e+00UniRef50_Q88WM8 Bifunctional protein FolD n=213 Tax=root TaxID=1 RepID=FOLD_LACPL  ali  25  4.IIDGKAVAKKVNAQTATAVGIQPGIAVIIVGDDAASQIYVRNKNRKATKLGMHSVVRQLPATTSQDELLAIIAAYNADDSIHGILVQSPLPAQINEPLITMAIDPKKDVDGFHPTNVGKPVANTPRGIMTMLADYGVDPAGKTAVVIGRSTIVGKPMAALLTNANATVTIAHSKTADLKAVARTADILVVATGIAHLITGADIKPGATVIDVGMDRDENGKLVGDVDFDSAQGIAGLITPVPGGVGPMTIATLMQTTVELAKWS........ 282
201 0.000e+00UniRef50_A0A1G9S0E9 Bifunctional protein FolD n=2 Tax=Siphonobacter aquaeclarae TaxID=563176 RepID=A0A1G9S0E9_9BACT  ali  26  156.LIDGKAVAAHFKARIAEEVGKTPHLVAILVGNNGASETYVAHKVKACAELGFESTLVRFPDTVSEEELLRKVEEINANPDMDGLIVQLPLPKHINPDRIMETIAPAKDVDGFHPINIGRMVSATPQGCLMLIEHYGIETAGKHCVVVGRSQIVGLPMSILMQRNNCTVTITHSKTANLAEICRQADILVGALGRPEFITADMVKEGAVVLDVGLERVADPSLKGDVKFDEVAPKTSYITPVPGGVGQMTIISLMQNTLLAAK.......... 441
202 0.000e+00UniRef50_A0A2U9BTE2 Putative bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2 n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A  ali  29  53.VISGTELARQLHREIQRDVNMRPHLGVVLVGDDPASRTYVKNKTRAASILGISSDTVVRPTSVSQEELLELIDKMNRDWRVSGLLVQLPLPEHINERAVCNAIAPEKDVDGFHIVNIGKMVPATPAAVWEIIKRAGIDTVGKNVLVAGRSKNVGMPIAMLLHTDRATVTIAHRCTPRLKELTCLADIIIAAAGVPRLITADMVKVGAAVIDVGINRIHDPKLIGDVDFEGVKEKAGIITPVPGGVGPMTVAMLMKNTV.............. 339
203 0.000e+00UniRef50_A0A1M6L4P4 Bifunctional protein FolD n=2 Tax=Clostridiaceae TaxID=31979 RepID=A0A1M6L4P4_9CLOT  ali  31  4.VLKGKELKQKISEELKEKYRVEPCFASILIGNDGGSMFYVEFQKKNCESLGIKYELIHLSEGVSTEEVIDIIEKLNCDTSVHGIMMQVPLPSHLDEKAIIHHINPDKDVDSLTDTNSRCFEPCTPKAVMELLDYIGEDLAGKRAVVIGRSNIVGKPLAIMLLKKNATVTVCHSHTKDIKSITKEADILVSCVGKPHFVNSEFVKPGAIVMDVGTS-DVNGKITGDVDFDDVEPVAGYITPVPGGVGSITTMLLLKNTLKAMERNLEIK.... 284
204 0.000e+00UniRef50_A0A120FMQ4 Bifunctional protein FolD n=6 Tax=Bacteria TaxID=2 RepID=A0A120FMQ4_9RHIZ  ali  28  4.VIEGKKVASTVIERVKRTSGVKAGLAVVIVGDDPASHAYVGAKSRMAKECGFASVQHTLSSETTQEELLELVGTLNQDPSIHGILVQLPLPKHLKSEPVIQSILPEKDVDGLNVVNAGKLVSCTPAGAMVFVRQHGEDLSGLHAVVVGRSNLFGKPMAQLLLNANATVTIAHSRTRDLSAVCRTADILVVAVGRPQMVRYDWVKPGATVIDVGINRIGKSRLVGDVAFEECSETAAVITPVPGGVGPMTIAMLMANTIIAAYR......... 290
205 0.000e+00UniRef50_A0A2E3HVL3 Bifunctional protein FolD n=1 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2E3HVL3_9BACT  ali  32  9.LINGQQIAKSIRNHIRIQVKRKPGLAVIQIGTDSASTVYVNHKQKDCERVGFHSEVIRLPSNTLQEKVIDLIQQLNLSKHIHGILVQMPMPNHIDEQIVIDSILPQKDADGLGTVNQERVLPCTPGGILRLIEETKIELAGKRVVCVGRSRLVGKPIGLLMLNRHATVTFCHSRTMDLGLETKEADILVVAIGKPKFITPKMVKSGAIVIDVGINRIGNS-LIGDIDFKTVSKVAGFITPVPGGVGPMTRAILLENTLKLATTQFETL.... 285
206 0.000e+00UniRef50_A9AZP9 Bifunctional protein FolD n=13 Tax=Bacteria TaxID=2 RepID=FOLD_HERA2  ali  28  4LLLDGRGLAKELKAQIKARTGYAPQLVVIQVAGNAASDWYVRSIRRSCEGVGFGFALQRLPETSDQATLEAAIQQASNDPAIHGIIIQMPLPSQLSADGAVAALNPQKDVDGLHPTNAGRLVPNTPAGGMALLDRYQINLAGKHAVVVGRSNVVGKPLAQLLLARHATVTICHSRTANLAEVIRQGDIVAAAVGKAGLVTGEMLKPGAVVLDFGINEVAEGQVVGDVDWESASKVASAITPVPGGTGPVTNMMLLQNTLQAAQ.......... 280
207 0.000e+00UniRef50_A0A2A3TA28 Bifunctional protein FolD n=2 Tax=Thaumarchaeota archaeon TaxID=2026795 RepID=A0A2A3TA28_9ARCH  ali  33  6..IDGIXIAQTVKDRVKKAVGINPCLATILVGDDTASATYVRNKHKACEEVGIITRDHKLDANTTQTQLNDIIENLNKDPTTHGILVQLPLPKQLDEFTTKSRISPLKDVDGLTPHNKAALVACTPSGIIEMFEFHKINLEGKNVVLINRSNLVGKPLYHLLLEKNATVITCHSRTRNLTELCQXADIIISAVGRAKFLTSDMIKEGAIVIDVAISRYQD-KLVGDTDFEDIIQKASFATPVPGGVGPMTVAMLLKNTITAASLSSQIGR... 287
208 0.000e+00UniRef50_A0A1Q9C7A8 Bifunctional protein FolD 2 n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9C7A8_SYMMI  ali  27  145.LLDGKATAAEVREELRERTGLKPGLAVVLVGSRPDSESYVRGKTKAAEEVGCQVFNINFPEAVTETVLLDQISELNQDPRVHGVLVQLPLPAHINEQLVLDSISVHKDADGLCSANCPLALPCTPAGCMEMLRRYQVGVEGKNCVVLGRSAIVGMPMMLLMLKANGTVRLCHRFTKDIAKACSDADILVAAVGRANFVKGDWLKPGVVVLDVGINRVPDYRLQGDVEFGSAAQKASLITPVPGGVGPMTVAMLLKNTVALAELQQKFEM... 436
209 0.000e+00UniRef50_A0A1S9CBE2 Bifunctional protein FolD n=3 Tax=Epulopiscium TaxID=2383 RepID=A0A1S9CBE2_9FIRM  ali  31  7.VINGQKIASIIKDQIKDVINQTVGLAVISLGNDEASQIYVRNKQKACDYVGIKSQIYNFEANTPLEDILELIDVLNNSHSVDGILIQLPLPAHINPRDLISAIDFKKDVDGFSKESDTVFKSCTSLGIIELLKYEKIKISGKKCVVVGRSNIVGKPLALMLLNEDATVSICHSKTDNLIDEIKTADILITAIGQPKFITGDMIKPGAVVIDVGINRDINQKLCGDVDFDSCFGIAGYITPVPGGVGPMTVAMLLKNCLTAANLK........ 281
210 0.000e+00UniRef50_A0A1I1DAL2 Bifunctional protein FolD n=2 Tax=Brevinema andersonii TaxID=34097 RepID=A0A1I1DAL2_9SPIR  ali  31  1MILDGKKIAEKKKHQIIADKNLTPGLATVLVGSDRASYSYVAAKIKACSEVGFYSHPVFLSEKISEVELLHCIEQLNINPKIHGILVQLPLPGHISEKNILSAILPEKDVDCFHPLNLGRFSPCTPKGILTLLKSMDISLESQNALVIGKSNIVGKPAAFLLLQHDMTVSIAHKKTKNLKQLCREADIIVSAAGCPNLITADMIRDGVIIIDVGINRVPDYRIQGDADFAGIASKCKAITPVPGGIGPMTIVSLLENTLYLAER......... 280
211 0.000e+00UniRef50_A0A1M6LLN2 Bifunctional protein FolD n=2 Tax=Caminicella TaxID=166484 RepID=A0A1M6LLN2_9CLOT  ali  26  4.IINGREISKKRLIEIEEKVGKVPGLAVVYIGNDKASEVYVNTIIKKCTKVHFYSEKHLLSENVSEDEILDLINNLNKNEKINGIIIQFPLPKGIDENKIKFALSYEKDVDCINPINVGMLYPCTPKGVIELIKSINQDLTGKNAVVVGRSNIVGKPVAELLQQENLTVTLCHSKTKDLKEHLLRADVVVAAAGRANLIKGDMLKENCIVIDVGTNVV-DGKLVGDVEFDSAVKKASYITPVPGGVGPMTIAMLLENTLEACLKQ........ 280
212 0.000e+00UniRef50_A7NHA9 Bifunctional protein FolD n=2 Tax=Chloroflexales TaxID=32064 RepID=FOLD_ROSCS  ali  26  4MILDGRALAKTLREELRADIGVTPSLAVVKIAGDPASERYTRTIRKGCEDIGIVFYDHTLPPDTTQAALEETLHALSFDRAVNGILLHLPLPPGFDSNRAIAQIDPHKDVDGVHPYNQPTMVPNTPAGGMELLLRNHILIKGQRATVVGRSVVVGKPMALLLLQEHATVTIAHSRTKDLASVVREADIVVAATGKPGLITADMVRPGAVVVDFGVNVLGDGKVVGDVDFAGVAEIASAITPVPGGTGPVTNIMLLRNVLRAARLQ........ 282
213 0.000e+00UniRef50_A0A2B8A136 Bifunctional protein FolD n=2 Tax=Cytophagales TaxID=768507 RepID=A0A2B8A136_9BACT  ali  30  7.LIDGKKIAQEIKDEIKEAGKKLPHLAIILAGDDIASQTYVNNKIKACKAVGFHYTMMRFADTISEKKLMEHIDHVNDDPDVDGFIVQLPLPPAISVERITEKIRPDKDVDGFTNRNFGSIMPATPFGVMELLRRYKIDTTGKNCCVVGASRLVGAPLSMMLAQGKATVTICHKYTRNLKSFTQQADLLMSAVGKPGLITGDMVKEGAVVIDIGTTMTEDKTIKGDVVFDEVSKKASYLTPVPGGVGPMTIASLLLNTLRAAELR........ 291
214 0.000e+00UniRef50_A0A1W9UJW3 Bifunctional protein FolD n=4 Tax=unclassified Anaerolineaceae TaxID=1324991 RepID=A0A1W9UJW3_9CHLR  ali  25  5.ILDGRAMAKEVREEVKAKHGFTPTIAVVRAGDDPASVSYAKMIKKSFEKAGMNFALHTLPDTASQDEVAGLVAELNADSNVHGIMVQEPLPKGIDDAAIKAVILPEKDADGVSPINKDYIVPATPLGGLEMLKRSGVEMDGKRAVVVGRSNIVGRPMAFLLMQHHATVSMCHSHTRPLGDATRQADILCVAVGVAELIKGDMIKPGATVIDFGFNRSE-GEWVGDVDFEEAKKVAGMITPVPGGTGSMTNVILMRNVLEAAKKQMK...... 292
215 0.000e+00UniRef50_A0A0J8RRB2 C-1-tetrahydrofolate synthase n=1 Tax=Coccidioides immitis H538.4 TaxID=396776 RepID=A0A0J8RRB2_COCIT  ali  30  6..IDGTAIAKGIRERLNAEIRKTPSLVIFQVGDRSDSSTYVRMKLKAAEEANILCRLAKFPEEITETELIQEITNANNDPSVHGILVQLPLPNHLSEHTVTSAVSNEKDVDGFGAINKPLFVPCTPQGIMELLRSSGVNPAGKNAVVLGRSDIVGSPVSYLLKNADATVTVCHSKTKNLPEVIKEADILVAAIGKAEFVKGEWLKPGAVVIDVGTNFVPDQRLVGDVEFGSAVEVASQITPVPGGVGPMTVAMLLQNVVNSANASFERLKDR. 298
216 0.000e+00UniRef50_I0GIU2 Bifunctional protein FolD n=3 Tax=Caldisericum exile TaxID=693075 RepID=I0GIU2_CALEA  ali  26  1MILDGKEIALRLQNEIKKKRLINPALAVIQVGEEKASESYAKNIRREGENLGIYVEHHKLASDISEEELLYNIKNLNLRKDIHGILIELPLPQQINKTKVIETISPEKDVDGFHPINFGKFQPATAQAILTAIKSV-VSIEGKHAVVIGRSNIVGKPTAALLLQENATVTICHSKTRNLKDITNLADILVVSVGKPKLIDRNYVKPGAVVIDAGINKI-DGKLVGDVDFDSVKAIASYITPVPGGIGVLTTLMLFRNTVKAANLQSKII.... 280
217 0.000e+00UniRef50_A0A1B6BIC8 Bifunctional protein FolD n=2 Tax=Fusibacter sp. 3D3 TaxID=1048380 RepID=A0A1B6BIC8_9FIRM  ali  30  1MIIDGREIAKKIKSDVKQRIESKPKVTAILLGDNPSSESYLKMLEKTCESVGFGCEICRLPNTTSEMQLLSLIDEKNKDEKTNGILVQMPLPAHISEEQVIMQIDPIKDIDGFHPMNAGRMRPCTPLAVITILDALDMELTGKNIVVIGRSNIVGKPLAIMLMQKNATVTVCHSRTKNLAKHTKSADIVILAVGKPGFLKQEMVTEETVVIDVGTNEV-DGKLVGDADFESLKDYVKMITPVPGGVGPVTNAVLLLNVLEHFK.......... 272
218 0.000e+00UniRef50_A0A1Q7RNA5 Bifunctional protein FolD n=2 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7RNA5_9BACT  ali  31  5.LLDGKAVSQAIRSELKRSAGVAPSLAAVLVGDDPASQVYVRNKIIACAEVGMRSVEVRLPPTATQDQLMARLRRLNEDPDVDGILVQLPLPRGLDRMAVILALDPAKDVDGLHPLNAGRPVPCTPAGIIELLERYRLPIAGQHAVIVGRSEIVGRPLGVLLLQRDATVTVCHSKTRELPVITRQADLLVAAIGRPAFLRAEHIREGATVIDVGVNRLGDYTLVGDVHPREAAERAAHLTPVPGGIGPLTIACLLRNTL.............. 298
219 0.000e+00UniRef50_A0A151A5Z9 Bifunctional protein FolD n=6 Tax=Bacteria TaxID=2 RepID=A0A151A5Z9_STASA  ali  27  30....................GFTPKLSVILVGNDGASQSYVNSKKKAAEKLGMISEIVHLDESTSEEEVLNELKRLNEDDSVSGILVQVPLPKQVSEQKIIESINPDKDVDGFHPTNIGKFVPCTPLGIMELLSHADIEIEGKEAVIIGRSHIVGQPVYKLLLQKNATVTIMHSKTKDMHSHLKNADIIVSAVGQPGIVSKDDVKEGAVVIDVGNTPDENGKLKGDVDYEDVKEIAGAITPVPGGVGPMTITMVLNNTLLAEKMRR....... 282
220 0.000e+00UniRef50_E2BT00 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial n=19 Tax=Hymenoptera TaxID=7399 RepID=E2BT00_HARSA  ali  30  32MIINGQKVAEEIKKELKNAGKKRPKLVAILVGNHPSSKAYVDRKMKAAKFVGIESYTVHLGENITQTDLLKEINSLNRDPTVDGILVQLPLPKSMNEKEVCQAIIPKKDVDGFHLENIGNIVPATALAVRELVIRSKIETFGKNAVVVGRSKHVGLPIALLLHSDDMTTTICHRHTPHLEKFTKLADLVIVAAGVPGLITKEMVKPGACIIDVGITRDGKYRLVGDVDYDSVKEVAGHITPVPGGVGPMTVAMLMRNTVAAAMGNQEDQIKQ. 331
221 0.000e+00UniRef50_A0A2C9L9U0 Uncharacterized protein n=1 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9L9U0_BIOGL  ali  30  5.IIDGKAIADKICTQIKELIGISPYIATILIGHNPASKIYVENKKKRAEQIGMKFKVFELPENTKEIEVYEIVKSLNNDKTINGILLQLPTPQHINKYTLLDAISPEKDIDGLSTQNKYSIAPCTPSGCMELIYSCEKNLSGKHAVVIGRSNLVGSPMAQMLLNKNCTVTIVHSKTKNIAKECCRADIIIAAAGVKNLVQPNFVKKDAIVIDVGINRNSTQKLTGDVNFNAVKHVAGAITPVPGGVGPMTVAMLMKNTFIASLRQN....... 282
222 0.000e+00UniRef50_A0A2K9A329 Bifunctional protein FolD n=8 Tax=Tenericutes TaxID=544448 RepID=A0A2K9A329_9BACT  ali  30  2ILLDGKKISKERNLKLKEDIKRPPKLAIILVGNNPASLSYVKGKNKACKLVGIENEMYHLDEMVSEKELKTLIEQLNHDKNVDGILLQLPIPKHLDEDMFIDLISREKDADGFHVVNQKTIYPATPKGIMTLLDTYAIDPKGMHAVIIGRSNIVGFPVARLLMDRGATITVCHSKTKDLGYHTRQADLIVAAVGKPKIVKKDMVKKDAIIIDVGVNRVE-GKLVGDVDFEALKDLVSFMTPVPGGVGPMTIHSLLENTFELYLDHVK...... 281
223 0.000e+00UniRef50_A0A1F9VR11 Bifunctional protein FolD n=2 Tax=Bacteria TaxID=2 RepID=A0A1F9VR11_9BACT  ali  32  5.ILDGKRVAEGILKGLRKKSGIEPTLAAIVVGRNPATSLYVKKKIEACEIVGTRALEFQLPSSTTQEELYEQLRALSRDPQVHGILLQLPLPANLSAEKALSGISPVKDVDGLTTYNLGRFYPCTALGILQLIAKTPLRLPGCRAAVIGRSSIVGMPVAHLLTCHNATVTLCHSKTKDLDQICRQSDLIVSAIGKPRFLKAGMIRRGAVVIDVGINYGKGGKLCGDVDFKEAAKKAGYLTPVPGGVGPMTVAMVLSNTILAAERQ........ 289
224 0.000e+00UniRef50_A0A0E9E537 Bifunctional protein FolD n=1 Tax=Chlamydia trachomatis TaxID=813 RepID=A0A0E9E537_CHLTH  ali  28  4.IISGKILASKIKQEVKQEIGIKPYFAIVQIGNNPASNTYVRNKMKDCDECGIESYLYHYGEGISQHALEVFLEELSISKDFHAVMLQLPIPNHLDTQEAINEIDFKKDVDGLTTINQNGFIPCTAAGCIEMIHATGIDIAGKNAVVIGRSNIVGKPVAMQLLKENATVTICHSHTVGLKEICQKADILIAAVGKKNFITVDMVKPGAIVIDVGINVQENGRLCGDVAFDEVKEVAGYITPVPGGVGLMTRAMLMKNILEATKCQ........ 277
225 0.000e+00UniRef50_A0A1J4WW51 Bifunctional protein FolD n=1 Tax=Candidatus Peregrinibacteria bacterium CG1_02_41_10 TaxID=1805322 RepID=A0A1J4WW51_9BACT  ali  36  3.LIEGNLLADKIQLQLKQEVKSKPGLAVILVGENPASLSYIRQKNKAADKIGINFQTIKLPAKTNTAKLIQTIQRLNRDKKIHGIIVQLPLPSQINETLILNAIDPSKDVDGFHPLNRGKVFPCTPKGILKLLEYSKCSPRGKHVVIVGRSNLVGKPLAVMLINQQATVTVCNSQTRRLKQITQTADIFISAMGQSHFFKPAWFKKGVVLIDVGFSKVKD-KICGDIQLEKFKNLARAGTPVPGGVGPLTVACLMENVIKAWGKNK....... 278
226 0.000e+00UniRef50_A0A024H284 Bifunctional protein FolD n=12 Tax=Actinobacteria TaxID=201174 RepID=A0A024H284_9MICC  ali  27  6.IIDGKGLAARLREELRSEVGRPVGLSTVLVGDDPASEVYVGSKRRLSQQAGIDDHHRRLPADATQEQVAAVLDELAADPAVAGILLQLPLPSHLDAKALIDRIPWEKDVDGLTTTNLDGLRPCTPLGVISLLEAEGVRLQGINAVVVGRSDLVGNPLSRLLLQKDATVTLAHSKTEDLAEVTSRAALVIAAAGVPGLLGKQHISPGAVVIDVGIHRTANG-LVGDVDFDAVSGVASRITPVPGGVGPMTIAELLRNTLKAAQLQN....... 283
227 0.000e+00UniRef50_A0A1X7NS43 Bifunctional protein FolD n=1 Tax=Carnobacterium iners TaxID=1073423 RepID=A0A1X7NS43_9LACT  ali  25  6IIMSSKNLVDKMNEEMQAMVGVIPGLAVLLIGESPASQIYVRNKQKRAQSLGFNSKVVRYPQEVSEQEILREIKQFNQDDTIHGILIQLPLPKQIDPEKVLNAVNPEKDVDGFHPVNMGKKIACTPYGIMKLLEYHQIDIAGKTAVVIGRSNIVGKPMAQLLLMNDATVTMSHSKTNHLAEIAKTADILVVAIGRGHFITKEFIKPGAVVIDVGMNHDVKGKLIGDVKADEVAEIAGYITPVPGGVGPMTITMLLYQTIISAQR......... 282
228 0.000e+00UniRef50_E4T3T1 Bifunctional protein FolD n=2 Tax=Bacteroidetes TaxID=976 RepID=E4T3T1_PALPW  ali  29  4.LIDGKAISEQIKLEIAKEVKKRPHLAVIIVGHDGGSESYVAGKVKDCGDCGFTSTLIRFEEDVTEETLLAEVDKLNKNQDVDGFIVQLPIPKHISEEKVIEAIDYRKDVDGFHPVNVGRMTPCTPAGIIELLKRYEIPTAGKNCVVIGRSNIVGKPIATLMMQKDATVTVCHSRTKNLKEICLQADIIIAALGQPEFLKGDMVKDGVTIIDVGTTRVPGFKLKGDVAFDEVAPKASFITPVPGGVGLMTRIALMQNTLLAAK.......... 289
229 0.000e+00UniRef50_A0A2N7PLR5 Bifunctional protein FolD n=34 Tax=cellular organisms TaxID=131567 RepID=A0A2N7PLR5_9BACT  ali  32  30...................YNIVPGLVTILVGENPASVSYVKGKQKTAQDLGFYSVEEWLSENTSEEELLKLIEKYNKDPRIHGILVQLPLPRHIDERKVIYAIDPKKDVDGFHPVNVGKMIPCTPYGILVILEKIGCQVEGAEVVVVGRSNLVGKPIANLLMQKNATVTICHTGTKNLNFHTKRADILIVAIGKPKFITADMVKEGAVVIDVGINRIGEGKLCGDVDFESVKEKAGAITPVPGGVGPMTITMLMKNTLESAKMWNRL..... 295
230 0.000e+00UniRef50_UPI000BE13D1F uncharacterized protein LOC111255109 n=1 Tax=Varroa destructor TaxID=109461 RepID=UPI000BE13D1F  ali  28  37.ILDGRSVAHVREDALRHHVKPTPSLAVLLVGHNPASEVYVRNKRMACARVGINFYLVRMNDSVRQEELIHEIHRLNEDPLIHGMIIQLPLPETMDANQVCSKVSPLKDVDCFTPENVGKLCPCAPKAVLTLLEEAKITLEGTNTLVIGRSKIVGQPLSIMLGHRGATVTVAHSLTPPLANLCRWADLIVSAAGVPHLVRGGMVRSGAVVIDVGINRLPKGGIVGDVHFEEVRQKASVLTPVPGGVGPLTVVSLLENTFLAYELQ........ 312
231 0.000e+00UniRef50_A0A1Y6CCL3 Bifunctional protein FolD n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y6CCL3_9PROT  ali  30  5.VIDGKAIAQNIRLSIKEQIKRAPCLAVILVGNDPASEVYVGHKKKACASIGIESRSLELPGDISQDELSKHVKALNDDPAIDGILLQLPLPKHLIPEIAIDLIDPDKDVDGLTAMNQPGLVSCTPAGVMELIRSTGVKVEGARAVVMGRSVLVGAPIATMLCNAGATVNCLNSKTVNGPELTRQADILVVATGVHRLVRGDHIKPGAVVIDVGMHR-HDGKLSGDVVYDEAKDVAGHITPVPGGVGPMTIAMLMRNCLTAYSKNN....... 282
232 0.000e+00UniRef50_A0A1J4UGS0 Bifunctional protein FolD n=1 Tax=Candidatus Micrarchaeota archaeon CG1_02_47_40 TaxID=1805247 RepID=A0A1J4UGS0_9ARCH  ali  30  4.LLEGKKAADKIIAEVSEAVKREKCLAVVLVGDDKASELYVKKKEEACLKAGIASIKRILPADTQEEKLLSMIRGLNENPLVGAILVQVPLPEHISEKRVMREISPQKDVDCFHPENTAKLYPCTPRGIMDLIGEYGISLEGKHVVIVGRSNAVGKPLALMMLAKNATVTVAHSKTKNLAEHTKMADILVCAVGKRNLITADMVKEGVIVIDAGIVR-EGGKVYGDVEFEGVSKKASRITPVPGGVGPMTIAGLMKNTLILYERKKKWI.... 280
233 0.000e+00UniRef50_A0A1J5F4D3 Bifunctional protein FolD n=2 Tax=unclassified Candidatus Gracilibacteria TaxID=1046947 RepID=A0A1J5F4D3_9BACT  ali  33  1MIIDGRSIANTILTNLREEIEKKPKLSVILVGESPASLSYIKQKERSALITGIDFKLHQLSVDTTEKELQDLIYEINKNPSIHGLIVQLPLPKHIDTNKIIEAIDPRKDVDGFTSQNIGELFSCTPKGIMRLLKESSVKIQGENIVMVGKSNIVGKPLSLLLMNAGGTVTVCNKDTKNVAEFTKNADIVIVAAGSPGLVKKDMVHPGATIIDVGFT-LMDGKIRGDADFEALEPTC-LITPVPGGVGPMTVTMLMENTYIATKSQ........ 273
234 0.000e+00UniRef50_A0A2D6FKN2 Bifunctional protein FolD n=1 Tax=Parcubacteria group bacterium TaxID=2026774 RepID=A0A2D6FKN2_9BACT  ali  33  9.ILDGKMVAERIKNVLRKENGVVPKLSIVLAGKDAPSKMFIRMKQKACQDIGIQSELLELPENILEEELIKIINKLNSSKEVTGFIIQLPMPSHINGSRIFETINPQKDVDCLNPVNFGKLVPCTPKGILRLLKEYKIEVSGKNVAVVNASNIIGKPLAMMLIKEGATVTLCHSRTRNLASQTRDADILITATGVPKLIKEDMVKEGSVVIDAGINYSE-GRPVGDVDFEKVRQKASFITPVPGGVGPMTVAMVLENILYLIKN......... 283
235 0.000e+00UniRef50_UPI00026573F2 uncharacterized protein LOC100898454 n=1 Tax=Galendromus occidentalis TaxID=34638 RepID=UPI00026573F2  ali  29  31.VLDGRALAEETLRHLVESVRRAPCLTVVLVGHQPASEVYVRNKQMACARVGIEFKLLRFPDSIEQHELIGEIHRLNQDSSVHGVLVQLPLPAALDANQVCSEVIPVKDVDCFTPENVGKLCPCAPQAVLTLLEEAGSQLEGANALMIGRSKVVGLPLSMMLGHRGATVATAHSLTQNLEELCRWADIVVCAAGVPHLVRGNMVKKDAVVIDVGINRLPMGGIVGDVYFDEVIQKASVITPVPGGVGPLTVVSLLENTMLAYEL......... 305
236 0.000e+00UniRef50_A0A1Z8RRR9 Bifunctional protein FolD n=1 Tax=Verrucomicrobia bacterium TMED40 TaxID=1986790 RepID=A0A1Z8RRR9_9BACT  ali  30  3.LIDGNEVASSVIQDLTDRVAVKPRVTFIRVGDDPASISYLRKKEKTAKQIGIRSELKVFPISISQNDLLEEIDKLNXNPDVHGILVQAPLPDQIDERLVFNQVHPNKDVDGFNATNLGKLCSCTPAGIVELVKRKEIETAGKHVVVLGRSLIVGKPAGMLFLRKNATVTFCHSRTSNLEDFIKRADLIIAAIGKPLFVQAEMVKEGAVVIDVGINRISDYRLVGDVDFEKVAPKTSFITPVPGGVGPMTVAMLMSNTVKAFEQS........ 288
237 0.000e+00UniRef50_UPI000BE17887 C-1-tetrahydrofolate synthase, cytoplasmic-like n=2 Tax=Bilateria TaxID=33213 RepID=UPI000BE17887  ali  31  5.ILSGTQTAKEVREALKAEVGFQPKLVIVQVGGREDSNVYIRQKLKAAAEVGVDSEHVKYPREVSEAELLSGVQKLNSDPRVHGIIIQLPLDSKIDGGKICNAVCPLKDVDGVHIENAGRFLPCTPRGCLELIQKTGIEISGKNAVVIGRSKIVGSPMACILRNVNATVTMCHSRTKDVPYWTRQADIIVAGVGVPRLVKRDWVKPGAIVIDCGINSIQDSRLVGDVDYDEVKEVASWITPVPGGVGPMTVAMLIKNTVISAKR......... 292
238 0.000e+00UniRef50_F4X334 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial n=14 Tax=Neoptera TaxID=33340 RepID=F4X334_ACREC :  ali  31  30.IIDGTKIAEQIQQELKNAGKKRPKLVAILVGNHPSSKAYVGRKMKAAKSIGIESYTIHLGENITQAELLKEIDSLNRDPSVDGVLVQLPLPKSINEREVCQAIIPKKDVDGFHLENNNSIVPATALAVKELILRSKIETFGKNAVVVGRSKHVGLPIALLLHAMDMTTTICHRYTMELEKYTKLADLIVVAAGVPGLITKEMIKPGACIIDVGITRVKKYRLVGDVDYD-VKDVAGYITPVPGGVGPMTVAMLMKNTVTAAMSNQEDTKQS. 327
239 0.000e+00UniRef50_A0A0P6AFD8 Uncharacterized protein n=3 Tax=Bilateria TaxID=33213 RepID=A0A0P6AFD8_9CRUS  ali  31  64.LLSGTEIAKNLRAGLNEQVGFTPGLNIIQVGAREDSNVYIRMKMKAAEEIGIKASHVVLPSSTTQAELIRVLNKINLDPSVHGIIVQMPLDSKIDSTLITDSVLPSKDVDGLNTINQGKFLPCTPNGCMELIKRTGIKIEGSQAVVIGRSKIVGTPAAELLKWHHATVTVCHSKTKNLPQLVANADILVVGIGQPNMVKGEWIKQGAVVIDCGINSISDYRLVGDVDFEGAKTKASWITPVPGGVGPMTVAMLMKNTVLAAEK......... 351
240 0.000e+00UniRef50_A0A2J6LVM3 Uncharacterized protein n=1 Tax=Lactuca sativa TaxID=4236 RepID=A0A2J6LVM3_LACSA  ali  30  63.IIDGKAIAQTIRSEIASEVGKAPGLAVVIVGHRKDSQSYVSMKRKACCEVGIKSIDIDLPEQVPEAELIAKVHELNADPNVHGILVQLPLPKHINEEKVLTEISIDKD------------------GCIELLKRSGISIKGKRAVVVGRSNIVGLPVSLLLLKEDATVTVVHSRTEDPESMIREADIVIAAAGQPMMIKGSWIKSGAAVIDVGTNAVDDYRLVGDVDFDQACKVAGWVTPVPGGVGPMTVAMLLKNTLDGAKR......... 320
241 0.000e+00UniRef50_A0A2D5WFT4 Bifunctional protein FolD n=23 Tax=cellular organisms TaxID=131567 RepID=A0A2D5WFT4_9BACT  ali  26  8...DGRAIAQXVHADTESRVDVEPGLRFVRVGDDPASQVYVGMKERTAARLGIRSETTXLPEDTPEAELLTLLEKLNHDDSVHGVLVQAPLPGHIDETKVFSTVSPAKDVDGFHPVNAGKLMPCTPGGVHELLIRSGVTIEGAEVVILGRGNIVGKPMAAILSQKNATVTLCHSRSRDVAGHCRRADLLVAAMGVAGFVKADMVKPGATVIDVGVNRVDDYRLVGDVDFAAVQPVAGKITPNPGGVGPMTIAMLMRNTVRAAGQQ........ 293
242 0.000e+00UniRef50_A0A1Q1FMI8 Bifunctional protein FolD n=31 Tax=cellular organisms TaxID=131567 RepID=A0A1Q1FMI8_9EURY  ali  29  4.IIDGNAVAQEIRDGLGDAIGTTPTLATVLMSDDPASETYVSMKQDDCEEVGIDARDVEIDPDAPADELFDTIDELNDDPEVNGILVQMPVPDHVDDREVLRRIDPLKDVDGFHPENNARYKPCTPHGIQKLLADAGVETEGADAVVVGRSDIVGKPMANLLLQKNATVTVCHSRTEDLAARTRAADIVIAAAGVPEMIDGDMLGEGATVIDVGINRVEGYELVGDVEYESAKEVAGAITPVPGGVGPMTRAMLLWNTVKAASLQ........ 289
243 0.000e+00UniRef50_A0A2D6AC12 Bifunctional protein FolD n=16 Tax=unclassified Euryarchaeota (miscellaneous) TaxID=115531 RepID=A0A2D6AC12_9EURY  ali  29  6..LDGKVCAAQVESELVERIGIKPHLAVVIVGDDPASHVYVGSKVRACERLGIKSTHIELPADATEQQVREIIESLNXQXDLHGXLVQSPLPSHMDEESLTDMIEPSKDVDGFHPQNLGRMLPCTPSGVMRMLSWAGVDTEGKTAVVLGRSRIVGMPQSLLLGAKGVTVTVVHSRTKDTQKICANADIVIAAVGIPEMVKPDWIKEGAVVVDVGINRVDDPRLAGDVHPD-VAQKAGWLSPVPGGVGPMTIAMLMENTVRAAELS........ 289
244 0.000e+00UniRef50_A0A2C6J1K6 Bifunctional protein FolD n=2 Tax=Parasaccharibacter apium TaxID=1510841 RepID=A0A2C6J1K6_9PROT  ali  27  18.LIDGKAMAAQMTTEIRQQVEQLPGLAVVLVGNDPASEVYVKNKAIQTHRAGMKSFMQMMPESTSQEELLALIKELNENPKVDGILVQLPLPPQIDAATVTNAIHPDKDVDGLGEVNNNGIVPCTPLGCLKLLQSVHKDMTGLHAVIIGASNLVGRPMAQLLLRENCTVTVAHIHTREIEKIAREADILVVATGKAGLVKGSWIKPGATVIDVGITRIGKSRLVGDVVFEDACQVAGHITPVPGGVGPMTIACLLHNTFLTASRHK....... 301
245 0.000e+00UniRef50_A0A161PU52 Bifunctional protein FolD n=4 Tax=Bdellovibrionales TaxID=213481 RepID=A0A161PU52_BDEBC  ali  31  2LILNGKEVAKEVRSKLSQKVGRAPHLSVVIVGDDDASHIYVRNKKKACESVGMTSQIIAMPAHTTQKELNAQIKALNNDASVDGILVQFPLPGHLSSDEVLRLVSPEKDSDGLTYASLGFFFPCTPEGVMTILKHYGISAEGLRAVVVGRSNIVGKPMAQLLTEANATVTVCHSKTKDLSTVVREADLVVVAAGKARLLGREDFKKDAIVIDVGMHHDPNGKLCGDVRTEELDGWVKAVTPVPGGVGPMTIATLLQNTCLLAEKR........ 281
246 0.000e+00UniRef50_A0A061AIM4 Bifunctional protein FolD n=26 Tax=cellular organisms TaxID=131567 RepID=A0A061AIM4_9MOLU  ali  30  1MILDGRKTADILNEQLKEKVNRKPRLEIILIGDDPASHTYVNSKLKQASQLGMEVHINHMDESVLEDEVIQLITSFNQNNQVDGILLQLPIPKHLNEVQLMELIDFNKDVDGFHTMNQEGIRPATPKGIMMLLDHYHIPIEGMHVVIIGRSQIVGMPLSKMFIDRNATVTVTHSKTKNLKELTKQADILVAALGKPKFVTKDMVKIGAVVIDVGINRV-DNKLVGDVDFDEVAPIASYITPVPKGVGPMTISALAHNLYELYLKGDKNT.... 278
247 0.000e+00UniRef50_F9CXV1 Bifunctional protein FolD n=24 Tax=Archaea TaxID=2157 RepID=F9CXV1_9ARCH  ali  32  4IKIDGKEIAQSVKDRVRKAVGINPCLATILVGDNPASATYVKNKHKACEEVGIITKDFKFASEISQLELNKKIDELNNDKTVHGILVQLPLPSQLDEFFTTSRISPLKDVDGLTPHNKAALVACTPLGVMEMFDYYKIDLDGKNVVLINRSNLVGKPLYHLLLARNATVITCHSKTKNIKELCQHADIIITAVGDRNTLTSDMIKKDAIVIDVAISRY-NEKLVGDADYEQIIQKASYATPVPGGVGPMTVAMLLKNTITAASLSSQIER... 287
248 0.000e+00UniRef50_A0A2E0F566 Bifunctional protein FolD n=9 Tax=cellular organisms TaxID=131567 RepID=A0A2E0F566_9FLAO  ali  29  2ILLDGKLTSEKIKQEIVKNGGRPPHLVAVLVGNDGASLTYVGSKVRSCEKIGFKSTLIHLDENISEEELISEIDKLNNNNKIDGYIVQLPLPKHINEEKILMMVNPDKDVDGFHPFNFGKMIPATPHGIIELIDRYGIETEGKNTVVIGRSNIVGRPMSILMSNKNSTVTLVHSRTPDIPSFTKKADIIIVALGIPNFLKSEMIKQDSVVIDVGITRVEDYRIVGDVDFESVKNKVSHITPVPGGVGPMTIAMLLKNTLKARKNN........ 290
249 0.000e+00UniRef50_A0A146YG20 C-1-tetrahydrofolate synthase, cytoplasmic n=4 Tax=Clupeocephala TaxID=186625 RepID=A0A146YG20_FUNHE  ali  25  94.IISGKEVSAQVRQRLKKDVNFRPGLVVLQVGDREDSNLYISMKVKAAAEIGINATHLRLPKTATEEEVLHSIREVNENSSVHGLIVQLPLDSKINTERVTNAVAPEKDVDGLTSINAGKFIPCTPNGCMELIRQTGISVAGKRAVVIGRSKIVGAPMHDLLLWNHATVTTCHSKTADLAAEVGKADILVVGMGKAEMVKGEWIKKGAVVIDCGINHVPDKRVVGDVHFASAKEQAGFITPVPGGVGPMTVAMLMGNTVLGAKRFLESHQPG. 389
250 0.000e+00UniRef50_A0A1F2XFU2 Bifunctional protein FolD n=2 Tax=root TaxID=1 RepID=A0A1F2XFU2_9PROT  ali  25  5.IIDGRKIAEEFKKELEKETGIKPGLAALRIGENSASQLYVQLKGAQARDLGFHFEEHIFPAWVSLDILESKIKELNQSPFIHGILIQLPLPSQLDKFYLLSLIDPLKDVDGLHPLNAGKMIPCTPLGCRALIKTVHESLEGLNVGVIGCSLLVGRPMALLMLQQNCTVWMAHSKTRDLPSLCEMADILIVAIGNPRFIQGDWIQKGATVIDVGINRLPTGNFVGDVDFMTARDRAGAITPVPGGVGPMTVAYLLHNTLEAAFRYAK...... 285
251 0.000e+00UniRef50_R7H2I9 Bifunctional protein FolD n=1 Tax=Ruminococcus sp. CAG:403 TaxID=1262958 RepID=R7H2I9_9FIRM  ali  29  5..IHGKIVAAKIRTTVKKEYGIHPGLAIIQVGNEPLSQLYTQIQLQACSDMDFHVSEYKMNNNATTEQLLDLIGVLNKDPKIHGILVQLPLPELIDTKRVLASIAVQKDVDAYSPYSMGCLMPCTPAGILELIESTGVSLSGKHCVIIGRSNLVGKPLAMLLLQKDATVTICHSKTDQLQSICKEADILISAVGKPHVVTADMVKEQAIVIDVGLYQMEDGSLCGDVEYDAVAERASYLTPVPGGVGPMTVAMLLKNTLSAARQSKEKK.... 285
252 0.000e+00UniRef50_P11586 C-1-tetrahydrofolate synthase, cytoplasmic n=332 Tax=Opisthokonta TaxID=33154 RepID=C1TC_HUMAN  ali  28  6.ILNGKEISAQIRARLKNQVGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHIKLPRTTTESEVMKYITSLNEDSTVHGFLVQLPLDSEINTEEVINAIAPEKDVDGLTSINNDCFIPCTPKGCLELIKETGVPIAGRHAVVVGRSKIVGAPMHDLLLWNNATVTTCHSKTAHLDEEVNKGDILVVATGQPEMVKGEWIKPGAIVIDCGINYVPDRKVVGDVAYDEAKERASFITPVPGGVGPMTVAMLMQSTVESAKRFLEKFKPG. 301
253 0.000e+00UniRef50_Q38XU9 Bifunctional protein FolD n=91 Tax=cellular organisms TaxID=131567 RepID=FOLD_LACSS  ali  29  3.LLDGRALANELVETLKEQ-GVTPKLVVIMVGDDPASAIYTQSKQKRATKIGMASELKRLSAETTEAELLALVKTLNDDRTVDGILVQLPLPKQINEDHVIQAIDAKKDVDGFSPVNIGQLWACTPNGIMRLLAAHKIDVAGKNVVIVGRSNIVGRPLAALMLNANATVTIAHSRTANLKALTKTADILVAAIGKPHFFGIDAVKEGAVVIDVGINRLEDGSVTGDVDFEALQTHVSAMTPVPRGVGPMTITMLMEQTIEIAKERVK...... 281
254 0.000e+00UniRef50_UPI000901179E C-1-tetrahydrofolate synthase, cytoplasmic-like isoform X1 n=2 Tax=Larimichthys crocea TaxID=215358 RepID=UPI000901179E  ali  27  154.VISGNKTSKLVRDRLKMEVGFRPGLVVLQVGDRDDSNLYISSKLKAAAEIGIDAKHVRLPNTATQDEVLRSIMSVNDDLSVHGLIVQLPLDSTIDTELITNAVSPQKDVDGLSCINNDCFIPCTPNGCMELIRQTGMSVVGKHAVVVGRSKIVGAPMHDLLLWNHATVTTCHSKTPDLPEQVGRADILVVGAGRAEMVRGEWVKEGAIVIDCGINHVPDKRVVGDVHYASANQRAGFITPVPGGVGPMTVAMLMENTVQSAQRFLQNQ.... 446
255 0.000e+00UniRef50_A0A2J6NQ95 Bifunctional protein FolD n=7 Tax=Bacteria TaxID=2 RepID=A0A2J6NQ95_9LACO  ali  26  4.VIDGRQLAAELNQETAKRVGVRPGIVVILVGDDPASIIYTRNKHRRATKMGIKSILKKFPADVDQATVMATIDRYNQDDSINAILVQEPLPPQLDGLAITNAIRPDKDVDGLHPANQPGHYPCTPRGIMTILHHHHVELSGKNATIVGRSILVGKPMVALLNNANMTTTLASRHTQDLGAATRQADVLVVAAGSPHLIKKEDVKPGAVVIDVGINRLPSGKLTGDVDFENVQDIASLITPVPGGVGPMTIASLMEQTVDMAEWRHHGQR... 287
256 0.000e+00UniRef50_A0A101GAN6 Bifunctional protein FolD n=11 Tax=root TaxID=1 RepID=A0A101GAN6_9BACT  ali  28  4.IIDGRKITKEISESLKAKVKLTPKLAVIIVGEDPASLFYVKMIARSCEKVSINFEKHSLPFKTTEEELLKLIDNLNEDKKVSGIIVQVPLPEHINQERIQEAVNPSKDVDCFNPINMGRFLPCTPYAVYELIKRENIVVEEKHTVIVGRSNIVGRPMALILLQKNATLTICHSRTNDLSYFTRQADILIAAVGKPEIIKRDMVKEGAVIIDVGTNEVE-GKLVGDVAYEEVLDKVSIITPVPGGIGPITNVMLMHNTLKAA........... 281
257 0.000e+00UniRef50_A0A254Q7G4 Bifunctional protein FolD n=1 Tax=Bdellovibrio sp. SKB1291214 TaxID=1732569 RepID=A0A254Q7G4_9PROT  ali  31  2LVLDGKEVSNQVRSSLKTKNGRAPHLAVIIVGEDAASQVYVRNKKASCEKIGMTSTIHALRTDTTQEELTEMIQTLNNDADVDGILVQFPLPKHLSSDEVLKTVSPLKDADGLTYSSLGYFFPCTPQGVMTILKHYNINVEGMNAVVVGRSNIVGKPMAMLLSEANATVTICHSKTKNLSQFTRNADLVVVAAGKAQLLGKEDFKKDAIVVDVGMHSGQGGKLCGDVRFSELQGWAKAATPVPGGVGPMTITTLLENTCLLAEKRANS..... 284
258 0.000e+00UniRef50_A0A0M0GPT2 Bifunctional protein FolD n=4 Tax=Bacillus TaxID=55087 RepID=A0A0M0GPT2_9BACI  ali  29  5.IIDGTKISNEWRSELKTRVGIIPGLAIILVGDNPASRSYVRLKEKACADVGIHSELHHY-QSADEEQLVTLIDQLNDSAHIHGILVQLPLPGHIDPANVLGAVSPTKDIDGLHPLSIGRFHPCAPLAIANMLQHENIPIAGRHVVIIGKSNLIGKPLGTMLLNRNATVTQCHSDTEDLFSLTRQADILISAAGKAGFIGREAIKSGALVIDAGMNRGEDGGVCGDVIADDVMGRAGLITPVPGGIGPMTITMMLHNTVKSAMR......... 279
259 0.000e+00UniRef50_B8C1N0 5, 10-methylenetetrahydrofolate dehydrogenase n=12 Tax=Eukaryota TaxID=2759 RepID=B8C1N0_THAPS  ali  28  6..IDGKSIAATIRSELAAELSSRPGLAVMLVGSRKDSQTYVRMKQKACSDCGMVSFLQEYPEEVEEEMLLKKIREWNEDEKVHGILVQLPLPEKISEERILKAVDPKKDVDGLHPANIPFHIPCTPQGCIELLDRIGVEIEGMNAVVIGRSNLVGLPVAMLLLHRNATVTIVHSRTKNIENVVKQADIVVAAVGRANMVPASWLKPGCTVIDVGINSVDGYRLVGDVNYAEAKEVCGWITPVPGGVGPLTIAMLLRNTLNSWKR......... 309
260 0.000e+00UniRef50_A0A150IP42 Bifunctional protein FolD n=5 Tax=Arc I group TaxID=1705400 RepID=A0A150IP42_9EURY  ali  28  4IILDGLALSQKIKNELSEKVGSCPKLATVLVGNDPASRVYVNLKKKDSEIIGIDYEEYYF-EDISEKDLLALIDELNSRKDINGILVQMPLPNHIDSNTILERIDPLKDVDGFSPINVGRIFPCTPKGVVKILDEYKIPIEGSDITIINRSNIIGKPLAAMLINMGATVTVVHSKTKNIKEKTRNADIVIVGVGKVDFLTADMIKEKAVVVDVGITRSEEG-IVGDVKFDEVSKKASYITPVPGGVGPMTRAMLLENLILCYQKQK....... 280
261 0.000e+00UniRef50_A0A2G9YKK9 Bifunctional protein FolD n=3 Tax=Bacteria TaxID=2 RepID=A0A2G9YKK9_9BACT  ali  31  4.LLEGKPIAEKIKEEIKQEVKHKPVLASIMAGENAGAVSYVKSQTKVAENLGIEYKLHNLAQDTSEATLIDFIKKLNADKSVNGIIIQMPLPAQIDYKKISQFILPEKDVEGMHPVNKAKILPCTAAAVMELLKETGVDLYGKEAVVVGHSEIVGKPLSLLLLDKFATVTVCHIGTSKLEEHVRTAEILIVAVGKAGLIKGDWVKEGAIVIDVGINRVAD-KIVGDLEFEPAEKHASWITPVPGGVGPLTVTMLMRNLVEAAKLQQ....... 280
262 0.000e+00UniRef50_A0A2D8VTD4 Bifunctional protein FolD n=28 Tax=Bacteria TaxID=2 RepID=A0A2D8VTD4_9BACT  ali  27  5.ILSGVDLSSEVYTKLRERISITPSLAVVLVGNNPASKVYVKNKIKRFKDLGLDSSTFTFPENVTEESLLKKISDLNNDNAFHGILVQLPLPGHIDSEKILTIIDPKKDVDGFHPVNLGNFIPCTPKGILRFFEXYKIELSGKHVVVVGRSNIVGRPISILLKGRYATTTICHSGSSDLFKFTQMADVIILALGKPHFLKSEHIKQGAIVIDVGINRIENGILVGDADIKSLEGKASAITPVPGGVGPMTIAMLVENTVEAAERXLNNES... 294
263 0.000e+00UniRef50_UPI0009EAB512 exodeoxyribonuclease VII large subunit n=1 Tax=Lactobacillus camelliae TaxID=381742 RepID=UPI0009EAB512  ali  27  11.................KKQGVTPGLAVVLVGNDPASAIYVRNKQRRADQLGIHSVMRTLPSTAMQAEVLAVVAELNADESIDGILVQLPLPKQVDPDAVVAAINPAKDVDGFHANNVGRLWASTPFGIMALLKHYGIEVAGKRAVIIGRSNIVGRPMAALLLNADATVTITHSKTRDLFAVTREADILVVAIGRAKFVTADAVKPGAVVIDVGMDRDAAGKLVGDVDFDSVSKVASAITPVPGGVGPMTIAALMIQTVELAKRHHHAE.... 269
264 0.000e+00UniRef50_A0A2D4C704 Bifunctional folD protein n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4C704_PYTIN  ali  28  19.IXDGKAVAKALRKAIKAEVGRPPALGLIMVGDRKDSALYVKTKRVACQRTGIRSENFLLPENVDERVVLEHVHALNADPTVDGILVQLPLPDHLDSQRVIDSILPSKDVDGLHPFNYPYLVPCTAKGIIELLDAENVELXGKTAVVLGRSNLVGNPISLLLQKRNATVIQCHSLTRDLPRYVRQADVVVAACGQPYLVRGDWLKPGATVIDVGINFVRDDKIVGDVAFAEASAVAGAVSPVPGGVGPMTIAMLLHNVVAAYKRH........ 311
265 0.000e+00UniRef50_A0A2E5TUJ1 Bifunctional protein FolD n=3 Tax=Verrucomicrobiales bacterium TaxID=2026801 RepID=A0A2E5TUJ1_9BACT  ali  28  6.LIDGRAIADQIHEETQRRVCGPPGLVFVRVGEDSASRVYVGMKQKACERLGIQSQIQVLPQETTEKELLGLIGELNVNPAIHGILIQAPLPEHINEANIFSAVSPNKDVDGFHPLNVGKFIPCTPAGVHEXLIQSRTPIDGANVVILGRGNIVGKPMAAILCQKNATVTLCHSRTSNIHEHCQRADILIAAIGAPQFVKEDMIKPGAVVIDVGVNRIPDSRLVGDVDFDAVQKKAGLITPNPGGVGPMTIAMLLRNTTQACAKAN....... 294
266 0.000e+00UniRef50_D0MY89 Bifunctional folD protein n=20 Tax=Oomycetes TaxID=4762 RepID=D0MY89_PHYIT  ali  25  5.LIDGKAIAKALRAALKAKHGRAPALGLIMVGDRKDSALYVRNKNTACRRTGIRSENFLFDEGVSQDTIVQKVEELNEDPSIDGILVQLPLPGQLNAQQIIDRIQHDKDVDGLHPFNYPYLIPCTAKGILALLDEQHTPLRGKTAVIIGRSNLVGNPVSMLLQKRDATTILCHSKTVDLPRYVRQADVVVAACGQPYLVRGEWLKPGATVVDVGINFVRDFKLVGDVNFHEACEVAGALTPVPGGVGPMTIAMLLHNVVEAFKRKMDNRKKGL 306
267 0.000e+00UniRef50_Q4Q9F9 Putative C-1-tetrahydrofolate synthase,cytoplasmic n=11 Tax=Trypanosomatidae TaxID=5654 RepID=Q4Q9F9_LEIMA  ali  28  6.IIDGKAIAAAIRSELKDKVGRVPGLASIIVGQRMDSKKYVQLKHKAAAEVGMASFNVELPEDISQEVLEVNVEKLNNDPNCHGIIVQLPLPKHLNENRAIEKIHPHKDADALLPVNEPPFTPCTAKGVIVLLKRCGIEMAGKRAVVLGRSNIVGAPVAALLMKENATVTIVHSGTEDMIDYLRTADIVIAAMGQPGYVKGEWIKEGAAVVDVGTTPVPDYRLVGDVCFEEAAARAAWISPVPGGVGPMTIAMLLENTLEAFK.......... 292
268 0.000e+00UniRef50_A0A1F3XSB3 Bifunctional protein FolD n=1 Tax=Bdellovibrionales bacterium RIFOXYD1_FULL_53_11 TaxID=1797403 RepID=A0A1F3XSB3_9PROT  ali  23  2LLLQSKPVVEEIKNRLGPRVGRPPRLAVVLVGDDPASVIYTRNKGRAAVELGMLHETIAFPASAAPAEVKAAVDRLNADPATHGILIQRPLPSQFNESEVLYWVTPEKDVDAFHPVNLPCFAPCTPAGVMEILKHYNISASGKIACVIGRSHIVGKPMTTMLLKENATVIQCHTRTRDLPSMTSQADLLVVAAGRRGLIGPEHIKEGAVVVDVGMHRKEDGRLCGDVRFEEVAALCSAITPVPGGVGPMTIAMLLENTVRAAER......... 279
269 0.000e+00UniRef50_G8NTC8 Bifunctional protein FolD n=18 Tax=root TaxID=1 RepID=G8NTC8_GRAMM  ali  29  10.VLDGVAIAGEIKAEVAREVGYTPGLAVVLVGDVPASQIYVRSKVKTCGELGIYSEMHTPDASVTTEELLELIASLNARDEIDGILIQLPLPKHVDTERLLEAVVPEKDVDGFHPINAGRLAPCTPAGIMEVLRRSDIPVSGKRAVVIGRSNIVGKPIAAMLINASATVTVCHSRTQGLAEIAREADILVAAIGRAGFVTPEMVKPGATLIDVGINRLTDSTVIGDIDPAAFA-LSGAYTPVPGGVGALTIAMLMSNTVKAAKMRR....... 311
270 0.000e+00UniRef50_A9A4N5 Bifunctional protein FolD n=50 Tax=cellular organisms TaxID=131567 RepID=FOLD_NITMS  ali  33  6..IDGKVISQSVKDRVKKAVGINPCLATVLVGDNPASATYVRNKHRACEEVGITTKDHKLDASTTQAQLNEIIENLNNDNSVHGILVQLPLPEQLDEFTTTSRISPLKDVDGLTPHNKAALVACTPSGVMEMFDYHGIELEGKNIVLINRSNLVGKPLYHLLLDKNATVITCHSRTKNLVELCQSADIIITAVGDRNTLTSDMIKEGAIVIDVAISRFQE-KLVGDADYEDIIQKASFATPVPGGVGPMTVAMLLKNTITAASLSSQIGK... 287
271 0.000e+00UniRef50_P13995 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial n=162 Tax=Euteleostomi TaxID=117571 RepID=MTDC_HUM  ali  30  39.VISGRKLAQQIKQEVRQEVNKRPHLSVILVGENPASHSYVLNKTRAAAVVGINSETIMKPASISEEELLNLINKLNNDDNVDGLLVQLPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDDATVTISHRYTPQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVHDPKLVGDVDFEGVRQKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRLEEREV 339
272 0.000e+00UniRef50_A0A1U8P547 bifunctional protein FolD 1, mitochondrial-like isoform X1 n=4 Tax=Pentapetalae TaxID=1437201 RepID=A0A1U8P547_GOSHI  ali  26  76.IINGKSIAEEITSRVKESIGKVPGLAVILVGQRRDSLTYVRNKIKACEEAGIKSVVAEFPDSCAEEDIMTSLSKFNEDPSVHGILVQLPLPEHLDEEKILNLVSLEKDVDGFHPINMGNFLPSTPKGCLELLLRSGVEIVGKKAVVIGRSNIVGLPIALLLQRHHATVTIVHACTKNPERITCEADIVVTAAGVPSLIRSSWLKPGAVVIDVGTCPVEDYRLVGDVCYEEALSIASAVTPVPGGVGPMTIAMLLCNTLDSAKW......... 385
273 0.000e+00UniRef50_A0A251SAB1 Putative tetrahydrofolate dehydrogenase/cyclohydrolase n=4 Tax=Pentapetalae TaxID=1437201 RepID=A0A251SAB1_HELAN  ali  29  55..IDGKSIANDIKATLATEVKKAPGLGVILVGERKDSRSFVRIKKKACEEVGITSVVVNLPENCTETEVLDAVSALNNQESVHGILVQLPLPCHLSEQKIINAVNVEKDVDGFHPVNEPLFIPCASRGCIELLHRYGVEIIGRKAVVIGRSNITGLPTSLLLQRHHATVSVVHKFTKNPEEITREADILVSDVGVPNLVRGHWLKPGVVVIDMGSTLVADSKVTGDVCYEEAIVKASLLTPVPGGVGPVTISMLLCNTVEAAKRSYQWTENS. 343
274 0.000e+00UniRef50_A0A0R1YHY0 Bifunctional protein FolD n=18 Tax=root TaxID=1 RepID=A0A0R1YHY0_9LACO  ali  30  29....................GITPCLAVVLVGDDPASQVYIRNKKRAAQKVGVKTLDNVLPASTSENEIIDLIYSLNNDPQVHGILVQLPLPQGINEDRVIQAILPSKDVDGFHPQNIGKLFPCTPNGIMHLLAKYNIQLDGKRVVIVGRSKIVGMPMIAMMLNANATVTVTHSHTHNLKEITREADVVIVAVGKAEFLTGDYFKPNAVVIDVGMNRNEAGKLVGDVEAASTADKVAFMTPVPGGVGPMTIAMLLKQTIEIAERS........ 280
275 0.000e+00UniRef50_A0A1G1MD26 Bifunctional protein FolD n=2 Tax=unclassified Candidatus Omnitrophica TaxID=1047005 RepID=A0A1G1MD26_9BACT  ali  31  4.LLEGKPVADKIKEELKRQIGKKPVLASIQAGDNAGSAAYVKSQQKTAQNLGIEYQLHNLNQGINEAELIKFIQKLNSDNTINGIIIQMPLPSQIDYKKISQFIAPEKDAEGMHPANIGKIVPCTPAAVMELIKETGVDLYGKEVVVVGHSEIVGKPLSLLLLEKFATVTVCHIGTSKLEEHVRKAEILIVAVGKASLIKGDWIKEGAIVIDVGINRLGD-KIVGDVEFEAAEKRAAWITPVPGGVGPLTVTMLMRNLVEAAKLQ........ 279
276 0.000e+00UniRef50_A0A2M7H5B2 Bifunctional protein FolD n=1 Tax=Candidatus Kerfeldbacteria bacterium CG15_BIG_FIL_POST_REV_8_21_14_020_45_12 TaxID=2014247 RepI  ali  29  8.VLSGKGLAAKIRTDLKRKISIRPGLAVILVGHDPASQVYVKFKSEASEEVGMYLETIELPEDVPQQRLLKIIQKLNRSKKIHGILVQLPLPDHLEPFDVMAAIDPMKDVDGFHPENRPHMVPATTLGIWQLIRSVQMDVAGKHVVIVGKSNIVGKPTATLLLNKGATVTVCSRSTADLSKQTLQADILISATGVPNLITADMVKPNAMVIDAGISK-RQGRVVGDVDYDAVAEVAKYISPVPGGVGPMTVAALLQNTWRAMR.......... 278
277 0.000e+00UniRef50_Q9H903 Probable bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase 2 n=349 Tax=Bilateria TaxID=33213 RepID=MTD2L_HUMAN  ali  29  52IIISGTEMAKHIQKEIQRGVNRRPHLSIILVGDNPASHTYVRNKIRAASAVGICSELILKPKDVSQEELLDVTDQLNMDPRVSGILVQLPLPDHVDERTICNGIAPEKDVDGFHIINIGRLCPATASAVWEIIKRTGIQTFGKNVVVAGRSKNVGMPIAMLLHTDDATVTIAHRYTPQLKIHTQLADIIIVAAGIPKLITSDMVKEGAAVIDVGINYVHDPKLVGDVDFEAVKKKAGFITPVPGGVGPMTVAMLLKNTLLAAKK......... 344
278 0.000e+00UniRef50_Q9Z8K3 Bifunctional protein FolD n=49 Tax=Chlamydia TaxID=810 RepID=FOLD_CHLPN  ali  28  1MLLRGIPAAEKILQRLKEEISQSPGLAVVLIGNDPASEVYVGMKVKKATEIGIISKAHKLPSDSTLSSVLKLIERLNQDPSIHGILVQLPLPKHLDSEVILQAISPDKDVDGLHPVNMGKLLPCTPAGIIELLNYYEIPLRGRHAAIVGRSNIVGKPLAALMMQKHCTVTVLHSQSENLPEILKTADIIIAALGAPLFIKETMVAPHAVIVDVGTTRVPGYTLLGDVDFNNVVTKCAAITPVPGGVGPMTVAMLMSNTWRCYQN......... 284
279 0.000e+00UniRef50_E1BNJ2 Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2 like n=30 Tax=Amniota TaxID=32524 RepID=E1BNJ2_BOVIN  ali  29  52IIISGTEMAKQIQKEIQHGVNRRPHLSIILVGDNPASHTYVRRKIKAAAAVGICSEIILKPKDVSQEELLDITDQLNADPRVSGILVQLPLPDHMDERTVCNGIAPEKDVDGFHIINIGRLCPATASAVWEIIRRTGIETFGKNVVVAGRSKNVGMPIAMLLHTDDATVTIAHRYTPQLKIHTLLADVIIVAAGIPKLITSDMVKEGAAVIDVGINYVYDPKLVGDVDFEAVKKKASFITPVPGGVGPMTVAMLLKNTLLAAKK......... 344
280 0.000e+00UniRef50_I3ZDI8 Bifunctional protein FolD n=131 Tax=root TaxID=1 RepID=I3ZDI8_TERRK  ali  27  6.VLDGAATAAEIRAELKQQVGFTPGLAVVLIGEDPASAIYVRSKVKACEELGIRSIELRPDASLTTEDLLTIVADLNSRDDVDGILVQLPLPKQVDTKRVLEAVDPDKDVDGFHPVNVGKLQPCTPTGVLEILKRSGIPTAGAEAVVVGRSDIVGKPVAAMLLQANATLTVCHGRTRNLAEHTRRADILVVAIGKAGFITADMVKPGAVLVDVGINRLTDSVVIGDIDPAAFA-VSSAYTPVPGGVGALTIAMLMHNTVKAAKLRR....... 301
281 0.000e+00UniRef50_UPI0007E7D9A4 bifunctional protein FolD-like n=1 Tax=Drosophila miranda TaxID=7229 RepID=UPI0007E7D9A4  ali  27  13..INGKAEAKVMTNTIAREVGITPGLAVILVGDDPASAIYVRSKVRKTEAIGMHSVCHCLPADTTQQALLALIHALNDDRSIHGILVQLPLPPHIQRDAVLDAIDPAKDVDGFHVLNVGKMIPCTPMGCMILLHRFLPSLSGLHAVVIGCSNIVGRPMARLLLNEGCTVVITHLKTRDVAAEARQADILIVAAGHAGLVRGDWVKPGAVVIDVGINRIDGPTIVGDVAFDEVADRARAITPVPGGVGPMTIACLLQNTLRAATMSH....... 293
282 0.000e+00UniRef50_A0A1F4DHQ5 Bifunctional protein FolD n=1 Tax=Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_62_58 TaxID=1797497 RepID=A0A1F4DHQ5_9PROT  ali  29  5.LLDGAAVAREVYSQLGQRVGVRPGLAAIQVGNHAASTIYIRRKVKACAETGVYSEIHQLESDCPESTLLATIDKLNHHRGIHGILLQLPLPQHFDAGRIMQSIAVEKDVDGFNWQNRPRFTPCTPSGIIALLERYEVRIEGRNAVVVGRSTEVGKPMALMLIARSATVSVCNSKTRDLRQFTSIADILVVAAGRPLLVTADMIKPGAAVVDVGINRLPDGRVCGDVDFAGASQVASLLSPVPGGVGPMTVAMVIANTVSAAEHHAQA..... 284
283 0.000e+00UniRef50_UPI000B8409BF bifunctional 5,10-methylenetetrahydrofolate dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase n=1 Tax=Atribacteria ba  ali  28  5.IIDGRKIAKEINESLKKKNKLTPKLAVIIVGEDPASLFYVKMIARSCERASIDFEKYTLSGKTSEKELLKLIDNLNEDKKVSGIIVQVPLPGHINQERIQEAVNPSKDVDCFNPINMGRFLPCTPYAVYELMKRENIVVEGKHTIIVGRSNIVGRPMALILLQKNATLTVCHSRTNDLSHFTRQADILIAAVGKAEIIKPDMIKEGAVIIDVGTNEVE-GKLVGDVAYEEVLDKVSVITPVPGGIGPITNVMLMQNTLKAAEK......... 284
284 0.000e+00UniRef50_V5GXR2 C-1-tetrahydrofolate synthase, cytoplasmic n=10 Tax=Opisthokonta TaxID=33154 RepID=V5GXR2_ANOGL  ali  31  20.ILSGTAIAREIQEQLRNDVNFQPGLAIVQVGGREDSNVYIRMKIKAASEIGIKATHIRLPRSVTETELLNKIHRLNDDPDVHGIIVQMPLDSEIDSHLITDLVSPEKDVDGLNTINESRFLPCTPNGVIELIKRSGITLEGAQAVVLGRSKIVGTPAAELLKWHHATVTVCHSKTKDLKEQCQKADILVVAIGKAKLVKGSWVKPGAVVIDCGINAVPDSSLVGDVDYDEVSKVASHITPVPGGVGPMTVTMLMKNTVQSAQK......... 306
285 0.000e+00UniRef50_P56467 Bifunctional protein FolD n=867 Tax=cellular organisms TaxID=131567 RepID=FOLD_HELPY  ali  30  8.LLDGQALADNIEKDLKHKIQIRPKLAVILVGKDPASITYVNMKIKACERVGMDFDLKTLQENITEAKLLSLIKDYNTDQNISGVLVQLPLPRHIDTKMILEAIDPNKDVDGFHPLNIGKLCPATPMGVMRLLEHYHIEIKGKDVAIIGASNIIGKPLSMLMLNAGASVSVCHILTKDISFYTQNADIVCVGVGKPDLIKASMLKKGAVVVDIGINHLNDGRIVGDVDFNNVQKVAGFITPVPKGVGPMTIVSLLENTLIAFEKQQR...... 287
286 0.000e+00UniRef50_UPI000DBE8637 bifunctional 5,10-methylenetetrahydrofolate dehydrogenase/5,10-methenyltetrahydrofolate cyclohydrolase n=1 Tax=Bradymonadales  ali  29  21.VLDGRAVADALLEQVQARRGITPTLAVVRAGDDMASDIYVRHKERACARVGIAFRHEHLPATVREDEIVEVLSRLNADPNVHGILLQLPLPGEMNGADILTAIDPQKDVDGFHPLNLGGLMPCTPRGVMTLLSSAGVELTGKRAVVIGRSVIVGRPMSLMLARANATVTLCHRHTRNLDRIVSEAEILVVATGVAGLVKGSWVREGAVVIDVGISRVE-GKVRGDVEFEAARKQAALITPVPRGVGPMTVATLMENVVRAVCVRH....... 297
287 0.000e+00UniRef50_A0A2H6FCG1 Bifunctional protein FolD n=204 Tax=root TaxID=1 RepID=A0A2H6FCG1_9BACT  ali  28  5.IISGKEIAAQIREELRKEVGVVPGLVTILVGKNPASVSYVTGKQKTAHELGFNSIQDDQPEDISEEDLLSIVDKYNKDPKIHGVLVQLPLPGHINEKKILNAITPDKDVDCFHPVNVGRMMPCTPAGIQELIVRSGYETSGAEVVVVGRSNIVGKPIANIMLQKNATVTVVHTGTKNLEEHCKRADILIVAAGVPGLVKPEWIKPGACVIDVGVNRVGEKKLKGDVDFDAAKEIAGAITPVPGGVGPMTITMLMKNTVKAMK.......... 296
288 0.000e+00UniRef50_D0GMJ6 Bifunctional protein FolD n=4 Tax=Bacteria TaxID=2 RepID=D0GMJ6_9FUSO  ali  33  1MIIDGKDISQKILKYIEKEHKRTAGLAVIMAGNNPASEVYVKNKIKACESVKFYSEIVRLDENVTEADFIKEIERFNKNDKIDGILIQLPLPEHINELKVINAVSPEKDVDGFHVVNIGKMWPCTPYGIIQLLEEYDIDPAGKDVVIVGRSNIVGKPLALMLIEKSATVQVCNTKTKNIREKLKNADIVIAAAGVPNLISAEDIKEGAVVIDVGINRV-NGKLCGDVNYEEVSEKAGYITPVPGGVGPMTIASLIKNTFKSYINKVE...... 282
289 0.000e+00UniRef50_A0A094E621 Eukaryotic translation initiation factor 3 subunit I n=8 Tax=leotiomyceta TaxID=716546 RepID=A0A094E621_9PEZI  ali  32  655IKIDGNAIAKEIREKLHAQIRFHPSLKIIQVGDRSDSSTYVKMKLKAAEEAGISCELIHFPESTTEGELIDQIDVLNNDPTVHGILVQLPVPKHISEYSVTSSVANEKDVDGFGAINIPLFTPCTPKGVMKLLESTGVDLKGKKAVVLGRSDIVGSPVSYLLKDADATVTVCHSATQNIESYVKEADVLVSAIGKAHFVKGEWIKPGAIVIDVGTNFIPDQRLVGDVDYSAAVEVASHITPVPGGVGPMTVAMLLQNVVDAA........... 939
290 0.000e+00UniRef50_A0A0R1HJ59 Bifunctional protein FolD n=20 Tax=Bacteria TaxID=2 RepID=A0A0R1HJ59_9LACO  ali  28  4.IIDGKELAQTTTDNLKKKKGVIPALVVIVVGEDQASQIYVKNKHRVAESIGIKSIITKLPSSTSESDLLALISEYNENPDVHGILVQLPLPKQINEKKITESIRPEKDVDGFHPVNIGRAIPCTPMGIMRMFTAYDIDVEGKNAVVVGRSNIVGKPMAALLLNANATVTVTHSHTQNLSEITKQADILVVAIGQANFIKKADVKQGAVVIDVGMNRLDSGKLAGDVD-KDVSDVAGYLTPVPKGVGPMTIAMLMEQTIELTKRS........ 279
291 0.000e+00UniRef50_A0A151BC95 Bifunctional protein FolD n=1 Tax=Candidatus Bathyarchaeota archaeon B24 TaxID=1779368 RepID=A0A151BC95_9ARCH  ali  31  5MIMDGRTLAKSFAEKFKTEVGVKPCLSVVMVGENPASKVFVRNKVRFCNRVGVKVSVLTKPASISESELLELIDLLNEDENVHGILVQLPLPDHIDPFKVMARIDPVKDVDGLTPVNLGRLAPCGAKAVMRLLERYGVDLEGQDVCIISNSVLVGKPLSVMMTNRFATVSLCHVKTRVLDEYTSRADVLISATGVPHLVKADMVKRGAVVVDVGISRLK-GRIVGDVDFENVKELVSMITPVPGGVGPMTVAMVVENLLNALRLQR....... 282
292 0.000e+00UniRef50_R7HJW9 Bifunctional protein FolD n=2 Tax=Firmicutes TaxID=1239 RepID=R7HJW9_9FIRM  ali  32  2ILLDGKEVKLKVLEELKEKLDRNLGLVVIQVGNDPASNVYVRQKNKMAENLGYNFNHIKLDSNITEEELLSIINELNNNDLVDGILVQMPIPKSLDTKRIQNAIMPDKDVDGLTDINMGRLVPCTPIGIIDLLDYYNIPIEGKNVVIIGRSDLVGKPMATLMTNRNATVTLCHSKTSNLEFYTKSADILVAAIGIPKYIKENMVKEGAVIIDVGINRMEDNSLCGDVDFDNVKDKVSYITPVPGGVGQMTVAELAVNTYKAHILRKN...... 278
293 0.000e+00UniRef50_A0A0L8HZF0 Uncharacterized protein n=7 Tax=Bilateria TaxID=33213 RepID=A0A0L8HZF0_OCTBM  ali  30  67.LLSGKDVSAEIRNKLKEDIKFLPCLVIVQVGDREDSNVYIRMKVKNSADIGMKAEHIKLPKSSTQADVLATVNRLNEDLTVHGIIVQLPMSEHIDSHLVTNSIIPSKDVDGLHSENSNCIIPCTPRGCLELIKKSGVPVSGKTAVVLGRSKIVGAPMSNLLLWNHATVTVCHSKTVDLPAVVRTADILVVAIGRPEFVKSDWIKPGAVVVDCGINSIPDKRLVGDVDFGGAKEVASWITPVPGGVGPMTVAMLLQNTVESAKR......... 354
294 0.000e+00UniRef50_Q8RAD0 Bifunctional protein FolD n=31 Tax=Thermoanaerobacterales TaxID=68295 RepID=FOLD_CALS4  ali  30  4MIIDGKEISNRIKEEVKREIGYKPRLAILMAGDDESSKVYANSKVKACESVGIEAKVYYFSEK-EEDKFFDTLEKLNEDKDTHGIMIEMPLPKGFDVDKVYDTINPYKDVDCISNYNMGRFVPCTPKAIIHILENTGVDLEGKHAVVIGRSNILGKPVAKLLLDKNCTVTVCHSKTKDLAYHTKQADVLVVAAGKMNLVRGDMVKEGVVLIDAGIN-VHEGKIYGDADFESIKDKASYVTPVPGGVGPVTTAMILKNTLEAFKYAVKSL.... 280
295 0.000e+00UniRef50_A0A1H5V519 Bifunctional protein FolD n=6 Tax=Clostridiaceae TaxID=31979 RepID=A0A1H5V519_9CLOT  ali  30  5.VINCKEIAKKIREELSKKNGQKICLATIIVGKDPASLSYVKNQEKVCIETGLKFITYELSEDTSEEDLIELIKKLNDDSSVHGILVQVPLPKHIDENKIAGIIDVNKDVDCFNPINVGKLYPCTPKGILRILKEMNIEIRGKKVAVVGRSNIVGKPIAALMLHNDATVTICHSKTENLKEILLNSDIIISAVGKPKLITEDMIKEGAVIVDAGTTLV-DGKLVGDVDFENVLNKASMITPVPGGVGSMTTTMLIENVLEAA........... 278
296 0.000e+00UniRef50_UPI000B965E85 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase n=1 Tax=Propionibacteriaceae bact  ali  32  168..LDGKACAAEIKAELTKRVGVTPGLGTVLVGDDPGSQIYVNGKHRDCAQVGIASIRVDLPAETSQERLREEIARLNADATCTGYIVQLPLPRQLDEHEALGLIDPAKDVDGLTPTNLGKLVPCTPRGIVELLRRSGVELAGAEVCIVGRGTTVGRPLGLLLTRRNSTVTLCHTGTKDLAAHTRAADIVIGAAGVPGLITAEMIKPGAALVDVGITRNDEGKQVGDFAPE-VWEVAGAVTPNPGGVGPMTRAMLLENVVEAAERQ........ 444
297 0.000e+00UniRef50_UPI0005F4F3A9 LOW QUALITY PROTEIN: uncharacterized protein LOC105597730 n=1 Tax=Cercocebus atys TaxID=9531 RepID=UPI0005F4F3A9  ali  29  304.VISGRKLAQQFKQEVRQEVNKWPHLSVILVGENSASHSYVLNKTRAAADMGMNSETIVKPAXISEEELLNVIGKLNNDDNVDDLLVQLPLPEHIDERRICNAVSLDKDVDGFHVINVGRMCPATPWGVWELIKRTGIPTLGKNVVVAGRSKNVGMPFVMLLHTDDATVTISHRYTPQLKKHTIFADIVISAAGIPNLITADMIKEGAAVIDVGVNRVHDPKLIGDVDFEGVGEKAGYITPVPGCVGPMTVAMLMKNTIIAAKQ......... 595
298 0.000e+00UniRef50_E0VDT6 Methylenetetrahydrofolate dehydrogenase, putative n=33 Tax=Neoptera TaxID=33340 RepID=E0VDT6_PEDHC  ali  30  5.IIDGKKIANEIQQELKIETNRRPSLVAILVGEDPASSTYVANKMKAAHNVGINSRTEKFPHTLLESELLKKIDELNNDDNIDGILIQLPLPQHMNERLICSAVTHEKDVDGFHVMNQQTLAPCTPAGVMELLKRSGIKTFGKNAVVCGRSKNVGMPIAMMLHSMDCTTTICHRYTPELVRFAKTADIIITATGVPGLITKDMVKPGVCVIDVGISRITDPKLVGDVDFDGVKELAGHITPVPGGVGPMTVTMLMKNTILAAQYRAKKKST.. 303
299 0.000e+00UniRef50_R7M6S4 Bifunctional protein FolD n=6 Tax=Terrabacteria group TaxID=1783272 RepID=R7M6S4_9CLOT  ali  30  6IIMDGRKIKENILNNLKIEIKLKPSLTVIQVGNDEASNIYVRQKKNMASFLGYTFNHISLEENITEEELLDLIDKLNKDKTINGILVQMPLPKHIDEARIQNKINEYKDVDGLTDINSGRLFPCTPYGIMELLDYYNINVEGKNVTIIGKSNLVGKPLSMLMLNKGATVTICHSKTKNISELTKNADILVVAVGKRNLVNANMVKDNAIVIDVGINRDENNHMCGDVDFENVKNKTSYITPVPYGVGQLTVAMLGVNVYKAYMMQNN...... 282
300 0.000e+00UniRef50_A0A2H5W8B8 Bifunctional protein FolD n=1 Tax=bacterium HR11 TaxID=2035406 RepID=A0A2H5W8B8_9BACT  ali  32  5..LDGKAVAQKIYDELLRRRGIVPCLGAILVGDDPSSRLYVQNKQKACEQMGLRSIVQTFPADVSETQLLDHIERWNQDPDIHGILVQLPLPAHLSKARILEAIDPRKDVDGFHPENRARLVPCTPAGILRMLDAYGVPIEGRHCVVIGRSDVVGKPIATLLLHRNATVTICHSRTTDLPELVRRADIVVAAMGRAAYIQPDWVNPEATLIDVGINRQQGRVLLGDIHP-LAYERARAYTPVPGGVGPLTVAMLVHNTVTAAELQAQ...... 303
301 0.000e+00UniRef50_A0A0A0DXI9 Bifunctional protein FolD n=9 Tax=root TaxID=1 RepID=A0A0A0DXI9_9SPIO  ali  27  5.IIDGKAIAAGIRGEIARTVGTRPGLGVVLVGQNPASISYVNSKENDCDEVGIYSHDIRLPANTSESELLHIIDNLNHNPRIHGILVQLPLPKDMNEARIIAAILPEKDVDGFHPANLDCFIPCTPYGIVKILEIENIPIEGAEIVLVGRSRIVGAPLANLLFRKNATLTVCHSYTRNIEKVLSRGDIIIVATGNPGLIKGNMIRNGTVVIDVGINRVEDYKLVGDVDFDSVKQVAKAITPVPGGVGPVTRAMLLWNTAVAAQRFH....... 292
302 0.000e+00UniRef50_A0A1S3BZN7 bifunctional protein FolD 2 isoform X2 n=6 Tax=Viridiplantae TaxID=33090 RepID=A0A1S3BZN7_CUCME  ali  28  15.....................KVPGLAVVIVGNRKDSLTYVNMKRKACLEVGIKSFEIDLPEQVSEAELISKVHELNANPEVHGILVQLPLPNHINEEKVLSEISIEKDVDGFHPLNIGKFLPCTPKGCLELLSRSGISIRGKKAVVMGRSNIVGLPVSLLLLKADATVTIVHSRSVDPESVIREADIIIAAAGQAQMIKGSWIKPGAAVIDVGTNAVDDYRLVGDVDFQEACKVAGWITPVPGGVGPMTVAMLLRNTLDGAKR......... 272
303 0.000e+00UniRef50_A0M554 Bifunctional protein FolD n=93 Tax=Bacteria TaxID=2 RepID=FOLD_GRAFK  ali  28  3.ILDGKKISNDIKDEIKKRGEKVPHLAAIIVGKDGASMTYVNSKVKACERVGFESSLFRLPHTVSELELLDKIEELNENDDIDGFIVQLPLPPQINTQKVLNAVDPDKDVDGFHPTNFGKMIPATPFGILELLERYDIPTKGKHTVVIGRSYIVGRPMSILMGRSNSTVTLTHEFTKNITQVTSQADIIIIAVGIPDFLKGEMIKDDAVIIDVGITRVPDYVIKGDVDFENVSKRASFITPVPGGVGPMTVSMLLKNTLLARERHHK...... 292
304 0.000e+00UniRef50_R7G255 Bifunctional protein FolD n=2 Tax=Bacteria TaxID=2 RepID=R7G255_9PROT  ali  28  3.VIDGKLVSSVLREELRKKYGKTFKLTVIIAGNDPASEIYVRNKEKACLSVGIISDTIRLPENVTNEELQKVVSLAANNETVDGILVQLPLPNGLDERAALSLIPPEKDVDGFSDVNIGRSRACTPAGMMKLLDYYGVVLEGKHAVVVGRSNIVGKPMALMLLERNCTVTVCHSKTKDLQKYTKEADILVCAAGRKHLITADMVKEGAVVLDAGINRGEDKKIYGDVDFDAVYDKVNLITPVPGGVGPMTITMLLLNTYEAGLRKIKN..... 284
305 0.000e+00UniRef50_Q2LUP9 Bifunctional protein FolD n=120 Tax=root TaxID=1 RepID=FOLD_SYNAS  ali  30  4IIIRGSDIAQEIREDLKKEYGVVPGLVTILVGQDPASMSYVTAKQKTACKLGFYSLQDSQPGHVSESLLLDRIARYNKDPRIHGILVQLPLPPHIDEQKILYAIDPGKDVDGFHPYNVGKLMPCTPAGIQQLLIRSGIQTDGAEVVVVGRSNIVGKPIANMLLQKQATVTVCHTGTRDVGVHTRRADILIVAAGKPKAITADMVKEGAVVIDVGVNRVGDGKLCGDVDFEPVREKAGAITPVPGGVGPMTITMLMVNTLKAARLS........ 290
306 0.000e+00UniRef50_A0A097STP7 Bifunctional protein FolD n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A097STP7_9MOLU  ali  27  3.IINGKAIAEQIKQELKIKKRIRPTLAVVQVGNNEASNIYIRNKKKIAEELNIKFIHLHFGEKITTNDLLNEINKINLDKTIHGLFVQLPLPKHINEFAIINAIDPNKDVDCFSIANIGRLWPNTPAGIIELIKRSGISLEGKNVTVIGRSNIVGKPLIALLMMENATVTVCHSKTKNLAKVCAKADILISAVGKAKLVTEDFVKKGAVVIDVGINRDESGKICGDVDFNPVQLKTNMITPVPGGVGPMTVVMLMKNLIELAKNYRK...... 284
307 0.000e+00UniRef50_A0A1Z9DSY5 Bifunctional protein FolD n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1Z9DSY5_9PROT  ali  30  2MIIDGKKEAQILREEIKKEINKVPGLTVILIGDFVPSQIYVRNKEKNSKEVGINSNVIRYSKDVTEDEVLKKIQELNNNKEVSGILVQLPLPQQINKEKIINSIDPAKDVDGFHPVNYNAIVPCTPLGCLLLLKKIETNLSGKHAVIVGRSNLNGKPMAQLLLKENCTVTITHSKTKNLKEECLKADILIVAVGVANLVKKDWVKKGSIVVDIGINKLGD-KIVGDVSFEEVKDIASSITPVPGGVGPMTIACLLKNTLNCFKK......... 278
308 0.000e+00UniRef50_K7KE36 Uncharacterized protein n=189 Tax=Viridiplantae TaxID=33090 RepID=K7KE36_SOYBN  ali  28  72.VLDGKLISMEIRSKIAAKVGKVPGLAVILVGQRRDSQTYVRNKIMACEEVGIKSLVTELPTDCAVTDVQNAIMRFNKDPSIHGILVQLPLPQHLDEEKVLDAVCLEKDVDGFHPLNMGNFTPCTPKGCIELLIRSGVEIMGKKAVVIGTSNIVGLPASLLLQRHHATVTVIHAFTQNPEQITSEADIVVSAAGVPNLVRGNWIKPGAAVIDVGTTPVEDYRLAGDVCYEEAVKVASIITPVPGGVGPMTVAMLLCNTLDSAKR......... 356
309 0.000e+00UniRef50_Q01X76 Bifunctional protein FolD n=24 Tax=cellular organisms TaxID=131567 RepID=FOLD_SOLUE  ali  29  4.ILDGNRVRDEIKGELKPRIGRPPGLAVVLVGNNPASEIYVRNKIKTCHDLGIYSESITPPDTISTEELLAIVQGLNARAEIDGILVQLPLPPQVDTKRILMAVSPAKDVDGFHPANLPAPRACTPAGIMELLKRGGIPIAGQRAVVVGRSDIVGKPVAMLLLHEHATVTICHSKTPDLKSLCREADILVAAIGRAAMITGEFIKPGATVIDVGTNHVADRELIGDVDPVGVVEKAGAYTPVPGGVGPLTIAMLMVNTVASAERR........ 302
310 0.000e+00UniRef50_A0A1C0BT44 Bifunctional protein FolD n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1C0BT44_9FIRM  ali  33  4.IVYGSEIAAKCKEDLKNEIARLPQLVVILVGEDVGSQSYVKGKEKACHAIGMQNATLRYDASISEEKLIEKIQELNYDENVDGILVQLPLPEHIDTNRVLFSINPDKDVDGFHPYNIGKMIPCTPKGIIKILEHIGYDLSGKTAVVIGRSNIVGKPIAQLLLNKNATVQITHSRTKNIQDIVKHADIVVAAVGRAKLVKNDWLKDGAVVIDVGVNRGEDGKLCGDVDFDDVLDKVKYITPVPKGVGPMTIAMLLENTVESYRKR........ 282
311 0.000e+00UniRef50_A0A1W6N5Q6 Bifunctional protein FolD n=1 Tax=Candidatus Nucleicultrix amoebiphila FS5 TaxID=1414854 RepID=A0A1W6N5Q6_9PROT  ali  26  5.LLDGKENAARIKRKLQKKYGLVPCLAVIRVGENPASKLYVTSKCRQSEEMGMQAKEHHLPENAHREEVIELIHRLNANKNVHGILVQLPLPDHLNPLDICEAIDLEKDVDGLHPYNNPYITPCTPKGCMMFIKDYYKSLKGLKAVIIGCSNLVGKPLGLLLLNEDCTVTYVHRETKNIEEECVSADILVAAAGSPKLVKKNWVKPGALVIDVGINYDGTSDVVGDVDFNVVKDIAGAITPVPGGVGPMTVACLLQNTVEVALRQMGLEK... 291
312 0.000e+00UniRef50_Q6MI74 Bifunctional protein FolD n=12 Tax=Proteobacteria TaxID=1224 RepID=FOLD_BDEBA  ali  33  3LILDGKEVAKEVRASLKETYGRAPQLSVVIVGDDKASHVYVKNKKIACEKIGMTSTIHTLPAETTQSELNQILSKLNNDNGVDGILVQFPLPKHLSSDEVLKLVSAEKDADGLTYESLGYFFPCTPAGVMEILKHYRIPVEGKKAVVVGRSNIVGKPMALLLTEANATVTLCHSKTSNMSELTKQADLVVVAAGKARLLGKEDFKKDAIVIDVGMHSGQGGKLCGDVRFEELDGWAKAATPVPGGVGPMTIAMLLKNTCQLAEQRAR...... 284
313 0.000e+00UniRef50_L7LTU7 Putative methylenetetrahydrofolate dehydrogenase/methylenetetrahydrofolate cyclohydrolase n=1 Tax=Rhipicephalus pulchellus TaxID=7285  ali  29  10.VLSGRQIAKEIREKLAEEVKFRPMLAIVQVGGREDSNVYIRMKRRAAEEVGAESQHIKFPRTITEEELLKEVETLNKDPSIHGIIVQLPLPENIDSNRITNAVSPEKDVDGIHDQNAGRFVPCTPRGCLELIKRSGVPIVGARAVVLGRSKIVGSPMSSLLLWNHATVTTCHSKTKDLPSVCREADILVVAIGRPRMVKADWVKPGAVVIDCGINAIPDTRLVGDVDYDEVKKVASYITPVPEGVGPMTVAMLISNTVDSAKR......... 322
314 0.000e+00UniRef50_F4GJ71 Bifunctional protein FolD n=5 Tax=Bacteria TaxID=2 RepID=F4GJ71_SPHCD  ali  27  3.VLSGKDVAMSVLEHVRKEYGRMPSIAVILVGEDPASQTYVAAKKKSALELGYGHKDYHLSVHATQQELLELVRELNADDDVDGILVQMPLPPHMDENCVIDTIDPAKDVDGFHPVNAGKIVSCTPKGVLRIMDHYGIRTAGKDVVIIGRSSIVGKPMAALLMQRDATVTVCHSCTLGLKEHVRRADIIIAAVGHPHMITADMVKSEAVVIDVGITRVTDWRLVGDVDYDNVAPRTSAITPVPGGVGPMTIAMLMENTLQAAQERKREQKGE. 295
315 0.000e+00UniRef50_A0A0G4FXU4 Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4FXU4_VITBC  ali  29  310.VIDGRAMAEQVRNEVREEISRPPSLAVILVGERWDSETYVRMKKKAADEVGIECEVQQLPASINQFQLIERITRLNRNATVDGIIVQLPLPAHIDSRLALSAIDYAKDVDGLHPNNSCLFKPCTPLGCVELLKRSYVPIEGAKVVVLGRSSHVGLPAALLLAQENATVTMLHSKTGDIRAAVQLADIIVAAMGRPRFITADMVKPGAVVLDVGINSVPDYRLVGDVDFETVRQVAGLITPVPGGVGPMTVAMLMRNTLDSSKRRQ....... 625
316 0.000e+00UniRef50_Q3Z8K6 Bifunctional protein FolD n=210 Tax=root TaxID=1 RepID=FOLD_DEHM1  ali  29  5.IINGTEIAAAIREELKAKHGIVPGLATVLVGDDPASHSYVDSKIKMCQNLGIYSEHHPLPQSATNEDLLTLIARLNADPKISGILVQVPLPVQISENLVLNAINPDKDVDGFHPVNVGRMCPCTPHGVQELLIRSGIKIEGTHVVIVGRSNLVGKPLANILLQKNATVTICHSGTKNLPLITSQADILVSAMGKPKFITADMVRQGAVVIDVGTTYTPEGKLSGDVDFEAVKEKAFAITPVPKGVGPMTIIMLMLNTLTAAKR......... 290
317 0.000e+00UniRef50_A0A2A4SS47 Bifunctional protein FolD n=1 Tax=Candidatus Peregrinibacteria bacterium TaxID=2030811 RepID=A0A2A4SS47_9BACT  ali  28  1MILNGKILAQELLESLSGDIKKQPHLAIILVGDDPASHIYVRHKQRTADKHNIQTSLFQFDAATPELTVLQTLEDINNNPEIHGCIVQLPLPQHISSDKIFSLLNPKKDVDGFSFINMGKTIPATPQGIMTLLSANNIEISGKNTVVIGRSNIVGKPMAALMINAGATVTVCNSKTKNLSHFTKNADIIIAATGQKKLVQADMIKPGVVIVDVGISRTEDGKLCGDVDFHNVVDIASAITPVPGGVGPMTIAQLLTNTVQAAK.......... 272
318 0.000e+00UniRef50_A0A1J1HGQ5 CLUMA_CG001004, isoform A n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1HGQ5_9DIPT  ali  31 1722.LIDGKKIAEDIRGELREQIQRAPQLTAVLVGDDPASRTYVNNKMKAARDVGINSVTRNLSKEITEDELLLIIDELNNDESVDGILVQLPLPDQINERKICNSISCGKDVDGFNEKNVGRLCPCTPLGVQELLKRSDVETFGKHAVVVGRSKNVGMPIMMLLCAMDATVTICHRFTPQLKKFCLMADIIVTATGVPNLIRADMVKPGATIIDVGITRVVDNKLVGDVDFENVKKIAGKITPVPGGVGPMTVAMLMRNTFIASKKLAKLKRSQ. 2022
319 0.000e+00UniRef50_B0TFC9 Bifunctional protein FolD n=75 Tax=Bacteria TaxID=2 RepID=FOLD_HELMI  ali  27  6..IDGKAIAAQLRAEIKAEVGIVPKLAVILVGDDPASVVYARSKEKAAANLGIAFELFTLPGDTTEAALLALIERLNADAAVHGIMVELPLPKQISKEKVLEAIHPLKDVDGVHPLNRGYLMPATPMSCMELLARSGVELAGKRVVIIGRGETVGKPLFFLLLRRNATVTVCHTRTKDLAAEVRRAEIVIAAAGKAGLVTGEMIAPDAVVIDAGINEGEDGNIVGDVKTAEAAERASLISPVPGGVGACTTALLFRNVLFGLKLQ........ 281
320 0.000e+00UniRef50_F4PCM6 Uncharacterized protein n=23 Tax=Eukaryota TaxID=2759 RepID=F4PCM6_BATDJ  ali  29  6.LIDGKAIAETIRNELQIQVGYTPHLAIIQVGSRPDSTIYVRMKEQAAIKAGIKLTLKRFDESVSQMTLMDAVYALNDDPSVHGILVQLPLPSHIDERSVTEAMSPTKDVDGFHSTNHHAFVPCTPKGVVELLRRSGIDVKGKRAVVVGRSNIVGMPVSHLLQDLDATVTVCHSKTQNMQEIISTADILVAAVGHANLIQGSWLKKGVVVIDVGTNAVADPRWVGDVDFETASQVASAITPVPGGVGPMTVAMLMSNTVESAVNFLKGNKEPI 300
321 0.000e+00UniRef50_A0A2M6YGE5 Bifunctional protein FolD n=3 Tax=root TaxID=1 RepID=A0A2M6YGE5_9ACTN  ali  27  7.LISGTKISQDIKNEITEEVGIVPGLAAILVGDNPASKVYVGSKQKGCEEVGFKSETIKMDEGVSTEDVLKELDKLNNREDIHGILVQLPLPGQVDKAKVLEAIYPKKDVDGFHPVNQECLVPATPSGIIEMLKREGIDIKGKNATVVGHSEIVGKPVSLLLLNEWATVTICHIETRDLKIHTRDADILIVATGVPYLIKGDMVKEGAVVIDVGINRITKDKLIGDVDFLRVEPKASYISPVPGGVGPMTIAMLLSNTLKAAKN......... 302
322 0.000e+00UniRef50_A0A2H9KYM3 Bifunctional protein FolD n=1 Tax=Candidatus Micrarchaeota archaeon CG10_big_fil_rev_8_21_14_0_10_45_29 TaxID=1974417 RepID=A0A2H  ali  35  4.LLDGKEASSKWLEDIKKQASLKPKLVIINSGDDAASQIYVRNKVRACKECGVSCELLHYPASASTAELLSKIKELNKDASVSGMIVQLPLPSRVDVQALQEAIEPLKDADGFTPENQPRLVAATPAGVMRLLEHYNLDVTGKNCVVMGRSKIVGKPLAALLRNAGAKVEVVHSKTENPASITSKADFLFIAIGKPRLVGASMVKEGAVVIDIGMNRDENGKVCGDADFEEVKKKASCITPVPGGVGKMTVASLLANTLKAYKMQNKIQ.... 281
323 0.000e+00UniRef50_Q9A8Y0 Bifunctional protein FolD n=2318 Tax=root TaxID=1 RepID=FOLD_CAUVC  ali  26  6.LIDGKAFAADLRAKLKAEHGVTPGLAVVLVGEDPASQVYVRNKGEQTTAAGMYSETHRLPETTTQDELLAVVAKLNADPKIHGVLVQFPVPPHISQMDVVAALSPDKDVDGLTVTNAGRLAPCTPTGCMMLIRDAIGDLKGKTAVVIGRSNLMGKPMAQMLLAADCTVTIAHSRSQDLPSIVRQADIVVAAVGRAEMVKADWVKPGAVVIDVGITRFPKTRLVGDVAFDEVREVAGAITPVPGGVGPMTIACLLANTLTAAKR......... 292
324 0.000e+00UniRef50_A0A0L0CE32 Nuclear factor NF-kappa-B p110 subunit n=2 Tax=Lucilia cuprina TaxID=7375 RepID=A0A0L0CE32_LUCCU  ali  30 1017.IIDGKAIAAQIRAEIRQDVNRKPHLTAIIVGEDQASETYVRMKMNAAKDIGISSETKRLPANITEQELLEVIDQLNNDPNVDGILVQLPVPEHMNERKICNAVVCEKDVDGFNVFNVGRMCPATPLGVIELLRRTNIDTFGKNAVVVGRSKNVSMPIAMLMHAMDATVTICHRFTPELAKYCSMADIIITATGVPGLITKEMVKPGACVIDVGITRITDSKLVGDVDYDEVRQVAGYITPVPGGVGPMTVAMLMLNTVTAAKN......... 1307
325 0.000e+00UniRef50_Q6W210 Bifunctional protein FolD n=257 Tax=cellular organisms TaxID=131567 RepID=FOLD_SINFN  ali  28  7.LISGREVAESIIDQVKAANGITPGLAVIIVGSDPASQVYVASKGRKAEECGFLSIKHELPHDVPERRLLELIDSLNADPSIHGILVQLPLPRHVDSGKVIQAISPQKDIDGFHFINVGKFVPCTPAGCMILVERHGKDLSGLSAVVVGRSNIVGKPMANLLLAANATVTIAHSRTANLEVLCRQADILIAAVGRPEMIRSDWIKPGATVIDVGINRIDDGRLVGDVDFDGAVERAGAVTPVPGGVGPMTIAMLMANTLRAAC.......... 290
326 0.000e+00UniRef50_Q6MAH4 Bifunctional protein FolD n=68 Tax=root TaxID=1 RepID=FOLD_PARUW  ali  30  1MIIDGKRIAEEIQLEIKELIQRPPCLAVLIVGSHPASQIYVNRKTAACKAVGIASIKCELPFTISEEELIREVEKLNVDPQIDGILVQLPLPPHINSNRVNYHIDPQKDVDGFHPLNVGKMLPCTPFGIKTLLERTGIEVCGKHALIIGRSNIVGKPMAALLMQSYATVTVAHRYTKNLKELCLQADLIIVAIGQPKLITADMVKEGVIIVDVGINKIHDYQIVGDVDFVNVAPKCAFITPVPGGVGPMTIAMLLYNTLLSYSKSQNLN.... 291
327 0.000e+00UniRef50_B4U8W9 Bifunctional protein FolD n=138 Tax=Bacteria TaxID=2 RepID=FOLD_HYDS0  ali  31  3.ILDGKSLAKKIKHNIKQEVKRKPKLVVVLVGDDQASLVYVKNKVQACADVGFSSQLDMFEKDVEEDVLLNHIKSLNEQEDVDGILVQLPLPSHISMQKVIDTIDPSKDVDGFHPQNMGKFIPCTPLGIKLLLDEYNIDLKGKNVCIVGAGFIVGKPLSMLMLNYDATVSVCHKYTKDIVEYTKTADILISATGVPFLIKDYMVKEGAVVIDVGISKV-NGKIVGDVDFESISQKASFITPVPGGVGPMTVATLLLNTLKAYKQR........ 277
328 0.000e+00UniRef50_A0A060PZF2 Bifunctional protein FolD n=29 Tax=root TaxID=1 RepID=A0A060PZF2_9RICK  ali  28  3IIIDGKKIASDLIDALKKKHNIFPCLKVILVGSNPASQVYVRNKQKKAESIGISSETIVLPDNISEGELIAKINGLNADPSVHGILVQLPLPSHIKASRVINTVSVEKDVDGFHDENKNCLIPCTPKGSLHLIKSVESNLSGKNAVVIGRSNIVGKPMFHLLLQENCTVTILHSQSRDLAEYCSKADIVVAAVGKPNFVQKDWIKKGAIVIDVGINSMNVGKLVGDVDFDGVKEKVKAITPVPGGVGLMTIAFLMINTVIAACLQKKVD.... 289
329 0.000e+00UniRef50_UPI000C8390D0 bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD n=1 Tax=Faecalitalea sp. Mar  ali  30  4.IVYGNELAVQIKADIKKRIRRLPKLSVIIAGEDPSALSYIKSKEKACEEVGILNGLITLPQDVEEAALIDAIKQLNADDSVDGILVQLPLPKQIHEEKVLACIDPSKDVDGFQPVNLGKFQPCTAKSVMRILKEIGMDLSGKHAVVIGRSNIVGKPVAQLLLKQHATVTICHSKTADLKKFTKQADLLVVAVGRARMIDASYVKAGAVVIDVGVNRDENGKLCGDVDFASVEPLASYLTPVPKGVGPMTSVMLLENTLEAYEEREKMY.... 286
330 0.000e+00UniRef50_Q03FZ5 Bifunctional protein FolD n=203 Tax=cellular organisms TaxID=131567 RepID=FOLD_PEDPA  ali  30  4.IIDGKTLAAEIVQKLKNQ-GVEPHLVVVLVGENPASQIYVRNKEKRANKLGIKSTLVTMNADISENELLLKIQELNQTEDVNAILVQMPLPKHIDAFKVTMAIDPRKDVDGFHPVNQHTPIACTPQGIMEMFQKYHIDIQGKRAVVVGRSSIVGKPMAALLLNANATVTLAHSYTKNLAALTKEADILVVATGIAHFIKEDQVKEGAVVIDVGMDRDENGKLTGDVDFENVEKHVSYITPVPKGVGPMTISMLMKQTVNLTKWS........ 282
331 0.000e+00UniRef50_A0A0K8PBT6 Bifunctional protein FolD n=3 Tax=cellular organisms TaxID=131567 RepID=A0A0K8PBT6_9CHLR  ali  28  19.IIDGKRIANTVKDEVAAAVLQRPGLATVLVGNDPPSHIHVRNKTKTCEKLGIRSFSHLLPEDTTQEVLENLIGQLNSNPDVHGILIQLPLPEHLEPYHLLSLIDPRKDVDGIHPVNAGLFIPCTPAGILYLIHSIEPDITGLEAVVIGRSAIVGMPTAQLLCRNNATVTICHSKTVDLPKICRRADIVIVAVGQQNMVKGSWIKPGAIVIDVGINHVPDYHLTGDTDFESILPIAKAITPVPGGVGPMTIAMLMQNTYNAALR......... 303
332 0.000e+00UniRef50_A0A1F9LID9 Bifunctional protein FolD n=1 Tax=Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11 TaxID=1797896 RepID=A0A1F9LID9_9DELT  ali  28  4.LIDGKRVAQEVRDHLHAQVSARPCLTVILIGDDPASAVYVRTKERACAALGFRSSTHRLSKETTQQQLHALLDETGSDPKVHGILLQLPLPGHLCPEDAFLHLPPGKDVDGLHPLNQARFVPCTPLGILHLLRAYEIPLRGRRCCVLGRSLLVGKPTAALLTNHDATVTLCHSKTEELPAIIGEADLVVACLGKPHFVRGAWLRPGATVIDVGINRLDNGTLCGDVVLDEALSRCSFITPVPGGVGPMTVAMLLSNTYEAWRQASNSE.... 283
333 0.000e+00UniRef50_Q6GMK2 Methylenetetrahydrofolate dehydrogenase (NADP+-dependent) 2, methenyltetrahydrofolate cyclohydrolase n=41 Tax=Bilateria TaxID=33213 R  ali  30  32.VISGRKLARQIRNEARDDVNRRPHLSVVLVGDNPASHSYVLNKTRAAAEVGISSETILKPSNISEEELLDLIVKLNSDHRVDGLLVQLPLPDHIDERRVCNAVCPGKDVDGFHVVNVGRMCPATPWGVWEIIKRTGIETLGKNVLVAGRSKNVGMPIAMLLHTDDATVTISHRYTPQLRQHTKIADIIVAAAGIPNLITADMIKEGAAVIDVGINRILDNRLVGDVDFEGVRKKASFITPVPGGVGPMTVAMLMKNTIIAAKN......... 323
334 0.000e+00UniRef50_I7LI65 Bifunctional protein FolD n=5 Tax=cellular organisms TaxID=131567 RepID=I7LI65_9CLOT  ali  30  4LIIDCKSIAKNIREELKVKIGQKLCLATIIVGGDPASVSYVRNKEKVCIEAGLKSITYELPESTSEKELLDLIKKLNDDETVHGILVQVPLPKHIDEDKIANAIAVNKDVDCFNPINERCLMPCTPKGILRILKEMQIEIKGARAAVVGRSNIVGKPVAALMLHNDATVTICHSKTKNLKDILLESDIVISAVGKPKLITADMIKEGAVVIDAGTTLVEE-KLVGDVDFENVVKKASMITPVPGGVGSMTTTMLIENVLEAA........... 278
335 0.000e+00UniRef50_Q3AYX2 Bifunctional protein FolD n=233 Tax=root TaxID=1 RepID=FOLD_SYNS9  ali  29  5..LDGKALAKAVESRLQAQIGRPPGLAVLRVGDDPASAVYVANKEKACARIGVASYGAHLPSSTPFAEVLSTIQQLNADPRVDGILLQLPLPEGLDEGPLLMAIDPEKDADGLHTLNLGRPRSCTPAGVMAMLRSQGIDPAGQRAVVIGRSILVGQPMALMLQAANATVTVVHSRTKDLVAHTREADIVVVAAGRPGMVGAEHIKPGAAVVDVGIHRKPEGGLCGDVRAAEVEPIAAALSPVPGGVGPMTVTMLLVNTVVAWCRRH....... 282
336 0.000e+00UniRef50_I0EQT8 Bifunctional protein FolD n=3 Tax=Helicobacter TaxID=209 RepID=I0EQT8_HELCM  ali  32  8.LLDGQALACSLEEDLKNKIQKRPKLAVILVGKDPASVTYVNMKVKACERVGMDFDLKTLKETITEAELLSLIRDYNADENISGILVQLPLPRHIDTKMILEAIDPKKDVDGFHPLNIGKLCPATPMGVMRLLEHYHIEVKGKDVAIIGASNIIGKPLSMLMLNAGASVSVCHILTKDISFYTQNADIVCVGVGKPNLIKASMLKKGAVVVDIGINRLNDGRIVGDVDFENAQKVAGFITPVPRGVGPMTIVSLLENTLLAFENNK....... 286
337 0.000e+00UniRef50_UPI00083BCAD0 LOW QUALITY PROTEIN: bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial-like n=1 Tax=Rhinopith  ali  27  318...SGRKLAQQFKQEVRQEVNKRPHLSVILVGENPASHSYVLDKTRAAADMGMNSETIVKPAXISEEELLNVIGKLNNDDNVDGLVVQLPLPEHIDERRICNAVSPDKDADGFHVINVGRMCPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPFIMLLHIDDATVTISHRYTPQLKKHTIFADIVISAAGIPNLITSDMIKEGAAVIDVGINRVHDPKLVGDVDFEGVREKAGYITPVPGCVGPMTVAMLMKNTIIAAKQVLRLEEREV 616
338 0.000e+00UniRef50_UPI000B0B252A bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase n=1 Tax=Lactobacillus gorillae Ta  ali  28  4.LIDGKKLARELNEKTAKERGITPGIAVILVGDDPASAIYTRNKHRKAEKLGMKSVLKTFAEDVSQEEVMACVQDLNQDPSIHAILIQSPLPSHLDEKVLDNAINPQKDVDGFHPFNKCYPVSCTPRGVMTMLDHYNVKLGGRDVVVMGRSILVGKPMQSLLQNRNATVTMISRHTKDKAFYMRHADVLIVAIGQPRFVKAQDVKEGAVVIDVGINRLEDGSLCGDVDFEDVKDKASLITPVPGGVGPMTIASLMAQTVDLAEWSEE...... 285
339 0.000e+00UniRef50_A0A2N0MN81 Bifunctional protein FolD n=25 Tax=cellular organisms TaxID=131567 RepID=A0A2N0MN81_9CHLR  ali  28  5.ILDGKALAETIRAEMQQNHGITPGLAAILVGDDPASAIYVRNKRRACDEVGMVSDTLLLPADSTNEQVLECVQRLNDDPRFHGILVQLPLPPQVDERLIMESLDPGKDVDGLHPFNVGKFVPGTPAGIQQILLRNGHDPAGANVVICGRSDIVGKPLAILLMQRNATVTVCHTRTKNLAEITRQADILVAAIGSPNVITADMVKEGAVVIDVGINRVDDYRLVGDVDFAAVSEEASAITPVPGGVGPMTIAMLLVNTLTATRLS........ 292
340 0.000e+00UniRef50_Q8A7B8 Bifunctional protein FolD n=1921 Tax=root TaxID=1 RepID=FOLD_BACTN  ali  29  3.LIDGKAISEQVKQEIAAEVGKRPHLAAILVGHDGGSETYVAAKVKACEVCGFKSSLIRYESDVTEEELLAKVRELNNDDDVDGFIVQLPLPKHISEQKVIETIDYRKDVDGFHPINVGRMSPCTPNGILELLKRYEIETSGKKCVVLGRSNIVGKPMASLMMQKDATVTVCHSRSKDLVKECQEADIIIAALGQPNFVKEEMVKEGAVVIDVGTTRVPDFKLTGDVKFDEVAPKCSFITPVPGGVGPMTIVSLMKNTLLAGKK......... 289
341 0.000e+00UniRef50_A0A2P5CXD2 Tetrahydrofolate dehydrogenase/cyclohydrolase n=3 Tax=fabids TaxID=91835 RepID=A0A2P5CXD2_PARAD  ali  29  13.IIDGKAIAQAVRSEIADEVGKVPGLAVVIVGNRKDSQSYVSMKRKACAEVGIKSFDLDLPEDVSQAELIAKVHELNANPDVHGILVQLPLPKHVNEEKVLSEISIEKDVDGFHPLNIGKFLPCTPKGCLELLSRSSISIKGKKAVVVGRSNIVGLPVSLLLLKEDATVTIVHSHSSEPEKTIREADIVIAAAGQPMMIKGSWIKPGAAVIDVGTNAVDDYRLVGDVDFHEACKVAGWITPVPGGVGPMTVAMLLKNTLEGAK.......... 329
342 0.000e+00UniRef50_A0A2V9VPV8 Bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase FolD n=2 Tax=Acidobacteria bacterium  ali  26  5.VLDGNKIASEIRAEVAAEAGMRPGLAVVLVGHNPASEIYVRGKVKSCEEVGIFSEKHTPPETVSTSELLSLVDHLNRRDDIDGILVQLPLPSQVDSKKVLMAVDPAKDVDGFHPMNRPGLVPCTPGGIMEMLRRSGIPVAGQEAVVVGRSDIVGKPMAMLLMNANATVTVCHSKTRDLPEVCRRADILVAAIGRAGMITRDFVRPGATVIDVGMNKITDSTLVGDVHPE-VAAIAGALTPVPGGVGPLTIAMLMANTVRAAKLRR....... 303
343 0.000e+00UniRef50_W1Q897 C-1-tetrahydrofolate synthase, mitochondrial n=13 Tax=Saccharomycetales TaxID=4892 RepID=W1Q897_OGAPD  ali  30  3.IIDGRAISSELRASIAAEIKFAPRLVIIQVGDRPDSSTYVKMKLKSCQEVGIDGSLQKLPADVSEADLLARINELNEDSSVHGILVQLPLPAHLDEERITNAVKQEKDIDGFSELNLAKFIPCTPKGIMYLLKHEQVEITGKNVVVCGRSDIVGGPLSKLLEKAGGTVTVIHSKTRQLKFYCSNADIIVSAVGRANFITGDLVKQGCVIIDVGTNYVPDQRMCGDVDFASCKEKASKITPVPGGVGPMTVAMVLDNLLESAKRSKKV..... 294
344 0.000e+00UniRef50_A0A2E1ITV2 Bifunctional protein FolD n=7 Tax=cellular organisms TaxID=131567 RepID=A0A2E1ITV2_9FLAO  ali  29  3.LLDGKFISNKIKEEIREEVERPPHLAAILVGNDGASLTYVGSKVRSCEQIGFDSTLIKLDEDISEDKLIANINKLNNDSDIDGFIVQLPLPKHIDEEKILKLVDPSKDVDGFHPYNFGKMIPATPHGIVELIKRYDIQTEGKHVVVIGRSNIVGRPISILLSNKNSTVTLVHSRTKDISFYTKTADILVVALGIPNFLKSDMIKKDVVVIDVGITRVEDYKIVGDVDFESVKLKSSFITPVPGGVGPMTIAMLLKNTLKARKNQ........ 290
345 0.000e+00UniRef50_A6X610 Bifunctional protein FolD n=252 Tax=Proteobacteria TaxID=1224 RepID=FOLD_OCHA4  ali  26  4.LIDGKKLAEDVVSTVKTETGIVPGIAVVIVGEDPASQVYVASKSKKAKECGFHSVQHDLPETASEQELLDLIESLNNDPAIHGILVQLPLPKHIDSGRVIQTISPDKDVDGFHFINVGKFVPCTPAGAMIMIERHGRDLSGLNAVVIGRSNIVGKPMFNLLLAANATVTVAHSRTKDLPAIARTADILVAAVGRPQMVKGDWVKPGATVIDVGINRIPAPRLVGDVDFVEAEKVAGAITPVPGGVGPMTIAMLMANTLTAACR......... 290
346 0.000e+00UniRef50_Q8TK95 Bifunctional protein FolD n=86 Tax=root TaxID=1 RepID=FOLD_METAC  ali  32  10.IIDGKVLAQQVEEEVRSGVGIVPGLATILVGDDPASKMYVRLKHRACERVGIKAEDYLLPGDATQEELLTLIDSLNKNKDVHAILLQLPLPKHFSTQEAMEAISPTKDADGFHPYNMGKLMPCTPHGVIRALEEYGVSVQGKNAVIVGHSNVVGKPMAAMLLNRNATVSVCHIFTDDLKKYTLGADIIVVATGVKHLIKADMVKEGTVIFDAGITKEEDG-VYGDVDFENVIKKASLVTPVPGGVGPMTIAMLMKHVLLCAEKS........ 289
347 0.000e+00UniRef50_A2RVV7 Bifunctional protein FolD 1, mitochondrial n=120 Tax=Viridiplantae TaxID=33090 RepID=FOLD1_ARATH  ali  25  65.VIDGNVIAEEIRTKIKKAVGKVPGLAVVLVGEQRDSQTYVRNKIKACEETGIKSVLAELPEDCTEGQIISVLRKFNEDTSIHGILVQLPLPQHLNESKILNMVRLEKDVDGFHPLNEPLFVSCTPKGCVELLIRTGVEIAGKNAVVIGRSNIVGLPMSLLLQRHDATVSTVHAFTKDPEHITRKADIVIAAAGIPNLVRGSWLKPGAVVIDVGTTPVEDYRLVGDVCYEEALGVASAITPVPGGVGPMTITMLLCNTLEAAKR......... 349
348 0.000e+00UniRef50_A0A1Y1RKK2 Bifunctional protein FolD n=7 Tax=cellular organisms TaxID=131567 RepID=A0A1Y1RKK2_9BACT  ali  28  5.LIDGRKISKKIRVGIKSRVKIRPGLGVILVASDPASCSYVSAKERACRRLGIFSETARLSASVSQSDLLNRIDVWNQSDKIHGILIQLPLPSHINQDAVIQAILPDKDVDGFHPINVGKFAPCTPSGVCELLIRGGYDPSGKHTVIVGRSNIVGKPLAALLIQKNATVTVCHSATKNMASYTRQADILIAAAGRAEFITGDMIKPGAVVIDVGTNHIEDYRLTGDVHFDSAAKVAAAITPSPGGVGPMTITMLMHNTVRSAEEFYRKL.... 296
349 0.000e+00UniRef50_T0VAC6 Bifunctional protein FolD n=2 Tax=Streptococcus TaxID=1301 RepID=T0VAC6_9STRE  ali  29  4.IIDGKALATKLQARLKEETGVVPGLVVIVVGDNPASKIYVRNKERSAIAAGFRSEVRRLPESISQAELLEVIEHYNQDPLWHGILVQLPLPKHIDADAVLLAIDPTKDVDGFHPLNMGRLWPSTPAGIMEMFKEYGIDLEGKRAVVIGRSNIVGKPMAQLLLAKNATVTLTHSRTHHLPKIARRADILVVAIGRAKFVTADFVKEGAVVIDVGMNRDENGKLCGDVDFDSVAPLASHITPVPGGVGPMTVTMLMEQTYEAAVRALKNES... 286
350 0.000e+00UniRef50_Q818R5 Bifunctional protein FolD n=427 Tax=root TaxID=1 RepID=FOLD_BACCR  ali  33  30....................GIVPGLAVILVGEDPASRSYVKGKEKGCEQVGIYSELIELPETITEERLLAEIDRLNGDDRINGILVQLPLPKHIEEKAIIERISPEKDVDGFHPISVGRMMPCTPHGIVELVKETNLDISGKHVVVIGRSNIVGKPVGQLFLNENATVTYCHSKTQNMKELSKLADILIVAVGRPKMITADYIKEGAVVIDVGVNRLETGKLCGDVDFDNVLDVAGYITPVPKGVGPMTITMLLHNTVESAKR......... 280
351 0.000e+00UniRef50_A0A2U8I3B9 Uncharacterized protein n=1 Tax=Candidatus Fukatsuia symbiotica TaxID=1878942 RepID=A0A2U8I3B9_9GAMM  ali  31  5.IIDGKVIAQEVKNEVKERVKRAPGLAVVLVGTNPASQIYVGSKNRACKEVGFVSFPHHLPEITTETELLSLIDKLNQDDQVDGILVQLPLPAGIDNVKVLERIHPNKDVDGFHPYNVGRLCPCTPRGIITLLEKSGIKIQGLNAVVVGASNIVGRPMSLELLLAGCTTTITHRFTINLRQHVENADLLVVAVGKPNFIPGEWIKPGAVVIDVGINRLENDKTVGDVEFDSAEQRAGWITPVPGGVGPMTVATLMQNTLQACENS........ 282
352 0.000e+00UniRef50_A7UTF7 AGAP004677-PA n=12 Tax=Culicidae TaxID=7157 RepID=A7UTF7_ANOGA  ali  32  109.LIDGKQIAREIQEELRKKIERSPQLTAILIGDDPASTTYVNNKMKAAADVGIESKTERFGTEITEEQLLERIDQLNNDDAVDGILIQLPVPNHIDERKVCNAVSCDKDVDGFNERNIGRLCPCTPLGVQELIKRTGIETFGKNAVVVGRSKNVGMPIAMLLCAMDCTVTICHRFTQELKRFCRTADIIVTATGVPGLITSDMIKEGAAIIDVGITRITDKKLVGDVDFEEVRKKAGLITPVPGGVGPMTVAMLMKNTIIAAKN......... 400
353 0.000e+00UniRef50_C5L3W4 Methylenetetrahydrofolate dehydrogenase, putative n=1 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5L3W4_PERM  ali  27  5.IIDGKKVAAEVRKELKQTHGITPGIAVILVGQRPDSATYVRMKKKAAAEVGFISREKVLPDTCTEEEVLAAVSRFNADPEVHGILVQLPLPAHISEQKVLGRIMIEKDVDGFDPANQPKAISCTPYGVIELLKRYNIEIAGKNAVVVGRSNIVGMPVALLLIHENATVTVCHSKTKDLPGVVRRADIVIAAIGRANFIKEDWIKEGAVVIDVGINSVEDYRLVGDVDYDNVKEHCSYITPVPGGVGPMTIAMLLKNT............... 287
354 0.000e+00UniRef50_R6YP85 Bifunctional protein FolD n=36 Tax=root TaxID=1 RepID=R6YP85_9CLOT  ali  33  3.ILDGKKLSNEIIEELKKEKGIKPKFAVIMVGNDKASQIYVKNKRKACERIGIECVECFLDENIQQKELIDKIKELNSDNTIHGILLQSPIPKHLNINEAFETISPKKDVDGFNPTNVGKLCSCTPFGIIKLLDKYGIDLAGKKVTIIGRSNIVGKPLIQCFLNKNATVTICHSKTDDIKEHTKDADIVVVAIGKPKFLKENMVKKNSVIIDVGINRDDNGKIIGDVDFENVSKKSSYITPVPGGVGPMTIAMLMNNVIKAAEN......... 278
355 0.000e+00UniRef50_A0A2R6Y381 Bifunctional protein FolD n=1 Tax=Candidatus Carbobacillus altaicus TaxID=2163959 RepID=A0A2R6Y381_9BACL  ali  27  6..MDGRRLAALYREKVKEEVGISPRLVVVLVGSDPASLTYVQNKVKAAQEGAIRSEVLRFPETVREEELLETIARLSADDDVDGVLVQLPLPQGLDKEKVIEQIAPEKDVDGFTYQNVGRVMPCTPQGIIALLDAYRIPLLGEEAVVVGRSDIVGRPVAQLLLSRHATVTIAHSKTRHLGEITRRAQVLIVAAGVRELITGDMVKEGAVVIDVGIHRRADGTLTGDVEADSVREKARLLSPVPGGVGPMTIAMLLLNTVKAARLRR....... 283
356 0.000e+00UniRef50_A0A2M6K7V2 Bifunctional protein FolD n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2M6K7V2_9BACT  ali  30  4.VLDGKKLSQKIKNDLKREIKLKPGLAIVLVGQNPASKIYVKQKSKIGAEIGIKTTIHKLPSSVAEKKLLELINKLNKNKNVHGIIVQLPLPKRINPAKVIKTIDPKKDVDGFHPLNQKSFVPATPAGIMELLNSYKIKIAGRHSVVVGRSNIVGKPIALLLLEKNATVTICHSQTKNLSQITHQADILISAVGQPNLIKKNMIKKGVVIIDVGINRLGNKKIVGDVDFKNCKSMARAITPVPNGVGPMTIAMLMKNCVEAAKN......... 276
357 0.000e+00UniRef50_F3B9N6 Bifunctional protein FolD n=45 Tax=Bacteria TaxID=2 RepID=F3B9N6_9FIRM  ali  32  4.LIDGKKIALEIKNELKKQQEKDVCLAVIQVGNDAASTVYVNGKKKDCEYIGIKSLSYELPEETTENELLDLIGKLNGDINVHGILVQLPLPSHMNEEMITQAISPEKDVDGFHEMNIGKLCCCTPAGIIQLLKRSGIEIAGKECVVIGRSNNVGKPTALLLLRENGTVTIAHSHTENLKEITKRADIVVAAIGKPKFITKEYLKQGAVVIDVGIHRNADNTLCGDVDFDDVAETVSAITPVPGGVGVMTRAMLMYNCVSAVYR......... 279
358 0.000e+00UniRef50_A0A0X8JC95 Bifunctional protein FolD n=5 Tax=cellular organisms TaxID=131567 RepID=A0A0X8JC95_9FLAO  ali  28  2IILDGKATSAQIKAEIAEEVERVPHLAAVLVGEDGASLTYVGSKVKACEQVGFRSTLVQLPVDISEEALLAELDKLNANADIDGYIVQLPLPQHINTEKILLAVDPRKDVDGFHPANFGRMIPATPFGIVELLKRYKVPTAGRHVVVVGRSHIVGRPISILLSQKNATVTLTHSHTPDLAHFTREADIVVMALGQPEFLKGDMVKEGVAVIDVGITRLKDYRIVGDVAYEEVAPKAAYITPVPGGVGPMTIAMLLKNTLLARKWH........ 290
359 0.000e+00UniRef50_A0A0G0WA24 Bifunctional protein FolD n=1 Tax=candidate division CPR2 bacterium GW2011_GWC1_41_48 TaxID=1618344 RepID=A0A0G0WA24_9BACT  ali  33  1MILDGQKVAQVIYEKLKKELKSKPKLAVILVGENPASESYVKIKEETAKAIGIDFELFKFASDIDETEVISRIELLNNDTEVSGVLVQLPLPAHFDETRVLQSISPKKDVDGLNALNLGKMYPATALAVLEILDFYEIPIEGRHAVVIGKSNLVGKPVADMLLNRSATVTVCHERTEDLQFFCKRADILVSAVGKANLIGADMIKDGSVIIDVGVNKVGN-KLVGDVDFKEGRKRASAITPVPGGVGPVTVVMLMKNVFQAYK.......... 272
360 0.000e+00UniRef50_A0A0S2FAC3 Bifunctional protein FolD n=32 Tax=Proteobacteria TaxID=1224 RepID=A0A0S2FAC3_9GAMM  ali  29  13.ILDGKRIAEDLLDNLKAQVQSRPGLAVVLVGNDPASSVYVRNKRRAAQKVGIRAIDYDLPADTSDEQLLALIDRLNADPEVHGILVQLPLPDRRDATALIHRIDPRKDVDGFHPENQFGLRPCTPRGITTLLGYTDRPVRGQSATIVGVSNHVGRPMALELMIAGCTVTSCHKFTPPLEASVRGADILVVAVGRPQLIPGEWVKPGAVVIDVGINRLDDGRLVGDVGFDAAAQRASWITPVPGGVGPMTVATLMQNTLEAAEAADKV..... 295
361 0.000e+00UniRef50_A0A1R0IHB0 Bifunctional protein FolD n=6 Tax=Sulfobacillus TaxID=28033 RepID=A0A1R0IHB0_SULTH  ali  30  6.LLDGKRTAQIIREELAKKIELRPGLAVVLVGDDPASKIYVRNKHRASTQVGMDSRQIILPAHSTTSQVLETIEMLNQDPSIHGILLQLPVPRQIDAQVILRHLDPRKDVDGLTPTNMGRLMPCTPLGIIELLDRYHVPLEGQRVVVIGRSQLVGRPLALMFVERNATVTIVHSKTPNAWDITREADIVVAAVGHAHLVQPNWIKPGATVIDVGINRTESG-IVGDVDFDSVAAMASRITPVPGGIGPMTIAMLLSNTWQAFQ.......... 280
362 0.000e+00UniRef50_A0A2P8ZNM3 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase n=10 Tax=Bilateria TaxID=33213 RepID=A0A2P8ZNM3_BLAGE  ali  30  35.IIDGVKIARDIRQELKTEVNKRPHLTALLVGEDPASATYVRNKMRAAREIGIESRTLKVPPNITQTELIDHIEFLNGDSHVDGILVQLPLPKHITERAVCNAIAPHKDVDGFNIVNVGRFCPCTPLGVQELIKRTGVETFGKHAVVCGRSKNVGMPIAMLLHAMDATTTICHRYTPQLAQLTRSADIIITAAGVPNLIRADMVKPGACVIDVGITRIHDKKLVGDVDFDAVSEVAGFITPVPGGVGPMTVAMLMRNTMMAAKRS........ 327
363 0.000e+00UniRef50_A0A2I7N9N9 Bifunctional protein FolD n=1 Tax=Neisseriaceae bacterium DSM 100970 TaxID=2052837 RepID=A0A2I7N9N9_9NEIS  ali  33  6.IISGKELSSQILDAISEDVERTPCLAVVLVGNDPASQVYVKNKKNACQKVGIKSLEFVLPESTTQEELSTLIKDLNADFMVDGILVQLPLPAHLDSKLVIDTILPNKDVDGFHRYNMPNICPCTPHGVMYMLDNIKVNYHGKHAVILGTSNIVGRPMALELMNRGTTVTMCNSKTRNVEEIIASADILVAAIGNPNFVQAEWLKPDAIVIDVGINRLNDGKLCGDVNFNDALPKVKYITPVPGGVGPMTIAMLLKNTMRCYKLN........ 283
364 0.000e+00UniRef50_W6FUV8 Bifunctional protein FolD n=20 Tax=cellular organisms TaxID=131567 RepID=W6FUV8_NODSP  ali  30  8.ILDGKALAEKIHQELQAKIGRSPGLAVLMVGDNPASAAYVRNKERACAKVGIASFGKHFPTETTQGELEEVIAALNQDERVDGILVQLPLPSHLDAVALLNKIDPDKDADGLHPVNLGRLRSCTPAGVMRLLQEYEISLQGKQAVVVGRSILVGKPMALMLLEADATVTIAHSRSLDLGTITKNADLIIAAVGRPGLITGEMVKSGSVVIDVGMNRVTDSRLVGDVDWESTAGVAEYITPVPGGVGPMTVAILLQNTVASYLKKAK...... 291
365 0.000e+00UniRef50_A0A2R5FZT6 C-1-tetrahydrofolate synthase, mitochondrial n=5 Tax=cellular organisms TaxID=131567 RepID=A0A2R5FZT6_9STRA  ali  29  44..IDGKAIADDVLREVKQDVEITPGLAVVLVGDRPDSHKYVQMKKKAAKNVGIRSIETTLPENCSHEEVLEVVRQLNQRSDIDGILVQLPLPAQCNQTEILEAIDVDKDVDGFHPFNMSRNASCTPLGSIVLLERSGCEIAGKHAVVLGRSNIVGLPAALMLLHRNATVSMCHSRTPNIPEICREADIIIAAIGKPEFVKGDWIKPGATVIDVGINFKEDPRMCGDVDYEAARQVAGAITPVPGGVGPMTVAMLMVNTVNNAKARLE...... 344
366 0.000e+00UniRef50_W1Q4I2 Bifunctional protein FolD n=2 Tax=Abiotrophia TaxID=46123 RepID=W1Q4I2_ABIDE  ali  31  4..LDGKTLSQSIFARLRSQTGTQPKLTVISVGEDPASKVYVGQKQKRALEIGYAFEWMLLPADISQEELERTIKVHNQDPQTHGLLLQLPLPDHLDPLSAMHLIDPEKDVDGFHPLTMGRVYPCTPKGIVRLLENAQIPLQGQNVVVVGRSQIVGLPISIMLINRGATVTVCNSKTQDLGHYTRYADILIVATGQAHLIGPDHLKEGAVVVDVGINRLMSGKLVGDVDFEAVAHKVSYITPVPGGVGPMTVAMLMEQTFTCACQQQNLD.... 284
367 0.000e+00UniRef50_A0A1F8UQE1 Bifunctional protein FolD n=8 Tax=root TaxID=1 RepID=A0A1F8UQE1_9FIRM  ali  31  2ILIDGNELADEIKEKLRKQNGIHPKLTVILVGDDFASKKYVNNKKMACEYVGIEQGMIELGVNATEEELIMVIRKLNSDESVHGILIQLPLPKHIDVYKIINIINPNKDVDGFHPENCEGVIPCTPNGIMKLLEKYDIDVRGKNCVVIGKSDIVGKPISMLLLRESATVTVCHIETRDISNITKQADVLIVATGNPGLITADMIKPGVVIIDVGINRNEYDEVCGDVDFEGCKNKASYITPVPGGVGPMTIAMLMENCVKAARGLENKGEKK. 286
368 0.000e+00UniRef50_F4QAN3 Methenyl tetrahydrofolate cyclohydrolase / NADP-dependent methylene H4F dehydrogenase n=1 Tax=Cavenderia fasciculata (strain SH3) Tax  ali  29  14.IIDGRIISADIKKDIKIQVKRAPCLVVILVGDRPDSHTYVRNKKKTASDLGFESIDCLLPGTTTQQEVIDIVKKYNQDEAVDGILVQLPLPSHINEASVLNEIDISKDVDGFNPINNATFQPCTPRGCIEMLDRSGVEIAGKKAVVLGRSNIVGLPVALMLMNRDATVTICHSKTPDIPSQVKQADIVIAAIGQARFVKKEWIKEGAVVIDVGMNSV-DGKLCGDVDYVNVKEVASKITPVPGGVGPMTIVMLLSNTLESSKKRQN...... 294
369 0.000e+00UniRef50_Q73HK3 Bifunctional protein FolD n=15 Tax=cellular organisms TaxID=131567 RepID=FOLD_WOLPM  ali  32  3IIIDGKKIANDLCERLKREYNIFPCLKVILIGSNPASQVYVRNKQKKAESIGISSETIVLPNNILEDELIEKINELNEDPSVHGILVQLPLPNHISASRVINTVSVEKDVDGFHDENKNCLIPCTPKGSLHLIKSIEENLSGKNAVVIGRSNIVGKPMFYLLLQENCTVTILHSQSKDLAEYCSKADIVVAAVGKPNFVQADWIKKGAIVIDVGINSVNVGKLVGDVDFEGIKGKAKAMTPVPGGVGPMTIAFLMMNTVIAACLQK....... 283
370 0.000e+00UniRef50_Q5WN02 Os05g0150800 protein n=20 Tax=Eukaryota TaxID=2759 RepID=Q5WN02_ORYSJ  ali  28  4.IIDGKAVAADIRREVAADVNLVPGLAVVIVGSRKDSQTYVQMKRKACAEVGIRSVDVDLAEDISEAALVAEVHRLNADPAVHGILVQLPLPKHINEEKILNEISLEKDVDGFHPLNIGKFLPCTPKGCMELLTRSGVTINGKRAVVVGRSNIVGLPVSLLLLKADATVSIVHSRTPNPESIVREADIVIAAAGQAMMIKGDWIKPGAAVIDVGTNSISDYRLVGDVDFAEVSKVAGHLTPVPGGVGPMTVAMLLKNTVDGAKR......... 288
371 0.000e+00UniRef50_A0A1I0GPA8 Bifunctional protein FolD n=4 Tax=Bacteria TaxID=2 RepID=A0A1I0GPA8_9FIRM  ali  32  1MIINGKEIALKIKDQLKNDVSRMPKLVVILIGDNPASLTYVRNKERGCDYIGIESEIIKHDSSFSERQLLEEIEILNNDETVDGILVQLPLPKHISEEKVLNAIAFDKDVDGFHPHNQNSLVPCTPKGMLVLLEKINYDLDGKEVVVVGRSNIVGKPVALLCLQKNATVTIAHSKTKDLKKICSRADVLITAIGKPKFFNHEYIKDDAIVLDVGINRDENNKLCGDVDFEDVKDKVKAITPVPGGIGPMTITMLMQNTIEAFYKRN....... 280
372 0.000e+00UniRef50_A0A1Q8ZC68 Bifunctional protein FolD n=13 Tax=root TaxID=1 RepID=A0A1Q8ZC68_9CYAN  ali  31  8.ILDGKALAQRMQTELATEIGRPPGLAVLMVGNDPASAVYVRNKERACEKVGIASLGQHFPTDTTQAELEQMIQTLNQDQRVDGILIQLPLPGHLDAVALLTQLNPNKDADGLHPLNLGRLRSCTPAGVMRLLQEYDVELQGKHAVVVGRSILVGKPIALMLLEANATVTIAHSKTPNLAEVTRQADILVVAAGRPEMITADMVKPGAAVVDVGINRITDSRLVGDVQFDSVRRVAGFLTPVPGGVGAMTVTLLLYNTVWSYSQQR....... 290
373 0.000e+00UniRef50_A0A242JY09 Bifunctional protein FolD n=5 Tax=Bacteria TaxID=2 RepID=A0A242JY09_9ENTE  ali  28  4.LINGKELAEKMQEKLAKAKQIHPGLVVLLVGENPASQIYVRNKGRVAEKLGIYSKIERYDQSISEEKLLREIEKYNKDPQFHGILVQLPLPAHIDEDKVLLAIDPKKDVDGFHPMNLGRKIPCTPYGIMKMFEAYDINLEGKRAVVIGRSNIVGKPMAHLLLMANATVTIAHSKTQNLPELAREADILVVAIGRGHFVTKEFIKPGAVVIDVGMNRNEEGKLIGDVKFDEVAPLTSYITPVPKGVGPMTITMLMFQTVLSAEK......... 279
374 0.000e+00UniRef50_A0B8J7 Bifunctional protein FolD n=43 Tax=root TaxID=1 RepID=FOLD_METTP  ali  30  1MIIDGKALASDIEAEVRERVGFNPGLATILVGENPASQMYIRIKHAACERVGIRSENIVLPGDTDESTLIKTIQGLNKRGDVHAILLQLPLPGHLDPRKAMMAISPEKDADGFHPENMERLVPCTPRGIVYALEHLGVDIEGSEAVIVGHSNVVGKPLAAMLLNRNATVQVCHVYTRNLKEHTKDAEILVVAAGVPRLIKADMVRDGAYVFDVGINKV-DGKTVGDVDFDAVKEKAAGITPVPGGVGPLTVAMLLSQTVTAAEMSLERQRS.. 280
375 0.000e+00UniRef50_Q04448 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial n=395 Tax=root TaxID=1 RepID=MTDC_DROME  ali  31  10.IIDGKAIAQEVRTQLAHELKPKPHLTAVIVGEDPASEKYVANKMVACREVGISSETKRLPASTTQEELLQLIADLNKDPQVTGILVQLPVPEHINERTICNAVDVDKDVDGFNEVNMEANIPATPLGVKRLLEHMKIETLGRNAVVVGRSKNVSLPMAILLHAMDATVTICHRYTPELARHCRQADIIVVAVGKPGLITKDMVKPGACVIDVGINRIKDFKLVGDVDFEEVRQVAGHITPVPGGVGPMTVAMLMHNTLKAARKQFDDRKSS. 309
376 0.000e+00UniRef50_E7MQS9 Bifunctional protein FolD n=19 Tax=cellular organisms TaxID=131567 RepID=E7MQS9_9FIRM  ali  30  4.IIYGSELSAELKENMRSKVERTPCLAVILVGDNSASESYVRGKEKACAAVGIKTNTIRLSSSISQEELEKTICDCTKDDTVDGILIQLPLPEGFNEDRAIACIDPQKDVDGLHPLNFGRFFPCTPLGIMELLNRMECNPKGKHAVVIGRSKLVGTPVARLLQNANATVTICHSHTANLKELTNLADILIVAVGKPKMIDAQYVKEGAYVIDVGVNSV-DGHLCGDVDFESVAPKAGAITPVPKGVGPMTICMLLQNTITAYEKRQ....... 281
377 0.000e+00UniRef50_A0A1E8YHL7 Bifunctional protein FolD n=5 Tax=Aerococcaceae TaxID=186827 RepID=A0A1E8YHL7_9LACT  ali  27  12ILLSGTKRSKELLQKLKDHHQVTPKLVVITVGEDPASQVYVGQKEKKAHQIGFDFEWVKFPETVPETELIAKIDELNADSKVNGMIVQLPLPQHLDERKMIERISPDKDIDGFHPYNLGKVIPCTPKGILNLLKAQDITLSGKNVVIIGRSLIVGLPLQMLLTHENATVTVCHTKTRDLKAHTKQADIIVVAAGKPGLLTKEHIQSGAVVIDVGINRLPDGSLAGDVAFEEVEDMVSAITPVPGGVGPMTVAMLMEQTLECACRQHDIDYQTL 298
378 0.000e+00UniRef50_A0A1B9C250 Bifunctional protein FolD n=1 Tax=Acidithiobacillus ferrivorans TaxID=160808 RepID=A0A1B9C250_9PROT  ali  27  6..LDGRTLSKEIRASLIKNNGRAPGLAVILVGNDPASKVYVRNKSKACDECGVMSKVFLFPKTVSEHELVELIEELNASNEIDGILVQLPLPEHVNVRNIIGCISASKDVDGFHLYNVGGFPPCTPYGVQLFLETAKIEVSGKNVVIVGASNIVGKPMALMLLQKGATVSICHIKTNDLSLYTRLADILIVAAGKPGLITADMVKNDVVVIDVGINRPPDGSITGDVDFDNVKHKASWITPVPGGVGPMTVTMLIENTIKAAELRMSINNLEV 290
379 0.000e+00UniRef50_W6EG15 Bifunctional protein FolD n=11 Tax=cellular organisms TaxID=131567 RepID=W6EG15_SULMU  ali  29  3.ILDGKALSDQIKIELKTKKGITPGLAVILVGDDAASQTYVKMKEKACDAAGVYSIIHKMPTTISQEKILETIMMINNNPNIDGVLVQLPLPKHVDTTKIIEAIDPKKDVDGFHPFNVGRFVPCTPLGVMRLLAHYNIDPKGLDACVVGASNIVGKPMMNLLLNAGATVDICHIFTKDLKAHTQKADLVIVGVGKQNLITADMVKEGAIVIDIGINKTAEGRLVGDVDYENVAPKCSYITPVPGGVGPMTIAMLLENTIKAATQR........ 279
380 0.000e+00UniRef50_A0A1V5IGZ6 Bifunctional protein FolD n=1 Tax=Euryarchaeota archaeon ADurb.BinA087 TaxID=1852879 RepID=A0A1V5IGZ6_9EURY  ali  29  14MILDGKKIQEKRLEILKEQIGFTPRLATVIVGNDPASELYVRMKHRACEQVHIGSVGISLPESAGTKEVIREVQVLNRDPEISGILVQLPLPSHIDTMQVIEAVLPEKDVDGFHPVNLGRYSPCTPQGIMTLLNEYQITTEGMHAVVMGRSIEVGRPMAALLLSANATVTITHSKTQNLPLITREADLLVVAIGKPRYVGPSMVKEGSVVIDVGTNRV-DGVLCGDVDFDRVKDHTSAITPVPGGVGPMTIASLMENTFLAAKRS........ 287
381 0.000e+00UniRef50_Q7VVW3 Bifunctional protein FolD 2 n=221 Tax=cellular organisms TaxID=131567 RepID=FOLD2_BORPE  ali  29  5.VIDGSRASARIREQLKERVNIRPGLAVLLVGEDPASQVYVRNKVAACEQVGIHSVTERYPSAWTENQLLDRIASLHGDPAINGILVQLPLPPHMSAHRVIEAISPLKDVDGFHISNKPQFQPCTPYGVMKLLESEGVSLRGAEAVIVGASNIVGKPMAMLLLAAGATVTICNSKTRDLAGQARRADVLIVAAGRAGIVDGSMIKPGAVVIDVGINRSPDGRLCGDVDYGSAAKVAGAITPVPGGVGPMTIAMLLANTVEAAERS........ 281
382 0.000e+00UniRef50_A0A1F7RYN1 Bifunctional 5,10-methylene-tetrahydrofolate dehydrogenase/5,10-methylene-tetrahydrofolate cyclohydrolase (Fragment) n=11 Tax=cel  ali  35  1MIIDGNAVSKEIRDKIKIEVERAPGLTVILIGDDPASQIYVGRKSKACSEVGIASEIKRLPGDVHENEVINLISDLNKNDNVDGILVQLPLPKHLDENKIIDAISPRKDVDGLHPLNKASLVPCTAAGIIELIQRTGIEIKGKHSVIIGRSNIVGKPAALMLLHKHSTVTICHSRTKDLKEIAKQADILIAAIGKAKFVTKDMVKNGAIVIDVGINRV-DGKLLGDCDFEEIKEIAGAITPVPGGVGPMTVAMLLKNTLSAY........... 275
383 0.000e+00UniRef50_A0A0B7HGF0 Bifunctional protein FolD n=9 Tax=cellular organisms TaxID=131567 RepID=A0A0B7HGF0_9FLAO  ali  31  3.LLDGKKTSEQIKQEIAEEVGKVPHLAAVLVGTDGASLTYVGSKVKACEKVGFDSTLIELPAEITEAELLKKIEELNKNPEIDGYIVQLPLPKHIDSQKVLMAVDPEKDVDGFHPANFGKFIPATPFGIMELLKRHNVGTKGKHVVVVGRSHIVGRPMSILLSQKNATVTLTHSYTPNLKEITQQADIIIMALGIPEFLKADMVKEGATVVDVGITRLKDYRIVGDVDFEQVKEKADYITPVPGGVGPMTIAMLLKNTLLARKWKDK...... 292
384 0.000e+00UniRef50_A0A2N3LN66 Bifunctional protein FolD n=31 Tax=cellular organisms TaxID=131567 RepID=A0A2N3LN66_9BACI  ali  31  5.IMDGKRIAEEIRTDLSKK-GVIPGLAVILVGNNPASRTYVTNKQKSCHALGMKSVLIELSTEITENDLLHKIEELNEDKSIHGILVQLPLPAHINKKNVIEKIHPEKDVDGFHPINIGKMMPCTPFGIMEMIKHEKIDIEGKHVVVIGRSNIVGKPAGQLFLNENATVTYCHSKTKNLSLYTKQADILIAAIGKAKFVTEDMVKEDAVVIDVGMNRDQTGKLCGDVDFEHVKSKASYITPVPGGVGPMTITMLLFNTLKSAQK......... 280
385 0.000e+00UniRef50_C5Z052 Uncharacterized protein n=19 Tax=Eukaryota TaxID=2759 RepID=C5Z052_SORBI  ali  27  4.IIDGKAIAADIRREVAADVGLVPGLAVVIVGSRKDSQTYVNMKRKACAEVGICSIDVDLPEDISEPALVAEVHRLNADPAVHGILVQLPLPKHINEEKILNEISIEKDVDGFHPLNIGKFQPCTPKGCMELLSRSGVTVKGKRAVVVGRSNIVGLPVSLLLLKEDATVSIVHSRTPDPESIVREADIVIAAAGQAMMIKGDWIKPGAAVIDVGTNSVDDYRLVGDVDFAAVSKVAGYLTPVPGGVGPMTVAMLLKNTVDGAKR......... 288
386 0.000e+00UniRef50_P54382 Bifunctional protein FolD n=2097 Tax=root TaxID=1 RepID=FOLD_BACSU  ali  33  30....................GVTPGLAVILIGDDPASHSYVRGKKKAAETMGMNFKLDQFDSSLTEAELLSIIDQYNQDPEFHGILVQLPLPDHISEKAVIERISPDKDVDGFHPLNVGKMLPCTPHGIVELLKKTNIDLSGKEVVVVGRSNIVGKPVGQLLLNENATVTYCHSRTENITEHTKKADILVVAVGRANFISADQIKEGAVVIDVGVNRLENGKLCGDVEFEGAKEKASFITPVPGGVGPMTITMLAHNTVKSAKR......... 280
387 0.000e+00UniRef50_Q9LHH7 Bifunctional protein FolD 2 n=30 Tax=cellular organisms TaxID=131567 RepID=FOLD2_ARATH  ali  28  11.IIDGKAIAHTIRSEIAEEVGKVPGLAVVIVGSRKDSQTYVNTKRKACAEVGIKSFDVGLPEEVSEADLISKVHELNSNPDVHGILVQLPLPKHINEEHILGAISIDKDVDGFHPLNIGKFLPCTPKGCLELLARSGVKIKGQRAVVVGRSNIVGLPVSLLLLKADATVTTVHSHTKDPEAIIREADIVIAACGQAHMIKGNWIKPGAAVIDVGTNAVSDYRLVGDVDFAEASKVAGFITPVPGGVGPMTVAMLLRNTVDGAKR......... 295
388 0.000e+00UniRef50_Q7UNN9 Bifunctional protein FolD n=2003 Tax=root TaxID=1 RepID=FOLD_RHOBA  ali  30  6..LDGKKIAAEIRSEVAADVNPPPQLAAVLVGEDPASQVYVRNKERACAKAGIASRLDRMPAATTQAELLAKVAELNADPAVSGILVQLPLPSGIDERAVLDAIDPIKDVDAFSPVNRPRFLPCTPHGIVQLLHRTGIETSGKHVVVVGRSDIVGKPMAMMLAQKNATVTIAHSRTSNLAEICRQADILIAAVGRPEMITAEMIQPGAVVIDVGINRVGD-KLVGDVAFDEAEAVASAITPVPGGVGPLTIAMLLHNTLMAAKMQ........ 296
389 0.000e+00UniRef50_P18155 Bifunctional methylenetetrahydrofolate dehydrogenase/cyclohydrolase, mitochondrial n=223 Tax=Euteleostomi TaxID=117571 RepID=MTDC_MOU  ali  30  39.VISGRKLAQQIKQEVQQEVNKRPHLSVILVGDNPASHSYVLNKTRAAAEVGINSETIVKPASVSEEELLNSIRKLNNDENVDGLLVQLPLPEHIDERKVCNAVSPDKDVDGFHVINVGRMCPATPWGVWEIIKRTGIPTLGKNVVVAGRSKNVGMPIAMLLHTDDATVTISHRYTPQLKKHTILADIVISAAGIPNLITADMIKEGAAVIDVGINRVQDPKLVGDVDFEGVKKKAGYITPVPGGVGPMTVAMLMKNTIIAAKKVLRPEELEV 339
390 0.000e+00UniRef50_K2GDF1 Bifunctional protein FolD n=6 Tax=Bacteria TaxID=2 RepID=K2GDF1_9BACI  ali  32  5.IIYGSELAQEIRSELKSEVGIHPKLSVIIIGDDPASKSYVRGKQKASNKIGMDADLWEYDSTITEPELLNKIEELNNEKSVHGILVQLPLPEHIEDQKVIEAISPEKDVDGFHPISIGKMMPCTPHGIIVMMERAGIELEGKHAVILGRSNLVGKPVGQLLLNKNATVTYCHSKTEDAQNITKQADILIVAIGKPSVISAEDIKSGAVVIDVGVNRV-DGKLTGDVDFESVKEKASYLTPVPKGVGPMTITMLLHNTIEAAKRIHQ...... 282
391 0.000e+00UniRef50_E7GFR0 Bifunctional protein FolD n=19 Tax=cellular organisms TaxID=131567 RepID=E7GFR0_9FIRM  ali  31  1MIIDGKAISLKRKDELKKKIKRIPKLTVVLVGDNQASQTYVRNKEKACAYVGMLSEIIRLDDTINEQELIQVITGLNQDQSVDGILVQLPLPSHIHEERILDLIDPSKDVDGFHPSNQKGLVPCTPQGMMVLLDEIGFDLTGKEVVVVGRSNIVGKPVALLCLQKNATVTIAHSRTQNLKNVCQRADVLIAAIGQTKFFNKDYIKKGAVVLDVGMNRDENKKLCGDVDFKDVEDIASYITPVPGGVGPMTIAMLLENTLLAYNQR........ 279
392 0.000e+00UniRef50_UPI000D7C81ED bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase n=1 Tax=Xylophilus ampelinus TaxI  ali  29  6..IDGNALSRQLRADVARRRGTTPGLAVVLVGDSPASQVYVRNKVKACEDNGLHSVLEKYDADLSEADLLARVDALNADPAIHGILVQLPLPRHIDAQKVIEAISPEKDVDGFHVASTSGFWPCTPYGCMKMLESIGMDLRGKHAVVIGRSNIVGKPMALMLLAQNATVTVCHSATPDLGAFTRQADVVVAAVGKRDVLTADMVKPGAVVIDVGMNRTDEGKLCGDVDFAGVSEVAGWITPVPGGVGPMTITMLLVNTLEAAER......... 308
393 0.000e+00UniRef50_K4D2Y4 Uncharacterized protein n=56 Tax=Eukaryota TaxID=2759 RepID=K4D2Y4_SOLLC  ali  28  11.IIDGKAIAQTIRSEIASEVGKVPGLAVVIVGNRKDSQSYVNMKRKSCAELCIKSFDIDLPEDVAEAEVISKVHELNADPDVHGILVQLPLPKHINEEKVLCEISLEKDVDGFHPLNIGKFNPCTPKGCIELLVRSGISIKGKNAVVVGRSNIVGLPVSLLLLKEDATVTVVHSRTKEPEKIIREADIIIAAAGQAMMIKGSWIKPGAAVIDVGTNAVDDYRLVGDVDFQEACKVAGWITPVPGGVGPMTVAMLLKNTLDGAKR......... 295
394 0.000e+00UniRef50_A0A0M2NGY7 Bifunctional protein FolD n=39 Tax=cellular organisms TaxID=131567 RepID=A0A0M2NGY7_9FIRM  ali  31  5.ILSGKELSAEIREQLKQRVGITPGLAVIQVGDDGGSTIYVNNKEKACAEVGIYSEVNRLPEETTQEELLAMVDQYNNNPKIHGLLVQLPLPSHIDETEILKNINPHKDVDGFHVQNLPGLVACTPKGIIKLIKKSGIDLTGKNAVVIGRSNIVGKPVAVLLLNENATVTICHSKTKNLPEVCAQADVLVAAIGRPEFVTKEFVKPGAVVIDVGTSRV-DGKLKGDVKFAEVSEVAGYITPVPGGVGPMTITMLMENTVDAGEL......... 280
395 0.000e+00UniRef50_I2AXP2 Bifunctional protein FolD n=2 Tax=Francisella noatunensis TaxID=657445 RepID=I2AXP2_FRANT  ali  31  289.LIDGKKLSIDLKERLKEQTGIVPKLVAIIVGDDPASKTYVGSKEKACEKVGINSEVITLPEVTTEQELLELIDKLNNDSSVHAILVQLPLPTHINKQKVIYAIKPEKDVDGFHPANIGRLQSCTPKGILTMLKEYGIQTEGAHAVVVGASNIVGKPVSQLLLNAKATVTTCHRFTKDLKSHTTKADILVVAVGKPGFITADMVKDGAVVIDVGINHV-DGKIVGDVDFEAVKDKVSAITPVPGGVGPMTITELLYNTFQCAQELNR...... 568
396 0.000e+00UniRef50_Q3IF52 Bifunctional protein FolD n=210 Tax=root TaxID=1 RepID=FOLD_PSEHT  ali  32  5.IIDGKAIAKQVRSAVAQRVSRAPGLAVVLVGLDPASQVYVGSKRKACEEVGFISKSFDLPANTTEQTLLELIDELNNDQEIDGILVQLPLPEGLDVEKILERITPHKDVDGFHPYNMPALRPCTPKGIITLLDSTGVRYKGLHAVVVGASNIVGRPMALELLLAGCTTTVCHKFTQDLETHVRRADLLVVAVGKPEFIPGDWVKEGAIVIDVGINRLDSGKLVGDVEYSVAEQKADFITPVPGGVGPMTVASLIENTLEACEKYH....... 283
397 0.000e+00UniRef50_A0A2E4FXH7 Bifunctional protein FolD n=1 Tax=bacterium TaxID=1869227 RepID=A0A2E4FXH7_9BACT  ali  29  4.ILDGKATAEAIINQLKSENSRPPGLAVVLVGDNPASHAYVRTKKTMCARVGIQSLDYQLPATVSQSELESLIHDLNGNDHVDGILVQLPLPKHIDEAMVINTISPTKDVDGFHPYTVPTFRPCTPYGVVKLLEHYGIETTGKHAVIVGRSNIVGKPMAALLVQASATVTIAHSKTQDLPSIVRQADIVVAAIGKPHFITADMIQPGAVVIDVGINKVSDYRLVGDVDTEAVLPIASAITPVPGGVGPMTVALLMHNTLEAFKQR........ 288
398 0.000e+00UniRef50_A9SGC7 Predicted protein n=19 Tax=Eukaryota TaxID=2759 RepID=A9SGC7_PHYPA  ali  27  16.VIDGKSIAGQIRKELKETVGKVPGLAVVLVGTRKDSETYVRSKKKACEEVGFASFGVTLPEDATQEEIVNCVNQFNDDPEVHGILVQLPLPKHINEEAVVGAVSFEKDVDGFHPINKPLFVPCTPKGCIELLLRSGVELKGKRAVVIGRSNIVGTPAAQLLQRQNATVTVVHSATTNPAEIVREADIVVAALGKAEFVRGDWLKPGAVVIDVGINAVDDYRLVGDVCYKEASQVASMITPVPGGVGPMTIAMLLANTLDAAKRS........ 301
399 0.000e+00UniRef50_N9VDW4 Bifunctional protein FolD n=22 Tax=cellular organisms TaxID=131567 RepID=N9VDW4_CLOIN  ali  29  4.ILYGSEIAKDIRDELREKGKRIPKLVVILVGDNPASLSYVTGKEKACREIGMENILLRLQEDTTEEALLAEIHRLNTDTSIDGILVQLPLPKHMDEHKVLFAIDPQKDVDGFHPYNIGKLMPCTPKGILRMLDTAGYDLSGLRAVVIGRSNIVGKPVAQLLLNRNATVTICHSRTRNIEEICAEADILIASVGSPRLVTADWVKKGAVVIDVGINRV-DGRLCGDVDFERVKDKTAVITPVPKGVGPMTIAMLLENTLESYRKHR....... 282
400 0.000e+00UniRef50_A0A1A5V9W7 Bifunctional protein FolD n=9 Tax=Lactobacillales TaxID=186826 RepID=A0A1A5V9W7_PEDAC  ali  29  4.IIDGKALAAEIDLQTKAEVGIVPHLAVVLVGDDPASHIYVRNKKRRAEKLGIQSTVCQFPSSVTEATLLKEIDRLNHDASVHAILVQMPLPPQIDEFKVTLAIDPRKDADGFHPVNMGRPVACTPRGIMQMLHKYNINPEGKKAVVIGRSMIVGKPMAALLLNANATVTVAHSHTKNLSELTKQADILVVATGIAHFIKADQVKDGAVVIDVGMNRDQNGKLTGDVDFAEVSPKASFITPVPKGVGPMTITMLMRQTTDLTKWS........ 282
401 0.000e+00UniRef50_R6QEI7 Bifunctional protein FolD n=8 Tax=Bacteria TaxID=2 RepID=R6QEI7_9CLOT  ali  30  4.LIEGKVVAQKILENLSDEINKKPSLAVIIVGDDPASKIYVNLKKKKAQELGITSQVIEMNASVTEQELLDKIDELNNNKEVNAILVQLPLPAHINTQKVIEKISPIKDVDCFHPYNMGKIYPCTPKGIIRLLEYYDIEIEGKNAVVIGRSNIVGRPLGQMLLNSNATVTFCHSKTKDLAKITKTADILICAAGRLNLITRDMVKEGAVVIDVGMNRKEDGKLAGDVDFFNVETVASYITPVPGGVGPMTICSLMQNTFDLYKIQNEV..... 281
402 0.000e+00UniRef50_Q8EG21 Bifunctional protein FolD n=852 Tax=Bacteria TaxID=2 RepID=FOLD_SHEON  ali  31  5.IIDGKAIAQSIRTQLREQVQRVPGLAVILVGADPASQVYVGSKRKACEEVGFISRSYDLDTSCSEAELLALIDQLNDDPSIDGILVQLPLPAHIEDSKVIERIRPDKDVDGFHPYNVGRLRSCTPMGIMTLIKSTGVDTYGLDAVVVGASNIVGRPMTLELLLAGCTTTTCHRFTKNLEQKIRQADLVVVAVGKPGFIPGEWIKPGAIVIDVGINRLENGTLVGDVQYETAAQNASFITPVPGGVGPMTIASLLENTLYAAEQYH....... 283
403 0.000e+00UniRef50_Q8Y7C5 Bifunctional protein FolD n=62 Tax=cellular organisms TaxID=131567 RepID=FOLD_LISMO  ali  28  4.IIDGKKLAKEIQEKVTREVGKQPGLAVVLVGDNQASRTYVRNKQKRTEEAGMKSVLIELPENVTEEKLLSVVEELNEDKTIHGILVQLPLPEHISEEKVIDTISFDKDVDGFHPVNKDSFVPCTPAGIIELIKSTGTQIEGKRAVVIGRSNIVGKPVAQLLLNENATVTIAHSRTKDLPQVAKEADILVVATGLAKFVKKDYIKPGAIVIDVGMDRDENNKLCGDVDFDDVVQEAGFITPVPGGVGPMTITMLLANTLKAAKR......... 279
404 0.000e+00UniRef50_R5HD33 Bifunctional protein FolD n=16 Tax=Bacteria TaxID=2 RepID=R5HD33_9FIRM  ali  31  5..IDGKAIAAQIKQELKEQVNITVTLAVIQVGQDPASCVYVRNKQRTCEELGIHSLSYELEETTSEEKLLSLIQELNAREDVDGILVQLPLPGHINEKDVLNAIDPAKDVDGFHPYNEEGFVPGTPAGIIELLKRSDIRIDGKECVVIGRSNIVGKPIAQLLLAENGTVTIAHSRTVNLKEVTKRADILVVAIGKRQMIDAEYVKPGAAVIDVGIHRDEANRLCGDVDYESVFPVASAITPVPGGVGPMTIAMLMKNCIESRRRR........ 280
405 0.000e+00UniRef50_A6Q2W6 Bifunctional protein FolD n=55 Tax=cellular organisms TaxID=131567 RepID=FOLD_NITSB  ali  32  3.ILDGKKLSQKIKESIKKEVDIIPGLAVILVGDDPASHTYVKMKARACKDVGIYSIVHEMPESISQKEIEETISMMNKNPNIDGILVQLPLPKHIDTTKILELIDPAKDVDGFHPYNFGRLMPCTPLGVMELLDEYGIDVKGMNACVVGASNIVGKPMAALLLNRFATVDICHIYTKDLAEHTKKADIIAVGVGKPNLITADMVKERAIVIDIGINKVGN-KIVGDVDFENVSKKASYITPVPGGVGPMTIAMLLKNTIKAAKQRKRS..... 282
406 0.000e+00UniRef50_U5P6I0 Bifunctional protein FolD n=128 Tax=cellular organisms TaxID=131567 RepID=U5P6I0_9STRE  ali  27  4.VIDGKALAVKLQARLKEETGEVPGLVVILVGENPASQVYVRNKERSALAAGFRSEVVRLPEATTQEELLALIDRYNQEPLWHGILVQLPLPAHIDDEAVLLAIDPNKDVDGFHPLNMGHLWPSTPAGIMEMFREYDIDVEGKSAVVIGRSNIVGKPMAQLLLAKNATVTLTHSRTHHLAKIARKADILVVAIGRAKFVTADFVKEGAVVIDVGMNRDENGKLCGDVDYDTVAPLASHITPVPGGVGPMTITMLMTQTYEAAVRALK...... 283
407 0.000e+00UniRef50_A0KJD4 Bifunctional protein FolD n=612 Tax=root TaxID=1 RepID=FOLD_AERHH  ali  31  5.IIDGKQVAQTIRNQVAAQVKRAPGLAVILVGVDPASQVYVGSKRRACEEVGFISRSYDLDATASQEELLALIDKLNEDADVDGILVQLPLPAHCDTTQVLERIRPDKDVDGFHPYNVGRLRPCTPKGIMTLIEATGVKTHGLHAVVVGASNIVGRPMTLELLLAGCTTTTCHRFTQDLEDQVRRADLLVVAVGKPNFIPGEWIKPGALVIDVGINRLADGSLVGDVEFETARNHASFITPVPGGVGPMTVASLMENTLSACQ.......... 280
408 0.000e+00UniRef50_A0A1K1NYR5 Bifunctional protein FolD n=19 Tax=cellular organisms TaxID=131567 RepID=A0A1K1NYR5_9FIRM  ali  30  4.IIDGKQVSADVKARIAEEKGIEVGLAVVIVGDDPASKVYVRNKKLACEAVGFKSYEYALPAETTEEQLLELVDALNNDPKVNGILVQLPLPKHLNDKVIIDNIKAEKDVDAFHPVNVGKIMPCTPAGVMELIHSTGVEVSGKQCVVIGRSNIVGKPMAMLLLHESGTVTVCHSRTKNLKEVCAQADILVAAVGRPKMITADYIKEGAVVIDVGMDRDENGKLCGDVDFEDCKDKAGWITPVPGGVGPMTIAMLMQNTLTAAKQQN....... 282
409 0.000e+00UniRef50_A0A2I0INZ4 Uncharacterized protein n=2 Tax=malvids TaxID=91836 RepID=A0A2I0INZ4_PUNGR  ali  27  2................KEATGVVPGLAVILVGDRAESATYVRNKKKACGHVGINSFEVHLPANSSEEEVLKYISEFNADPNVHGILVQLPLPSHMNEQNVLNAVSMEKDVDGFHPLNIGQFVPCTPKGCMELLHRYGVNIKGKRAVVIGRSNIVGMPAALLLQREDATISIVHSRTSSPEEITRQADIVIAAVGQANMLRGNWIKPGAVVIDVGINRVEDYKLVGDVCYEEVCKVASAITPVPGGVGPMTIAMLLSNTLASAKRIHNF..... 268
410 0.000e+00UniRef50_P51696 Bifunctional protein FolD n=501 Tax=root TaxID=1 RepID=FOLD_PHOPO  ali  30  5.IIDGKIISQTVRQEVAARVKRAPGLAVVLVGQDPASQIYVGSKRKACEEVGFISKSFDLPSSASEQQLLDLIDELNQDPTMDGILVQLPLPAGMDCTRILERIDPEKDVDGFHPYNIPKLRSCTPKGIITLLERYNIEVRGKHAVIVGASNIVGRPMTLELLLAGATTTTCHRFTQDLEGHIRQADILVVAVGKPNFIPGGWIKEGATVIDVGINRLENGKLCGDVEFDVACQRAKYITPVPGGVGPMTVASLIENTLLACEQYH....... 283
411 0.000e+00UniRef50_A0A1M7Y2F2 Bifunctional protein FolD n=29 Tax=cellular organisms TaxID=131567 RepID=A0A1M7Y2F2_9FIRM  ali  30  4.IIDGKKISSDIKEELKEEVGISVTLAVVQVGNDSASTVYVGNKKKACEYIGIGSLSYELKEETTQEELLSLIKELNERKDVNGILVQLPLPKHIKEDVIIKAISPEKDVDGFHPENQKGFVSCTPAGVIELLKRSGITISGKECVVIGRSNIVGKPMAALLIREDATVTICHSKTVDLKKVAKRADILVAAIGKPKFINSEFIKEGAVVIDVGIHRLEGKKLCGDVDYDDVFDLVSAITPVPGGVGPMTIAMLMKNCVESAKLKNE...... 282
412 0.000e+00UniRef50_A0A2N1R074 Bifunctional protein FolD n=9 Tax=cellular organisms TaxID=131567 RepID=A0A2N1R074_9SPIR  ali  30  5.IIDGKKIAQDIRAEIKSKVGLTPGLAVILVGEDPASVSYVTGKEKALAEAGMLSFAHHLPGSTSQNELLDLVRACNADDRVHGILVQLPLPPQIDEKAVIAAISPEKDVDGFTPINIGRMNPCTPAGIIELIRRSGVSTKGANAVIVGRSNLVGKPLMNLLVRKNATVTLCHTGTKDLASYCRNADILIACAGKAGLISGDMVKPGACVIDVGVNRVEDSRLKGDVDFESAAKVAGWITPVPGGVGPMTITMLLANTVEAASRRAQ...... 291
413 0.000e+00UniRef50_Q74EU7 Bifunctional protein FolD 2 n=3162 Tax=root TaxID=1 RepID=FOLD2_GEOSL  ali  28  4.IIDGKAIAEKIRADLAAQVGITPGLATVLVGSDPASEVYVRMKGDACNKLGMHSVKITRPAETTEEELLALINELNNDPAIHGILVQLPLPPQINADRVLEAISPAKDVDGFHPYNVGRFQPCTPYGVMVMLQEAGVDLAGKEVVVVGRSNIVGKPVALMCLQRNATVTICHSKTRDLPGRVRAADVVIAAVGVPEMIKGDWIKEGAVVIDVGVNRVGEKKLVGDVEFAAAAERASAITPVPGGVGPMTITMLLHNTLEAAKM......... 279
414 0.000e+00UniRef50_D8LQ10 Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LQ10_ECTSI  ali  28  150.IIDGKATAAAIRAELKAEVGPPPGLAVVLVGDRRDSATYVRMKKKACDEIGVSSFGFDFPEDVTQDTLLACVGELNSRPDVHGILVQLPLPKHIDEQSVLQAITPSKDVDGLHPANLDFHVPCTPQGCIELLDRYGVEISGKRAVVLGRSNIVGIPVSMLLMHRDATVTMTHSKTVDIASVVREADIVVCAAGRAEMVKADWIKPGAAVIDVGINSVDDYRLVGDVDFKAAKEVAAKITPVPGGVGPMTIAMLLRNTVNGATR......... 448
415 0.000e+00UniRef50_J0L6V1 Bifunctional protein FolD n=26 Tax=cellular organisms TaxID=131567 RepID=J0L6V1_9HELI  ali  33  3.LLDGKKLSSEIKEELKNEYSRKVGLAVVLVGNDKASELYVSMKKKACEYVGINSISVELPEDISQEELENRVLELNIDSKVDGILVQLPLPKHLNTDKILELIDPKKDVDGFHPTNLDTFAPCTPLGMVELLDKYEIDIQGKNVVVVGASNIVGKPIASLLLNRNATVEICHIYTQNLKEHTLKADILVVAVGKENLIGADMVKDGVVVLDVGINKRADGKIVGDVDFENVSKKASYITPVPGGVGPMTIAMLLKNTVKSAKIR........ 276
416 0.000e+00UniRef50_A0A2H5WUQ3 Bifunctional protein FolD n=38 Tax=root TaxID=1 RepID=A0A2H5WUQ3_9BACT  ali  29  15LLLNGKVVAQQIRESLREQVGVQPCLAVMLVGDDPASHTYVRTKARACESVGIRSIVHHYPASVSQVELEAQIDAWNADPTVHGVLIQHPVPPPLDESALLRRLSPQKDVDGITPASEEAFGACTPLGIITLLDAYRIPIEGKHAVVVGRSLILGKPTALMLLNRHATVTVCHSRTRDLSFHTRQADILVAAVGKPEFITGEMIKPGAVVIDAGYNRVEGRMGVGDVHFDSAARVASAITPVPGGVGPMTVAMLLQNTLRAARNALES..... 296
417 0.000e+00UniRef50_A9BWT7 Bifunctional protein FolD n=188 Tax=root TaxID=1 RepID=FOLD_DELAS  ali  30  5.LIDGNALSRQLRAEVAQRRGTTPGLAVVLVGDNPASQVYVRNKVKACEDAGFHSVLEKYDASMTEAELLARVEALNNDPSIHGILVQLPLPAHIDDHKVIETISPLKDVDGFHVASEVGFKACTPYGCMKMLESIGMDLRGKHAVVIGRSNIVGKPMAMMLLAANATVTICHSGTADLAAMTRQADIVVAAVGKRNVLTADMCKPGAVVIDVGMNRNDEGKLCGDVDFDGVKEVAGFITPVPGGVGPMTITMLLVNTMEAAER......... 281