current user: public

If you have questions about the server, please let us know.

Query: gi|12044869|ref|NP_072679.1| chaperone protein DnaJ (MG_019) [Mycoplasma genitalium G37], from M.genitalium

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .
# E-value Template Links and tools%idFirst MAAGKRDYYEVLGISKNASSQDIKRAFRKLAMQYHPDRHKAENETTQKQNEEKFKEVNEAYEVLSDEEKRKLYDQFGHEGLNASGFHEAGFNPFDIFNSVFGEGFSFGMDGDSPFDFIFNRSKKRQQQIVVPYNLDIALVIEINFFEMTNGCNKTIKYERKVSCHSCNGFGAEGGESGLDLCKDCNGNGFVIKNQRSIFGTIQSQVLCSTCNGQGKQIKVKCKTCRSNKYTVTNQIKEINIPAGMYSGEALVDESGGNEFKGHYGKLIIQVNVLASKIFKRSDNNVIANVLVDPMVAIVGGVIELPTLEGIKEFNIRPGTKSGEQIVIPNGGIKFSKSFKRKAGDLIIIISYARPCEYTNLELKKLREFIKPNQEVKQYLNTLKNEYKTLast
1 0.000e+00UniRef50_Q6A997 Chaperone protein DnaJ 1 n=115 Tax=root TaxID=1 RepID=DNAJ1_CUTAK  ali  26  4......DYYEILGVSHDASADEIKKAYRRKAMKLHPDV-------AGPGSEEEFKKVQEAYEILQDPQKRAVFDR-------GGDPNARMGGFGEGGFSSAGFDFTNLVDAMFGGSSPFGSGGGRGPRSRTRRGQDALVRMRLSLAEAVFGVTKSLEVDTAVVCPKCQGKGAQSGSEPV-TCDTCQGRGEVITVQRSFLGDIRTSQPCPTCHGYGTVIPDPCQECSGEGRVRTTRTINVKIPAGVADGNRIHLRGEVGPGGGPAGDLYIEMTVSPHDVFTRHGDDLEMVVTIPMTAAALGTKVPMHTLEKTVTVEVPAGTQSGTRIVVSERGVPRLRRNG--RGDLGVTFIVQTPTKLDSHQKDLLRQLAEAREETRGMFSRIKEAF.. 390
2 0.000e+00UniRef50_A0A1L6MYQ1 Chaperone protein DnaJ n=1 Tax=Pajaroellobacter abortibovis TaxID=1882918 RepID=A0A1L6MYQ1_9DELT  ali  27  1MPEGQPNYYETLEVDRSANAEEIKTAFRKLAVKYHPDRNQDD-----PEAGNKFKAINEAYQVLSDPKQRARYDQMGSTWDRSPFEEQ---NPFSDFTSV---------SPEGIFDELFNFFGGHSRPSG-----NLQTQIEISLEEAAFGCEKKVSYERRVICPACRENRQHT-RGRTAVCPTCQGNGQLLSSS-----FFVFTRICPSCQGSGRVIPAVCNQCNSTGLITITNTLTVTLPPGIEDGTANTVTRAGDHPDHPPGNLELRIAIRPHPIFQRMGHDIECKATIGFPQAALGTEIEVPTLEGARKLRIPAGTQPNTVLRIKGKGLPHHN--QSQRGDQLVTIHIQVPISLTSYQQELLEKLALSLDGKESLFQRVRRFF.. 366
3 0.000e+00UniRef50_UPI0004DD928B molecular chaperone DnaJ n=1 Tax=Plasmodium vinckei vinckei TaxID=54757 RepID=UPI0004DD928B  ali  32  67..ASNQDPYTVLGLSRNATTNEIKKQFRLLAKKYHPDINP------SPDAKQKMADITAAYELLSDPKKKEFYDKTGMAD-DSNYSNHASSNFEGAFSG-FGDASFMFTDFAEMFTNMAG------NKNSSTRGEDIQTEITLKFMEAIKGCEKNIRLNVKVSCNNCNGSGKKPGTN-LTICKVCNGSG----VQRMERGPIIIGVPCRTCSGNGQIINNPCKHCSGSGVKFQTKNITLDIPPGIKKGMQMRIPNQGHSGGGKNGHLFVTINIEPHKVFKWIDDNIYVDVPLTIKQCLLGGIVNIPTLNGNMDLLIRPKTYPNSEKVLKGKGPSKVDSHTN--GDLIVKFSLSIPEKLTQRQIELIEEFNRIE................ 418
4 0.000e+00UniRef50_A0A2H5UVS1 Chaperone protein DnaJ n=3 Tax=Archaea TaxID=2157 RepID=A0A2H5UVS1_9ARCH  ali  30  1MAADGKDYYEILGVPRNASKEEIKRAYRRLALQYHPDRNK------SPDAEEKFKEISEAYAVLSDDEKRRLYDMYGRAGVSSTYFRSTRFDFEELFRDL------GLGDFESIFERFFGFRGRDRGP------EPTRVELEISLEDAFRGGERVFTINLRDVCDRCEGSGAEPGW--LEKCRVCNGSGQRVERRQTGFMYFTTVTTCRACGGLGQTVKKRCEKCGGGGTVVRPSQVRVHVPPGVNDGDVLVLRNMGDRMGGRRGDLLVQFRVRPHPYIRRVGDNLVVNLPVAVSEVVSGRRIVVPTLDGDVEVKLSPETRP---LILRG----RGMPGGRGRGDLEIRVEVTVPDNLSREVKNLYERLSLLEG............... 356
5 0.000e+00UniRef50_A0A0F9Z2A5 Chaperone protein DnaJ n=1 Tax=Candidatus Peregrinibacteria bacterium GW2011_GWF2_33_10 TaxID=1619065 RepID=A0A0F9Z2A5_9BACT  ali  31  3......NLYNILGVDKNASDGEIKKAYRKLAQKHHPDRNKDXXXXXXXXXXX---------------QKRANYDRFG--GENESQFGGFNSNGFD-----FNQNADFAEGFQDIFETFFGGGGKRTHKNYGQKGRDLESSITLTFEEAAFGIEKEMTISRMQTCSQCNGTGAEPGTS-VTSCPDCHGTGEISAIRQTLLGQIRTTQSCPHCSGSGRVVKTKCSQCRGKSREYVEKKLNIKIPAGVLNGSTLKIANEGDNGGGKTGDLYINIQVQAHEYFQRDNYDVLLDQKIHVLQSILGDNIEVPTLHGPIALKIPAGTSHDQTFRLKSYGIPKLN--KEGRGDQYVTIKVVIPHKLSSKEKSLYEEVAKESGKDQGFLKKI...... 374
6 0.000e+00UniRef50_A0A1F3AMG6 Molecular chaperone DnaJ (Fragment) n=9 Tax=Bacteria TaxID=2 RepID=A0A1F3AMG6_9PROT  ali  35  2...SKRDYYEVLEVGKTASADELKKAYRKLAMQYHPDRNPGDQ-----DAERKFKELNEAYEVLKDDQKRAAYDRFGHTAFQGGGGGGPXXXX---------XXXXXXXXXXDIFEEMFGMSNGGRRGEANQRGADLRYNMEISLEDCHTGKDTEIKVPTSVPCDTCKGSGSEGGAAPV-TCPTCDGRGNIRAQQ----GFFTIQRTCPTCNGAGRVIKSPCKKCGGSGRTRHEKTLSVSIPPGVEDGTRIRLSGEGEAGGAGPGDLYIFLTIKPHRLFQREGANIYCRVPIPMTTAALGGTVEVPSID................................................................................ 292
7 0.000e+00UniRef50_A0A1X7V3F9 Uncharacterized protein n=4 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7V3F9_AMPQE  ali  29  91....KEDYYQILGIPRTADAKEIKKAYYDLAKKYHPDRNPDN-----PEAAKKFTKIGEAYEVLSNSEKRKRYDYSGFSEFSDEAGPGHQGNPFEIFRQFFGDF--------DMFGQDIFGQDARNSQT---------LHLSLSFMESVKGCSKELSMRVQAMCERCSGSGGEPGT-KTEVCPYCRGSGEEVIST----GFFKMKSVCRNCHGQGRVITVRCRSCMGKGTTVKTRSVNVQVPAGVSDGQTLRVPGHTEA--------YVTLRVSSSDTFRRDGFDIHSDANVSYTQAVLGGVAKTPGLNGTLDLKIPAGIQSHHRLRLSGRGIPRLNGYGN--GDHYIHIRIKVPKNLTSEQKTLIEELAQTED............... 430
8 0.000e+00UniRef50_A0A0K3C5W8 BY PROTMAP:  ali  30  81.....KNPYSVLGVGKDASTSEIKKAYYQLAKKYHPD------SSKEPGAKEKFVEIQEAYDTLSDDKKRADFDRFGSAGFDSDAFARATSSFGGAGFGDFFGGGAGGASGADIFESLFGAFGRGGPRQTQPVGDDIDVSISVPFIQAAKGTSKTIQISPVVDCHTCHGSGLKEGMKK-TTCGSCGGTGTRTFTIQSG---FQMASTCAACGGSGSVAPSNCGTCAGVGKVRERRSVEVKIPPGVDDGMRIRLDGKGDAGKGRNGDLFVRINVQPSKVFTRQGSNLYETVSVPFYTAILGGRAPVKTLERDVEVKVPQGTQPGEEMVLRGRGVKKL--YKEEYGDLIVRFNVSMPRSLTPIQRMILEQYVRETEE.............. 450
9 0.000e+00UniRef50_A0A1D6HNN0 Molecular chaperone Hsp40/DnaJ family protein n=7 Tax=Mesangiospermae TaxID=1437183 RepID=A0A1D6HNN0_MAIZE  ali  32  62.VRASADYYATLGVPRAASNRDIKAAYRKLARQYHPDVNK------EPGATEKFKEISAAYEVLSDEKKRALYDQYGEAGVKSAVGGSGGANPFDLFETFFGASMGG-------FSGMDQSAFRTSRRSTAIQGEDIRYDVILGFTEAIFGTEKDIILSHLETCDTCGGSGSKAG-SKMRICSTCGGRGQVMRTEQTPFGLFSQVSICPTCAGEGEVISEYCRKCSGEGRIRVRKEIKVKIPPGVSKGSTLRVRGEGDAGGGPPGDLFVCLDIEEPSDIKRDGINLYSTVSISYLEAILGTVMQV.................................................................................... 356
10 0.000e+00UniRef50_A0A1F9ZG95 Chaperone protein DnaJ n=9 Tax=cellular organisms TaxID=131567 RepID=A0A1F9ZG95_9EURY  ali  28  2...AKRDYYEVLGVPRSASKDEIKRAYRKLAKEYHPDMAKGDXXXXXXG-------------------KRKIYDAYGHEGLKQQVWGGQDFDWSDLFGEDFFASFFGSRSPFGGGSLIEDLFXXXXXXXXXXXXEDLRVDVEVGLEDVYRGVRKEFRIPHAVPCKECRGTGARGG--RLTTCPQCNGQGQVSRSQTRGFSQFISITTCHRCQGRGQLAESPCAACGGSGRVETTSTLHVEIPAGAPDGLRLRVSGKGEAGGAPAGDLYVVVRVRDSPPFQRDGNDILLEWPATFPQAALGADIEVPTLDGAARLRVPAGTQTHTVFRLRGKGLPDLETER--RGDQLVRLVVVTPEKIGAEERRLLDKLDALLGDKSSFFDRFK..... 390
11 0.000e+00UniRef50_D3FAU9 Chaperone protein DnaJ n=12 Tax=Actinobacteria TaxID=201174 RepID=D3FAU9_CONWI  ali  28  1MPTAS-DYYDRLGVARDADANEIKKAFRKLARELHPDVNSHD-----PEAETKFKAAAEAYEVLSDPERRATYDRYGADGLRNGGFQPSGFGS---FSDIF-----------DAFFGGDVFGGAGGARGGPVQGGDVAVTATIELADVATGASVEVSYDAVVRCETCNGNGAEPGT-PIEACDRCGGTGQLRAVTRTPFGQVVRATACDVCGGDGRVPKSPCKSCQGRGRRVSRLTVGVDVPAGIADGQRIRLSGRGHAGGGPPGDLYVLVRVNEDARFVRDGDDLVTVVDVVAPLAALGTSLEVPTLDGPLELEVPAGIQPHETLTLRGRGLPALRRGRRGD--LRVVVNVVIPRRLSGEQRELLERLAESLGEEEGVFSKLKRAF.. 371
12 0.000e+00UniRef50_A0A2N2JCT9 Chaperone protein DnaJ n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-14 TaxID=2013741 RepID=A0A2N2JCT9_9DELT  ali  29  1MAEAKRDYYEVLGVARDADDAALKSAFRKLAREWHPDRNQ------SAGAEERFKEVSEAYGVLSDAQKRAAYDRFGHRGLEAGGGGGG---GFQDFSDM-----FGGGGFGSIFDTLFGGGGRGRQPSGPRPGRNATIEIAVSLERVATGGVEQLKLVRRAECLTCSGTGAKPGTE-PKRCQGCRGTGQRVVERREGPMLFRQVVGCPTCGGTGSVIEKPCKKCKGEGQVNEEETLELKIPVGIADGAVLRVPGRGEASGGIPGDLHVVVH-ARDERFVRRGAHLGVTEPLSALDATLGTRLTIETPTGPVEVDVPAGTQHGTTLHVAGAGLPEFRS--SGKGDLFVTVEVDVPVDLSVEEQDLYERLRALQQARR............ 365
13 0.000e+00UniRef50_R6EB92 Chaperone protein DnaJ n=11 Tax=Bacteria TaxID=2 RepID=R6EB92_9BACE  ali  32  2..AEKRDYYEVLGVEKNASTDDIKSAFKKLALKWHPDRWXXXXXXXXXXXXXXXXXXXXXYEVLSDPDKRAKYDRFGFSGAAAGGYGNAGGDINDILKDLFGSGFDFSXXXXXXXXXXXXXXXXQRSQQRVMRGRDIRTRVRLTLEEIAKGVTKEVTIERYEQCPDCAGKGTLN-ASDVKTCPVCHGSGQEQRVANSFFGQTVTYTTCSRCGGEGKIVTNPCRSCGGTGLVRKRVTVKVNIPAGVEDGMQLTLQGQGHAAGGINGDLLVVIEELPHASLKREGKNLFYSKIIPVTDAILGGETEIPCLDGTYKIKVEPGTQSGTIVRLRGRGLPAVKGYGSGVGDLYVKYLVWIPKKLKSSEKSAIESMRDLSREDRNLFDKMKENF.. 404
14 0.000e+00UniRef50_A0A1G0XD94 Chaperone protein DnaJ n=22 Tax=Bacteria TaxID=2 RepID=A0A1G0XD94_9BACT  ali  33  2...TKRDYYEILGVNRNASKDDLKKAYRKLAMEHHPDRNPNXXXXXXXXXXD----------------KKARYDRFGHEGMRSSGYSSPGFDINDIFSH-FSDIFGGGSIFDDFFGGSSRGRGQRRRTIGTP-GSDLRVTLKLTLDEIAKGATKKIKIKKHVKCDQCNGSGAESGTS-TKTCPVCQGSGEVKTVSRSVFGQFVNITTCSNCSGEGAVVDKPCKKCMGDGRVYEETTVKINVPAGVHEGSYMTMRGEGNFGGGPSGDIIVIFQEIPHEFFRREEDDIIYDLFISYPEAVLGADVDVPTLNGRARLKIDPGTASGKLLRMRDKGIKHLNS--SGYGDQIVRVNIDIPKRVNSKEKELLKELSEMPNIKGNPSSDEKNFFK. 379
15 0.000e+00UniRef50_L0PG51 Uncharacterized protein (Fragment) n=1 Tax=Pneumocystis jirovecii (strain SE8) TaxID=1209962 RepID=L0PG51_PNEJ8  ali  29  14...AMKDPYATLNLTKDATTADIKKAYFKLAKQYHPDTNKD------KGAQEKFLEIQQAYEILSDPKKRSKYDQYGTSAFEGEKFSTSGSSDFEDFGGFSNMKGFPFDDLFGAFG-FGGKSSTRSNVNEILVGDDVEVQTSISFMEAAKGGTKSIYINLMATCKTCSGTGLKSGQ-KRSACQRCGGTGTRVH---IMHGGFQVASTCEYCKGAGITIGSECWSCSGNGIIREKKAIKLDIPAGIEDGMRIRLAGEGNAPQAKNGDLYVRIRVMPHAIFRRKGSDIFHTVTIPMTTAALGGTIKVPTLDNDVELKVPSGTATGDVIVMNGKGIERLHSNG-MKGDIKYDFKVTIP.................................. 363
16 0.000e+00UniRef50_A0A218Z5T7 Uncharacterized protein n=9 Tax=leotiomyceta TaxID=716546 RepID=A0A218Z5T7_9HELO  ali  26  169..QATKNPYTVLGVDKNASAGEIKKAYYRLAKKFHPDTNKD------PKAKDKFAEAQSSYELLCDPQKKAAWDQYGAAAFDQGGNPAGFGGAGDAFRGGFGEGSGDGFSFEDLFKGFTGGRRTRSGQNPFQVGETIEVQTQISFAEAARGTSKTISIQPLTTCKACSGSGMKAGTNRTE-CKSCGGTGTRVH---FMSGGFQMASTCGVCGGQGVSIPNECRSCSGNGVVRERKTITVDIPGGIDDGMRLRLDREGDANPGIRGDLYVLVRVATDPKYRRSGADILYTATIPLTTGLLGGEVTIPTLDGDVKVKVATGTGTGDKITLGGKGMKRIDGKRGQ-GDLKVEFKISMPKYLSANQRTIVEMLADELGDKKRFMN........ 567
17 0.000e+00UniRef50_T2BPT9 Chaperone DnaJ, variant n=28 Tax=Tremellomycetes TaxID=155616 RepID=T2BPT9_CRYNH  ali  28  78.PASAKDPYDVLGINKDASSSDIKKAYYGLAKKWHPD------SSKEKDAKEKFHEIQAAYDILSDDKKRQAYDRYGSASTQEGFDPNFAHGAGGF-GGFQGFGPGFGDGASDLFESLFGGAFGGGSRQRPVRGDDLEVGVNLSFLEACNGVMRKVTVTPVIDCKTCTGSGLKPGEKK-SQCPACRGSGQRTFQVQ----GMVMASTCQTCGGTGSTIPKRCGECDGVGKVKEKKVLDVEIPAGVEDGMMIRVPGAGDSASGPPGDLLVRVLVKPSSVFRRQGVNLYHDAKVPLHIALLGGVIRIPTLEGDVDVKVKNGTQSGEEAVLKGRGVKSYGGRRNDRGDLIVGWKVQIPRSLTSFQRKILQAYAD.................. 446
18 0.000e+00UniRef50_A0A0D8HJ58 Chaperone protein DnaJ n=1 Tax=Acidithrix ferrooxidans TaxID=1280514 RepID=A0A0D8HJ58_9ACTN  ali  29  1MSANEKDYYSILGVDKSASEKDIRNAYRKLAKAYHPDAHPG--------SEEKFKELSSAYEVLGDAKRRSEYDSF----KDQSPFMPRTGGGGGGSEPGF---NFKVEDLGDVFGGLFNKG-RRNPTAGPQRGSDVDTSLSITFIESIEGLTTSVNVIGEAQCRTCHGTGAAPGSSPV-VCARCQGSGSVNENQ----GFFSFSQPCPACGGRGLRVDLPCNSCQGTGTVPSNRKLNVRIPAGVEDGQRIRLKQKGGPGGGPSGDLYITIKVGADPRFSRRGNDLVTTSKISFPQATLGTDIVVPTLRSSVKLRVPAGTKSGQVLRAKGYGV-APSGRRITPGDLLVTIEIVIPKNLSDEQRKLVEELARILPKE............. 360
19 0.000e+00UniRef50_A0A076NQ18 Chaperone protein DnaJ n=14 Tax=Corynebacteriales TaxID=85007 RepID=A0A076NQ18_9CORY  ali  29  8...ANKDYYGDLGVSSSASAADIKKAYRKLARENHPDSNPGN-----KAAEEKFKRVAEAYDVLGNEQERKEYDQFGRFGGGGSGFPGGFRTTQTDFSDVFGHPGAGDGGLGDLFGGLFNRGGAAGRNARPSRGADVETEITLDFREAAKGTTFPVELTGEAPCTTCHGSGSKDG--KTHRCGTCSGSGYVRENS----GAFGMARPCAECQGTGEIIEDPCTTCHGTGTVRRTRSITVRIPAGVIDGQKVRLAGQGEAGPNPAGDLFVHVHVREDAVFTRSGDDLEVTVPVSFGELALGGTVTVPTLEKRVRVKIPAGTPNGRTLRVKGRGVPRKSGKA---GDLLVTVEVAVPKDLDAAATSALRAYHQAERDS............. 380
20 0.000e+00UniRef50_A0A1V5XDW1 Chaperone protein DnaJ n=16 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5XDW1_9DELT  ali  29  2.....QDPYEVLGVPRDATADEIKAAFRKLAAKHHPDRNAGDVS-----ANERFKEINAAYQLLSDPKKRMMFDRFGAAGANASGANPFAGGMPFDFDL---SGVSLDGIFGDLLGAFGFGGKGDRG--------DVKKEVTIDFAEAAFGCEKEVTYERAELCERCHGSGAASG-ADTRTCSACNGRGRIRFQQPFLP--MAAERVCSRCHGTGREVLVPCVECRGEGMVRKKKTMLVQISPGIEHNASQVVARAGHPNKG-PGDLELTIKVRPHELFRREGDDVVCSVPISFPQATLGAEIEIPTLAGKGKLRVPSGTQSGTVLRLRGMGIP--RRVIGGRGDQLVEVSVEVPVNLSDRAKTLIQELAEVQPQRRTFMEKLRDLF.. 369
21 0.000e+00UniRef50_M0ZTF3 Uncharacterized protein n=29 Tax=Viridiplantae TaxID=33090 RepID=M0ZTF3_SOLTU  ali  28  10..SDNTRFYEILGVSKNASEDEIKKAYRKAAMKNHPDKGGDP---------EKFKELAQAYEVLSDSQKREIYDQYGEEALKEGMGGGGGHDPFDLFNSFFSGSPFGGGGGRRGQRERRG--------------DDVVHPLKVSLEDLYTGITKKLSLSRNVICSKCSGKGSKSGDS--MKCSGCEGTGMKVSIRQLGPGMIQQMQPCNKCKGTGETIKDRCPQCKGEKVVQEKKVIEVHVDKGMQNGQKITFPGEADEAPDVTGDVVFVLQQKEHPKFKRKGEDLFVDHTLTLTEALCGFQFILTHLDGRLLIKSNPGVKPDQFKAINDEGMPVYQRPF-MKGKLYIHFTVEFPDSLSLPQVQLLEAILPPRPTSQ............ 366
22 0.000e+00UniRef50_A0A1V6AV09 Chaperone protein DnaJ n=14 Tax=Bacteria TaxID=2 RepID=A0A1V6AV09_9BACT  ali  29  3.....RDYYEILGVGRSASDAEIKKAYRRLARKHHPDLNPND-----KAAEAKFKEISAAYEVLSDPKKKARYDQFGFAGERPPAYASGGFEGFD-FSDF------GGGSFRDLFQNIFXXXXXXXXXXXPERGEDLLYTMKVGFEDAVRGVQTKIRLNRRAACPACGGSGSKSGEA--KTCPTCRGSGKAFQQR----GYMKFSGVCPACGGRGTVAGRDCGDCRGQGTREMPETINVRIPAGVDTGSKVRIPRKGHAGLGGGPDLYIQIETLPHPLFRREGMSLHVKVPITVPEATLGAKIDVPTLDGPAVIRIPPGTKSGQRFRLKGKGAPQP--GARIRGDEFVEVMIVPPPFGDERVRDLMKKLEPLYGGSPR........... 366
23 0.000e+00UniRef50_M2M9U6 Uncharacterized protein (Fragment) n=13 Tax=Pezizomycotina TaxID=147538 RepID=M2M9U6_BAUPA  ali  27  11...ATKDPYKVLGVESGASAGEIKKAYYGLAKKYHPDTNKD------PKAKERFADAQSAYELLSDDKKKAAWDQYGAAAFDQGAGFDPSGGAGAGPGNPXSGGFGAEFNFEDLFSAFXXXXXXXXXQEEVMVGENIEVQTNISFMDAAKGVQKDIVITPLVQCKTCTGSGLKKGISR-SSCKSCDGTGTKVHFMQ---GGFQMASTCSTCGGTGVQIPKECGTCRGNGAVRERRTVTVDIPGGVEDGMRLRVMGEGDYPPGQAGDLYVFIRVSPDSKFSRNGSDVLYTASIPLTTAVLGGEISVPTLEGEVKVKVATGTGTGDKITLPGMGMKKLSSRRGNNGDLRVEFKVQMPKYLSVNQRTIVEMLADEMGDKS............ 406
24 0.000e+00UniRef50_A0A1F5AZN4 Chaperone protein DnaJ n=2 Tax=Candidatus Azambacteria TaxID=1752741 RepID=A0A1F5AZN4_9BACT  ali  30  2...AKKDYYHVLGVQKGSSEDEIKKAYRKLAHQHHPDKTGGN--------EAKFKEINEAYQVLSNKEKRAQYDTHGRTF--EGAGGGPGDFGGGGFQWDFGGA--GAEGFSDIFGDMFGFGGGARGGRSRASREDVQVALVIDLEDAAFGKEKEIQIKRQVECTHCGGTGAEP-KTDIATCDTCKGSGEVRKQFRTPFGVMAQAAVCSACHGRGKIPKHRCSSCGGDGILKETDTFRVKIPQGIDSGEAFGVPGKGNAAGGGTGNLYVVVTIVKHPKFTREGDDLHVKFPVTFSQAVFGDKVDLETLHGPIRLKIPAGIQSGTVIRVGGKGMPRKGGYG--KGDLLVMVQVRTPEKLSKRQ........................... 348
25 0.000e+00UniRef50_A0A2T2RID4 Chaperone protein DnaJ n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A2T2RID4_9ACTN  ali  26  1MV---RDLYEVLGVERDASEEDIKKAYRHKARQEHPDAGGDS---------EEFKEVTAAYEVLKNPEARANYDRYGDPRGPGGGGGGGDPDLQDLIDAFFXXXXXXXXX-----------XXXRGGRSGRRGGRDAIVDVALTLEEAAAGVRRDVEVTLPRECDTCGGSGAKPGSSGPTRCRTCGGAGEVQQVRRSVFGQVLTAGPCPDCEGVGQAVTDPCAACRGQGRREVTESVTVDVPAGVDDGTRLRLSGHGEAGGTASGDLYVRVRVTPHEVFERDGNDLHCELRLPMTQAALGAELKVSTLYGEEKLSVPAGTQTGDVLALRRQGMPKL-SGGGQRGDLRVHCRVETPTRLSEHQRDLLGQLATERDEERGFLGRLREVF.. 377
26 0.000e+00UniRef50_Q0KKV0 DnaJ protein (Fragment) n=26 Tax=Bacteria TaxID=2 RepID=Q0KKV0_STACA  ali  34  2...........LGVSKDASKDEIKKAYRKLSKKYHPDINQ------EEGAEEKFKEISEAYEVLSDENKRANYDQFGHDGPXXXXXXXXXXXXXD--------FGGFGGGFEDIFSSFFGGG-AQRDPNAPRKGDDLQYTMTVTFEEAAFGTEKEISIRKQVKCETCDGSGAKPGSKK-KTCHYCNGSGHVSVEQNTILGRVRTEKVCPVCNGTGEEIEEPCPTCHGKGTETKNVKIKVKVPEGVDNDQQIRLAGEGAPGGGPQGDLYVVFRVEPSDTFEREGDDIFYNLNVSFPQAALGDEIKVPTLKGHVMLSVPE....................................................................... 294
27 0.000e+00UniRef50_A0A2E4WY14 Chaperone protein DnaJ n=3 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E4WY14_9DELT  ali  29  18....KRDYYEVLGVERNSDAGHIKKAFRRIALAHHPDQNPDD-----PEAAKIFREASEAYEVLGDAEKRDLYDRYGHEGVEGRVQ-TAGADVHDIFSHF-----------GDFFGDLFGG----RPFQQARKGRDLRVRLEVPFSEVLSGAERSIQLRRNRPCTTCNGTGSES-EQGPETCGMCSGTGQVVQRQ----GLFVMSTTCPRCEGSGGVIKDPCASCDGRGVHVDTSPLVIHVPAGVSSGMQIRMRGEGDQAELPPGDLLVVFRVEDAPAWVRDGADLHQPLALDLPTAVLGGQVQVEGLDGLMALTIPAGTGEGAVLPLHGAGLPNPAGHQ---GDLLVHVQLQVPRQLNPETRALWQSLKDRQDET............. 363
28 0.000e+00UniRef50_A0A0V1A3I8 Mitochonrial uncharacterized protein n=31 Tax=Ecdysozoa TaxID=1206794 RepID=A0A0V1A3I8_9BILA  ali  28  59..AEKLDYYEILGVPKNASAKDIKKAYYQLAKKYHPDVNKND-----PQAARKFQQVSEAYEVLSDENKKAQYDQWGSTDFGATQGFHSTIDPEELFRKIFGDIDFSGWNFDEFAESKFGFGSTQ------------EYVMHLSFQEAAKGVTKTASINTVDVCQKCGGKKTELGY-KMVSCPYCNGSGMETFSQ----GPFIMRQTCRKCSGTGQFNKNPCLECEGTGHTVQRKTISVPVPAGVEDGQTLRMQGKKE--------LFITFRVSKSDIFRRDGADVHTDVSISVSQAILGGTVRIPGIYEDVYLQIPPATSSHSRLRLAGKGIKKVNSYG--YGDHYVHVKIEVPKKLSDAQRAIIMAYAEMETNTPGTIRGV...... 428
29 0.000e+00UniRef50_A0A146L168 Protein tumorous imaginal discs, mitochondrial n=5 Tax=Hexapoda TaxID=6960 RepID=A0A146L168_LYGHE  ali  28  86.SLAKKDYYEILGISRNASVKEVKKAYYQLAKKYHPDTNKND-----PNAAKKFQEVSEAYEVLSDDTKRKQYDQWGTTGREGAGTGPGNMDPQELFRKIFGDAAGGFSGFDDFAESRFGHGAAE------------EILMKLTFSQAVRGVSKEIYVNVVETCPKCQGRRCEPGTKPIK-CTYCNGSGYETVTT----GPFVMRSTCRYCQGTAMLIKYPCIECEAKGSVVQRKKITVPVPAGVEDGQTVRMAVNGKE-------LFITFQVEKSDYFRRDEADVHTDAQISLSQAVLGGSIKIQGVYEDHFIQIAPGTSSHTRIRLAGKGIKRPTSTGS--GDHYVHIKIGVPKRLSPKQKEAIVSFAELEEDTPGTIQGV...... 452
30 0.000e+00UniRef50_A0A135VD72 Uncharacterized protein n=2 Tax=Candidatus Thorarchaeota TaxID=1706441 RepID=A0A135VD72_9ARCH  ali  31  1MASD--DYYERLGVGRNATPEEIKKAYRALAKKYHPDRNPGNQH-----AEETLKGINEAYEILSDPEKRANYDRWGTADFQGINMDGFG----DIFSEIFRGFSGFGDF-----------GFGRRGRAGPPPGQTLRVTIPLSFEDAFFGVEKEIAFNRMIHCESCRGSGASAGSS-PRACPTCRGRGQVM---RSMGGFMSVSQTCPSCGGVGEVIDTPCKECSGKGLQKERREIKVPVPPGVEDGQALRIRGGGSAGPRGHGDLILVFAVEPHDTFIRKGLHIYMEMEIPFSLAVLGGEVEVPTMRGMSKMKVGKNTQGGTIFRMKGKGVYSDDG---RKGDQLVRVVIHIPKKLTKEQKKYLDKF.................... 342
31 0.000e+00UniRef50_O74752 Mitochondrial protein import protein mas5 n=414 Tax=Eukaryota TaxID=2759 RepID=MAS5_SCHPO  ali  28  1MVKETK-LYEVLNVDVTASQAELKKAYRKLALKYHPDKNPN--------AGDKFKEISRAYEILADEEKRATYDRFGEE-GLQGGGADGGMSADDLFA-----------------SFFGGGMFGGGMPRGPRKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGS--VKSCASCNGSGVKFITRAMGPMIQRMQMTCPDCNGAGETIEDRCKECDGAKVISQRKILTVHVEKGMHNGQKIVFKEEGEQAPGIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEHLDDR-WLTIPPGIRPNELKVLPGQGMLSQRHH--QPGNLYIRFHVDFPEPNTPEQLALLEKALPPRK............... 351
32 0.000e+00UniRef50_A0A2E3XLC3 Chaperone protein DnaJ n=18 Tax=Bacteria TaxID=2 RepID=A0A2E3XLC3_9BACT  ali  30  4......DLYDLLGVSRTASLTEIKKAYRELARKFHPDANPDDA-----EAEQKFKDIAMAYEILSDHEKRSQYDQFGAVGSAGSPFQGAGG-ISDIFEAFFGGQSPFGSSGF--------------QAQQRNSGEDVEIGLNITLEEVVNGGEAEFTLNLALECETCTGSGSQNGES--ESCGRCDGHGQLQQVRQSILGQIMSTAVCPSCQGFGTLITDPCSSCGGVGIKKSEKSFSIEVPKGVDTGITQRLSGMGPAGGGERGDIHVRYVVERHSRFSRNGENLLEQLWIPVTFAALGAEIEYETFDGMQKLKIPAGSRTGDKFRYSGLGVPRLQ--RRGRGDLIVEIVVDTPQNLSEVSKRLMIELAEEFGET--LKEKPKRSRKS 362
33 0.000e+00UniRef50_J9JBH0 Chaperone protein DnaJ n=3 Tax=Oxytrichidae TaxID=57506 RepID=J9JBH0_9SPIT  ali  28  63....KKDFYASLNVARGASQDEIKKAYFKLAKQYHPDVNK------APEAKEKFAIINEAYETLGDDSKRKVYDQTGMNADEQGGFGQGFSGYEGFYDQFKQGGAQGGQPFGDVFEEFGGGGPRGSKRQQAAKGKDIVMALEIDFMDAVNGSNKTINFSRVDVCGTCKGSKSKPGTSPSTCGGC-----GGTGYQTMRQGPFTIQQQCGNCDGQGTVIRNPCMTCRGRGSVSNTVKEQVNIPKGVDSGVNLRISKKGNFSPGPPGDLMIQIKVKPHPYFKRDGSDINTDLFVTVSQAILGTEATVKTLYGDIKLKVDPGTQNEERKKISNYGVQKLPPNQHQKGNHFVTMKVVIPKVLNDEQKRALEAYAKVEEKIPNTL......... 445
34 0.000e+00UniRef50_L8H8X3 DnaJ domain containing protein n=3 Tax=Amoebozoa TaxID=554915 RepID=L8H8X3_ACACA  ali  29  30.VSAGDDYYGLLGLDRSASDADIKRAYKKLALKWHPDVYKG---ADQEEAKKKFQKLSHAYEILKDKEKRGIYDQYGEEGLKGQRGGGGFTDPFDLFNS---------------FGFGFPGGQRGQRHEEERVGPPLHVDLEATLEDLYNGRTLTVTQKKQVLCHRCRGTGAENPDE-VTKCPVCGGSGVRLITQQLGPGFIQTQTTCDKCGGKGKIVKGTCPVCKGHKVESGEDTITVIVEKGMREGHEISFQGESHEHPDQPGDLVFRIKTIPHARFVRKENDLYMNATISLLQALVGFKKTYKHLDGHAITIERSGTRPGLVMTVPGEGMPMYEDS-DRFGDLHVEFTVKFPTTVTDEQKE......................... 378
35 0.000e+00UniRef50_A0A0G1VSY8 Chaperone protein DnaJ n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1VSY8_9BACT  ali  32  3.....KDYYEILGVARSSSQAEVKDAFRKKALEHHPDRGGD---------AAKFKEVNEAYQVLGNAEARAQYDRYGSSFEQMQGYQGAGFDPRE-----FGFDIGDLSDLFGG-LGEIFGFGGGRGRAREAHGRDIELEIAIPFEEAVHGGTREIELDKINQCGRCGGTGAEPG-SGFKNCPTCGGSGKVAKVTQSFFGAIQTVITCHSCHGIGKYPEKPCGACDGKGIARGKRILNVKIPAGIEDGGTIRFSGEGEARGGRSGDLYLHVRAKVHKEFERRDNDILSKIFIPFKIATLGGAVEVNTVDGSKELKIPAGTQSGTVLKLKGLGVPHLKGHG--RGDHFVEVQIKVPEHLSRHQRKVLEEFED.................. 353
36 0.000e+00UniRef50_A0A0G0IY44 Chaperone protein DnaJ n=2 Tax=unclassified Parcubacteria group TaxID=1794840 RepID=A0A0G0IY44_9BACT  ali  29  10.....KNYYDILGVPKGASKDEIKKAYRKMAHQYHPDKKHGN--------EAKFKEANEAYQILGDDQKRAQYDRFGTGFNDNSGGSSSRGGSWGGDGGFNGQGFDFSGFGEDIFGEMFGGG----KRSRSRRGQDIKMDFDIDLEDSVSGKDVEVNFKKVSLCDECKGQGGF----DPENCARCGGSGQVNQTFNSVFGTMSQIVSCQKCHGQGKFFKKVCGECHGQGRAKKTTLFKMRIPKGILDGEMIKFSGEGEAGGALAGDLFVQAHFKPHKHFKYEGVNIYYDLTIGLTQAALGDKMEIPTLYGSVKLKIDPGTQPQDIIKISGKGLPK-RGSWGGHGDMFVKIKVLVPKHLSHKQRELLEELKKES................ 364
37 0.000e+00UniRef50_H2ZZ30 DnaJ heat shock protein family (Hsp40) member A2 n=6 Tax=Euteleostomi TaxID=117571 RepID=H2ZZ30_LATCH  ali  28  4.VADTK-LYDILGVSPGVTDNELKKAYRKLAKEYHPDKNPN--------AGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGGGGGAGMD--DIFSHIFGGGLFGFMG------------GQSRNRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSTCNGQGGKSGA--VQKCTACRGRGVRVMIRQLAPGMVQQQSVCSDCNGEGEVIKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQKITFSGEADQAPGEPGDIVLVLQEKENEMFQRDGNDLHMTHKIGLVEALCGFQFTFKHLDGRIIVKYPPGIEPGCVRVVRGEGMPQYRNPF-EKGDLYIKFDVQFPEN................................ 340
38 0.000e+00UniRef50_A0A1W9MDL2 Chaperone protein DnaJ n=1 Tax=Candidatus Altiarchaeales archaeon A3 TaxID=1933927 RepID=A0A1W9MDL2_9EURY  ali  30  4.....KDYYEILGVSKNTTKDDLKQAYRKLAMQHHPDKAPADKKKESEEKFKE---ISEAYAVLSNDEKKAQYDRVGSAGMGNVNQEDIFRNAFSDFQDVFSGYSGGFGSADEIFKRIFGGGIGRQRGTQGDAGEDLEYNLSINLKESAFGTEKEIRFFHNSKCKVCNGTGSKDGS--RTVCDKCHGRGAVQIHKRAGFITFTSAQTCPKCHGTGVVIQSPCYTCHGTGKAKEEAKVTVRVPGGVNSGDNLKMTGHGNYGRDGQGDLYIKISVMEDDFFKRKGDDICCNVKIPFILAILGGKIDVQTLRGTTSLNISEGTQPGTTLRMKDLGI--HNEMRKHTGDQFVVTEIEIPKDLNERQKNLLIEFDEEMKKSKSRFK........ 377
39 0.000e+00UniRef50_A0A1S4EGR2 dnaJ homolog subfamily A member 1-like n=1 Tax=Diaphorina citri TaxID=121845 RepID=A0A1S4EGR2_DIACI  ali  31  62..KTSKDYYDLLGVKPGCSDDELKKAYRTMARKYHPDRDPKN--------EDKFKEINKAYDVLSNPEKRRVYDQGGEEAINQGGFG-GFESPMDIFDMFFRXXXXXXXXXXXXXXSPFGGHRRGQQQQKNRKGKDVVHTLYVTMEELYSGAVRKLALEKNVICSVCEGRGGKS--KIVEKCSTCKGSGMTVQVQQIGPGMIQQVQVCSDCKGQGERIKDKCRTCAGKKTVRERKILEVHIDKGMVHGQKILFTGEGDQEPGQPGDIVIQLHEQSHPVFKRVGNNLQMTQNIDLVEALCGFQRYIKTLDGRVIMIEVPGVKHGESRTVFDEGMPHYK-NARSKGNLQITFNVNFPTKIEPDKLHLLE...................... 433
40 0.000e+00UniRef50_U9UT08 Uncharacterized protein n=7 Tax=Rhizophagus irregularis TaxID=588596 RepID=U9UT08_RHIID  ali  32  58....KKDYYELLGVDKKASQAEIKKAYYSLAKKYHPDTNKD------PTSKEKFVQIQEAYDMLSDEEKRAQYDQFGASFAEGGPTGAXXXXX---------XXXXXXXSGSTDFFDLFEGFNRRSRGTGFSTGSDIEVGLNISFMDAIKGTTKTITVESVATCKPCK--GTGSKGGKKDTCKTCNGTGVQFIQINSG---FHMQTACPECNGKGTKIPNQCPTCGGHGQIKERRPVSIPIPSGVEDGIALRMPKQGNMNEGVPGDLYVRLHVAPHEIFKRQGLNIHVDTMIPFYTAILGGYIRVPTIDGNVELKVPPGAQPEQQALMKKRGIQQANSNY--RGDQIVTFKVTIPKTLTTKQRELIDQFVSISEGTKS........... 414
41 0.000e+00UniRef50_A0A1J4U9Y7 Chaperone protein DnaJ n=21 Tax=root TaxID=1 RepID=A0A1J4U9Y7_9BACT  ali  29  3.....KDYYKILGVDKGTTKEEIKKSFRKLAHEYHPDKKTGN--------EDKFKEINEAYQVLGDDNKRKQYDQYG-ADFEQQGGFGGGMNWNDFMNKARSGDFENFSSQGGSTWSEDGGGGRSRGRSRTMRGNDIQVSVELEFREAIFGVEKEIRLTKNNVCSVCSGSGAESG-AGTETCSDCRGQGQIKRVQQTILGAMQSVVTCQRCQGSGQIPKKVCKHCSGKGVVHSDSKYKVKIPAGISDGEMIRLSEKGESAGVGPGDLYVRVHVKSENGFERQGFDIFTAINISYPQAVLGDKVEINTLEGKKNLIIPEGTISGQKFKLKGLGVPRLQ--RSGKGDQYVTVIIDVPKKISKKVKKILEELKGEL................ 373
42 0.000e+00UniRef50_A0A023X0D9 Chaperone protein DnaJ n=1 Tax=Rubrobacter radiotolerans TaxID=42256 RepID=A0A023X0D9_9ACTN  ali  28  2...ETKDLYKTLGVGKDASREEIRGAYRRLARKYHPDANPDD-----PAAEERFKEIQNAYEVLSNPERRREYDR-GPETFFGQGGFRDGGRPDDL--SDFADLFGNFGGFGDIF-----GRSTSARTNVKQRGDDVTVSVNLKFNESLNGVTTRVRVVAEEVCGDCGGSGASPGTA-IRTCPDCGGRGTRSRDQ----GFFALSETCPRCRGEGVYVEKPCSSCAGTGRVERPRQVTVRIPAGAKDGTKVRVPGRGSAGGGPPGDLYVVTRVEEHPVFKRRGDDFVVEVPVSFVEAALGAEVPVPRPGGRVRLKLPAGTQHGRQLKVRGAGAPNVKKKGQT-GDLIVKVSVVVPKKLTRREREILEAFAEERDED............. 358
43 0.000e+00UniRef50_A0A2H6AL26 Chaperone protein DnaJ n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A2H6AL26_9BACT  ali  29  2..APKRDYYEILGVPRNASKEEIKRAYRRLARQYHPDLNPGXXXXXXXXXE-----------------KRKMYDMYGTAEFQPGAERTT-WRWTEAPGGGFEFTFGDFSGFEDIFNEVFG---EREPTRVRRRGRDLEYQLEIDFDTAIKGGVKDITITRETICPGCGGSGVRIG-AGARVCPKCRGSG-----RSLFTSFLNISRACDMCGGSGKISTEPCNTCNGSGKRITTETISVKIPAGVDTGSRIRVPGKGEEGTISNGDLYLVIKVRPHPLFRREQDDLYIEVPITVYEAALGAQISVPTVDGTAVVTIPPGTQSGTKLRLRGKGVPHLRDGG--RGDLYVITKIVLPEKINESARKKFEELAKTSPYNPR........... 360
44 0.000e+00UniRef50_A0A1Y2ETN3 DnaJ-domain-containing protein n=5 Tax=Neocallimastigaceae TaxID=29007 RepID=A0A1Y2ETN3_9FUNG  ali  30  21.VNAGRDYYEVLGVDRSASKREIRKAYKNLSRKYHPDKNPGD-----KKAEEKFIELAKAYEVLSDDEQRRIYDQYGEEGLN--HGEQQFHDPFDIFRQF--------------------GFGGGEPRHQERKGPEINIDLEVSLEDLYMGAYIDADIKKQVICTYCRGSGAAS-QEDVHICPACKGTGKRMVRQMLGPGIYQQVQVCDACGGKGKTIKKKCPHCHGERVQRGGEPISITVEKGMSDGHRIVFEREGDQHPEVPGDIIFTIKTIPHPLFTRKGNNLYVKVGISLADALLGFEKEIHHLDGHVVELKRTGTPPGFVQEIYDEGMP-LHEFPSEQGKLYVEYVVAFPTELSDEQKEVIK...................... 360
45 0.000e+00UniRef50_D8RQZ3 Uncharacterized protein (Fragment) n=1 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8RQZ3_SELML  ali  31  1......DFYDTLGVSKTASASDIKKAYYALAKKHHPDMNKDD-----PEADKKFQEIQQAYEVLKDDQKRSIYDQVGHHAYVERAD---------------GVPPGPGPGFSSIFEDIFNGPGSNLTLTT------VQVNVQISFMEAVNGCTTKVTYRTQVRCEKCKGAGVPSGV-KPQTCKSCRGAGRIFMQK----GFFSVESSCTACGGSGQFVKEHCKACQGSGTVMGVKEVDVEIPAGIESGMNLKISGEGGSGSRRAGDLIVKVEVKPDPVFRREGADVHVDVPITLVQAVLGGTIEVPTLTGSVMLKVKPGTQPGQKQVMRGKGIKVTQRH--AYGDQYVHFRVNIPTTVSDRQRQLLEEFAREESNE............. 339
46 0.000e+00UniRef50_A0A1X2IV85 Uncharacterized protein n=23 Tax=Mucoromycotina TaxID=451507 RepID=A0A1X2IV85_9FUNG  ali  31  63....KEDPYKILGVKKTASQGDIKKAYYALAKKYHPDTNK------AKDAREKFTQVQEAYEMLSDEEKRAQYDQFGH-GFEGAQGFPGGFDPNDIFSQFFGGGGQHYQXXXXXXXXXXXXXXXXXXXXRTMSGENLQAPLTITFMEAVKGTKKTIYIQQVTNCVTCKGTGLKTGV-KMDTCKVCHGTGMQTVQM----GGFNMQTTCTKCGGVGSSIPSECKTCDGLGKVREQKSIQVDIPPGVDDKARIRVSGQGDAGNGPRGDLFVSLSIQPSKIFKRQDKDVFLDTKIPFYKAMLGGTVRIPTIDGDVELKVPKGSQVDDKIALRGRGIQHLRG--AARGDQIVTLKIDLPRSLRGEQKSLIEKYAQLVDPE............. 448
47 0.000e+00UniRef50_A0A0S7XGJ3 Chaperone protein DnaJ n=3 Tax=FCB group TaxID=1783270 RepID=A0A0S7XGJ3_9BACT  ali  30  1MPQAQQDFYETLGVGENASTEDIKKAYRKLAKKYHPDANPGNTT-----AEAKFKEVSEAYNVLSDSKKRAQYDQMRKGAGAYAGGGFQGFDLGDLFGGSFEDLGGFGGLGSLFGNLF--GSRVRPQSHGPRKGNDILVELEVPFDLTVRGGKTTVVISKEDHCKECGGSGARPG-SKTVTCPECKGQGSVSFVQ----GGFAVSRPCPKCLGWGVLTEDPCRACGGRGTVRGAKKYVIKIPAGISTGEKIRLRGQGELGGGPPGDVIAQVRVGSHPFFTKKGANIYCTVPINIAQAVLGAKVKVKTVDGRVELKVPAGVQNGATFRLKGMGLKR----NGLKGDQFVKIDVVTPKKVTEKQKKLIEEFAKEGG............... 371
48 0.000e+00UniRef50_P87239 DnaJ homolog 1, mitochondrial n=4 Tax=Schizosaccharomyces TaxID=4895 RepID=MDJ1_SCHPO  ali  27  86......DPYKTLGVSKSASASEIKSAYYKLAKQYHPDANPD------KAAQDKFVEIKQAYEVLQDPKKKKAFDTYGAGAFKNGEFTGG--DFEGFQNGFAGASSFSSGFPGFNFEDLFGFSSRGPQARRNTVGEDIEASITIDFMEAVRGAKKDLSYSVSSTCSSCHGSGLQPGSHK-STCFACKGTGQRLH---FIPPSFHMQTTCDSCGGTGTTIPSACRSCMGSGTVRERKTVSIDIPPGIDDNTVLRVMGAGNAKGGPPGDLFATIHVRKHPFFVREGTNVTYNAKIPMTTAALGGTLRVPTLTGNVDLRVSPGTSTGDRITMAGKGIRKVNT--SRYGNFYVNFEVTIPKILSPHERSLLEQLADALNDS............. 457
49 0.000e+00UniRef50_Q5ZJV3 DnaJ heat shock protein family (Hsp40) member A1 n=106 Tax=Bilateria TaxID=33213 RepID=Q5ZJV3_CHICK  ali  30  1MVKETT-YYDVLGVSPNASAEELKKAYRKLALKYHPDKNHNEG--------EKFKQISQAYEVLSDPKKRDLYDKGGEQAIKEGGSGGGFGSPMDIFDMFFGGGG---------------------RMQRERRGKNVVHQLSVSLEDMYNGATRKLALQKNVICDKCEGRGGKKGA--VECCPNCRGTGMQIRIHQIGPGMVQQQSVCMECQGHGERIKDRCKSCTGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGEPGDIIIVLDQKDHSVFTRRDEDLLLSMDIQLVEALCGFQKPITTLDNRIIITSHPGVKHGAIKCVLNEGMPIYRRPY-EKGRLIIEFRVNFPES................................ 331
50 0.000e+00UniRef50_D8R624 Uncharacterized protein (Fragment) n=4 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8R624_SELML  ali  32  1..ATPSDYYQVLGVSRNASKQEIKTSYRKLAREFHPDVNK------ESNAEEKFKEITAAYEVLSDDEKRAIYDQFGEDGLKGGGPTFTD-SPFDIFDSFFGGRSGFGRRRGTDNWSG-------------VQGNDLSYDLSLDFKEAVFGVEKQFDIWHLESCEACSGTGARSKS--RKKCRVCGGMGEVMRTQETAFGMFSQVSTCTNCGGEGEVISDHCRKCGGKGGIRAKKTIKLSVPCGVDSGSTLRVAGDAGERGGPSGDLYVNLKIRDMPGIRRDGINLYSEISVSYTECILGTTKKVKTLEGFSDLRIPAGTQPGACITLPKIGVPRLR-KPSLRGDHIFSVKVLLPTKVSAAEKELVEELARL................. 349
51 0.000e+00UniRef50_A0A2E2VWZ7 Chaperone protein DnaJ n=3 Tax=root TaxID=1 RepID=A0A2E2VWZ7_9BACT  ali  31  2.....RDYYEILGVPKTSSKDEIKKAYRKVAMKFHPDRNPDN-----KEAEDKFKEAAEAYSVLSDDNKRSQYDQFGHAGVNNGGGFSGGMNVEDIFNSV---FGGGSGGFSDIFGGDI-FGSQRSSGNRRRKAENLKISIPLTYEEIFEGTSKKIKIKRWE-----------KSSSDAQKCPTCNGTGEIRNVQRSMLGQIVNVQVCPNCKGMGYI----------GGRDKKTATIKVKIPAGVSDGNYMTLEGEGNHSSDLNGDLIIYFEEKPHSLFVRSDSDLYLECVINYSDAVLGTEVKVPTLNGKVKFKIPAGIKNGQILRLKNKGFKEVNGYG-GRGDQYIKVNIDIPLNISKDLKKIILDLKNNLDDEIKFKK........ 352
52 0.000e+00UniRef50_A0A2G4H448 Chaperone protein DnaJ n=1 Tax=Thermoleophilia bacterium TaxID=2026888 RepID=A0A2G4H448_9ACTN  ali  29  2.....RDLYEVLEVPRAATADEIKKAYRKLARKHHPDANPED-----PKAEERFKEISAAHDTLSDVEKRKAYDQFGASG----GTGAQGFDPND-FRDFAQDRGF---DISDLFGDLFGRRRGGGPNAGRGRRPDLETRVTLSFDDALRGARVTVPVDKDLNCADCSGTGAAAGTSR-TTCPDCGGSGERQVNQ----GFFAIAEACMRCGGQGSIVERPCTTCKGSGRQRRTKRYTVKIPAGIADASRIRVRGKGGESGGAPGDLWVVVQVLPSERFTRRGKDIIVEVPVTFPEAALGAEIDVPTLGEKVRVKVPAGSVDGKMLRVRGLGAP---STSGDDGSLLVRLKLIVPSGLSTQQTEALEKFAALDGGT............. 359
53 0.000e+00UniRef50_C8V213 DnaJ homolog 1, mitochondrial n=156 Tax=Eukaryota TaxID=2759 RepID=MDJ1_EMENI  ali  27  79..AAIPDPYKVLGVDKGASAGDIKKAYYGMAKKYHPDTNKD------PGAKEKFAEAQSAYELLSDKKKRETYDRFGSAAFDQNGGFGAGGNPFAXXXXXXXXXXXXXXNIEDLFGAFAGGARRSGRGRRGPVGEDIEVQTNISFMEAAKGTSQDIVITPLKECGTCKGDGLKEG-AKRTQCRQCNGTGTRVHLMQ---GGFQVAATCDACGGAGLIVPSHCGTCKGDGVVRERKTVRVDIPGGVEDGMRLRISGEGDAAPGQRGDLYVSIRVSPDERFSRSGSDILYTASIPLTTALLGGEVLVPTLDGQVKVKVATGTGTGDRITLSGMGMKKLGGRSRGFGDLKVEFKVAMPKYLTSNQRTILEVLADEMGDK............. 476
54 0.000e+00UniRef50_A0A2V8SMW4 Molecular chaperone DnaJ n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8SMW4_9BACT  ali  29  2...AKKDYYQTLGVKKDAKADEIKKSYRRLARKFHPDVNPND-----KSAEEKFKEVQEAYDVLSDEKKRKVFDRFG--------YYNDNLDPDSPFXXXXXXXXXXXXXFRDIFSDLFGGSGGAPGARREKKGRDIEIPLALSFEEAFTGLTTNITVNRSEQCSRCQGAG--DTGGPVVTCTTCKGTGQVMRT----GGRLQFSQPCPDCEGTGRR-RTPCSLCNGKGTTPKTEQVKIRIPAGVDTGSRVRIPKKGHGGGAEPGDLFILTNVGKHKFLERRGDNVYVTVPITVPEAALGAKIEVPTVEGKAQLKIPSGTESGQKFRLRERGFPSLR-NPKLRGDEFIEVKISLPKVISEETKELLRQFEKSNAENPR........... 385
55 0.000e+00UniRef50_A0A1J6JDJ7 Dnaj protein-like protein n=54 Tax=Mesangiospermae TaxID=1437183 RepID=A0A1J6JDJ7_NICAT  ali  27  9..SDNSKYYEVLGVSKSASQDELKKAYRKAAIRNHPDKGGDP---------EKFKELAQAYEVLSDPEKRETYDQYGEDALKEGMGGGGVHDHFDIFEX-------------XXXXXXXXXXXXRFRASRQKQGEDVVHTLRVSLEDLYNGTTKKLSLSRNRLCSKCNGKGSKSGASG--RCYGCQGTGMRVTTRQIAPGMIQQMQVCPECRGSGEVIRDRCSQCKGNKVSQEKKVLEVNVEKGMQHNQKIVFEGEADEAPDITGDIVFVLQQKDHPKFKRKFDDLYIEHTLTLTEALCGFQFVLTHLDGRLLIKSNPGIKPDQYKAINDEGMPSY-GRPFIKGRLYIHFNVDFPESLSPEACRGIQTILPARPGKSS........... 370
56 0.000e+00UniRef50_P28616 Chaperone protein DnaJ n=52 Tax=Borreliaceae TaxID=1643685 RepID=DNAJ_BORBU  ali  30  2....KKDYYEILGLSKGASKDEIKKAYRKIAIKYHPDRNQGN-----EEAASIFKEATQAYEILIDDNKKAKYDRFGHSAFEGGGFEGF--------SGGFSGFSDIFEDFGDIFDSFFTGNKGQERNRKHAKGEDLGYNIEISLENAYFGYKNNINITRQMLCDSCLGKKSEKGTS-PSICNMCNGSGRVVQ----GGGFFRVTTTCSKCYGEGKIISNPCKSCKGKGSLTKQETIQLNIPPGIDNNQQIKMKGKGNVNPDEYGDLYVKILIRSHKVFKRNGKDLYAMLPISFTQAALGKEVKIKTISKEIKIHIPKGINNEEQILIKNAGMPILQT--EKFGNLILITKIKTPKNLNSNAIKLFENLGKELKD.............. 355
57 0.000e+00UniRef50_Q8KCD8 Chaperone protein DnaJ n=41 Tax=root TaxID=1 RepID=DNAJ_CHLTE  ali  28  2....KRDYYEILGVARSADKDEIKKAYRKLALKYHPDKNPDXXXXXXXXXXD----------------KRRRYDQFGHAGVGSSAASGSGPDINDIFSAFNDMFSSPFSGFEDVFSGGFSGSGSGRRRSAGIQGTDLKIRLKLTLEEIAKGVEKTIKIKKLVTCRECNGTGSKSG--KTEICPTCHGSGEVRQATKTMFGQFMNISVCPTCGGEGRVVKDRCPSCYGEGIKQGEATVKITVPAGVQDGNYLTLQGQGNAGGGAPGDLIVVIEEKPHELFKRNGDDIIYDLSVGFPDLVMGTKIEVPTLDGHVKLTIPAGTQPNTMLRIGGKGIGHLRGGGS--GDLYVRVNVFVPKEVSGKDRDLLKELKKSENHEKSIFEKAKDIF.. 402
58 0.000e+00UniRef50_A0A1F7SN61 Chaperone protein DnaJ n=3 Tax=Candidatus Schekmanbacteria TaxID=1817811 RepID=A0A1F7SN61_9BACT  ali  27  3....KQDYYRILGLNSDATAEEIKKAYRKLALRFHPDKNPGNHF-----AENKFKEVSVAYQTLINHQKKRIYD--------STSNSETFSDFRGNFSSGYRSYGGFTNIFEEIFHDFFDVG-YSGDRTRIKKGSDIKTELKISLADAAFGKETEVTIERLEKCNTCNGNGSEAGI-GESICPSCNGTGEKRYS----YGFFIVKRICTQCKGNGFIIVHPCLKCDGDGRQKKKNTITVKIPPGVDTGSKLRLSEQGNTGGGPSGDLFVIIRVEKHNIFERENFDISCEIPITFTQAALGSEIEIPTLEGTANLKIPEGTQSSSVFTLEGKGI--INPASYIRGNQYVKILVETPVNLSSFQR.......................... 342
59 0.000e+00UniRef50_A0A1F7QFJ5 Chaperone protein DnaJ n=9 Tax=Candidatus Rokubacteria TaxID=1752708 RepID=A0A1F7QFJ5_9BACT  ali  27  1MA---RDYYGVLGVSREATDAEIKKAYRQLAMQSHPDRNPGD-----KDAEERFKEANEAYAVLSDPDRRAHFDRFGTAGPGAGPGFGD---------------AGFGSLFEDIFENFFSG-APRGRRSRAVQGEDLQYELKLALEEAAAGIDTKIQIPRLEACEACGGGGVEAG-SRLETCGLCHGRGEVRRSH----GFLTVAQPCPKCQGSGQLNTHPCAQCRGEGRRRAERLLAVKIPPGVEDGMQLRLSGEGSGGLRPPGDLYVLLRIREHDLFVRDGADLHCDVPVSFPQLALGAELVVPVLNGTTTLRIPAGSQPHAILRLRGKGMPRLR--QRGHGDACYRLVLEVPHTLNESQREALAAFESAGRSARGFLERMKKL... 362
60 0.000e+00UniRef50_A0A1Y2DGA9 Uncharacterized protein n=2 Tax=Basidiomycota TaxID=5204 RepID=A0A1Y2DGA9_9BASI  ali  28  81.....RDPYNVLGVAKDASTSDIKKSYYQLAKKFHPDSNKD------KGAKEKFVEIQEAYDTLSDDKKRADFDRFGAAGFDSDAYARASSSFGGAGFGDFFGGGAGSAQGSDIFESLFGAFGSARPGQGQHVGDNIEVAINLSFLDAAKGTTRTVNVSPVVDCKPCTGSGLKPGAKK-TTCRVCGGSGTRTFTIQSG---FQMASTCNACAGSGEVAPENCGTCNGVGKVRERKQVEVKIPPGVDEGMKIRIPEEGDAGKGRTGDLFVRVNVSSSKTFTRQGTNLYQDVAVPFYTAILGGRARVATLDKDVEVKVPNGTQPGEEMVLRGRGIKKL--YKDEFGDLVVRFNITIPRALSPAQKRILQQFVSETE............... 451
61 0.000e+00UniRef50_A0A0K9EU88 Chaperone protein DnaJ n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A0K9EU88_9ACTO  ali  29  2......DYYETLGVARDASQDEIRKAYLRLSRKLHPD-------HAGPEKAEEYKAVNEAYTVLSNEESRRKYDMGGSA-----QGGGFDFGMGDIFNTFFGGMGGMGG-----------ASSSRGPAPRGQRGQDSLLRISVELKDVIFGSERDIDTTLYVRCHTCEGDGCAPGTEPI-TCTNCHGAGMVQRVSNSLFGQMITQAPCPECEGHGTIIASPCPDCGAEGRVREKKTIHVKIPAGMESGMQLRFSNEGDAGGGGYGDLYVEVTVKEDRIYQRSGSDLLAEVQIPMTSAALGATITVPTFDGEQELEIPAGTNSGTVLTMKGLGVTRMNGK--DRGNIRMTVAVTTPRDLDSQQRELLEQLATLRGEDQSFFSKLKERF.. 368
62 0.000e+00UniRef50_R1G1R8 Putative mitochondrial chaperone protein n=11 Tax=Pezizomycotina TaxID=147538 RepID=R1G1R8_BOTPV  ali  26  47...ATKDPYSVLGVGKSASSSEIKKAYYGLAKKFHPDTNKD------PGAKDKFADAQSAYELLSDPEKKKAYDTYGSAAFDGGASGFGDFNFEDLFGAFXXXXXXXXXXXXXXXSAF---------QEEVLVGDNIEVQTNISFMDAAKGTTKEIFITPHVQCKTCDGSGLKKGTKK-SSCQVCHGTGQRVVSM----GGFQLATTCEACGGVGVSVPKECGTCDGEGAVRERRTVTVDIPGGVEDGMRLRVSGEGDASGAQNGDLYVFIRVAPDPKFQRSGSDVLYTATVPLTTAVLGGEIRIPTLDGDVKVKVPTGTGTGDKITLGGMGMKKLNSRKGLKGDLRVEFKVQMPKYLSANQRTILEMLADEMGDKN............ 444
63 0.000e+00UniRef50_D8TBS8 Uncharacterized protein n=2 Tax=Selaginella moellendorffii TaxID=88036 RepID=D8TBS8_SELML  ali  33  1MAV---DYYETLGVPRTATVLEVKHAYRKLAKKYHPDKAPGN--------EEKFKAISAAYEVLSDPEKKEYYDKYGDADFQNGVPPVSMINPFDIFQSVFGEMAGM--------------------RPENFQGADLGYELHLEFTEGIFGAEKKIEVSHLETCNNCDGSGAYLG--KVKPCKACRGSGQTFETQQASYVTFSKVSVCTDCDGRGEVILDYCRTCGGEGVVLTKKNIDVKVPAGVKNGNTLRVPHEGHAGPRPPGDLYISLKVKDYPGIKREGNNLLSTISVSYVDAILGTLVEVNTLGGKAVIRIPPGTQPGDTVVLPNQGVPRL-GSPRTRGSHIFTIQVKIPRSL............................... 329
64 0.000e+00UniRef50_A7I2G3 Chaperone protein DnaJ n=12 Tax=Epsilonproteobacteria TaxID=29547 RepID=DNAJ_CAMHC  ali  35  3......DYYEILGVPKDADSDEIKKAFRKLALKYHPDRNAGD-----KEAEEKFKEINEAYQVLGNDERRQTYDRYGKEGLNGAFGNFGGFDFGDIF---------------DTFFGGGGFNKSRSQRYDDAYDLDSEILVSISFKDAFFGVSKDIKYKIKKPCKTCDGTGSKD--KKLNTCPYCGGSGKIVKRS----GFLSFAQTCPFCKGSGQIVKEKCHDCAGKGFIEEQVNVKFDIPKGVNTGIRIRIAKKGNSKSGEIGDLYVAVQVKDDKFFVRSADDIYIEVPVFFTQAILGKTIKVPTMHGEKELQLKVGSKDKDQFVIEKEGFENIRTKIA--GNLIVQINVQTPKKLTDEQIELLEKLHESFDKTDGIFDKIKNWFK. 359
65 0.000e+00UniRef50_T2M7X5 DnaJ homolog subfamily A member 3,mitochondrial n=2 Tax=Hydra vulgaris TaxID=6087 RepID=T2M7X5_HYDVU  ali  31  61.SLNKKDYYKILGVQKGASATDIKKAYYQLAKQYHPDTNKD------KTALEKFQEIQQAYEILSDESKRSAYDQFGQTDFAGAQNPFQDANIDEIFKQFFG------GNKASGFSSSFGFEDARSTQQ---------YVMNLSFMESVKGVNKDIRVQIQNICNRCNGKKAEPGSTA-QKCPKCNGSGEEV----LSNGFFNMRSTCRRCQGQGSIVNNPCRKCTGKGTVLEDKVITVPVPAGIEDGQTVRV-------PVSHGELFVTFKVAKSKIFERVGTDVYSDLSVHFTQAILGGTQVVPGIHGDVEITLLPGTQSHQQMRLIGKGIPRLNGHGN--GDHYLQIKIHLPKYLTEEQKKLIVKFAEMDDTIQGSVRGV...... 414
66 0.000e+00UniRef50_A0A0C9M7A4 Pheromone processing endoprotease KexB n=1 Tax=Mucor ambiguus TaxID=91626 RepID=A0A0C9M7A4_9FUNG  ali  28  813.SAPKKDPYEVLGVKKSSTASEIKKAYYGLAKKYHPDTNKD------KDAREKFVQIQEAYEILSDEQKRQQYDQFGHGFEGGAPGGGNPYDPNDIFSQFFGGGFGGRAGGGDPF------------HNRPTPGDDLQVPLTLSFMEAVKGATKYVQVNKVTNCDTCHGSGLGEGKKK-ETCQVCHGSG----VQTIMMGGFHMQTACQSCGGAGSSIPAGCPSCNSMGKVRERKTVQVKVPPGVDQNSRIRVTGEGDAGQGPNGDLFVTLNIQASKVFRRQDSDIFVDAKIPFYKAMLGGRIRIPTVDGDVDVKVPSGAQPGDNIALRGRGIQRLRSN--ARGDQIVTLKVEFPRSLKGKQKEIIQEYAALVDEE............. 1182
67 0.000e+00UniRef50_A0A2A5D9N2 Chaperone protein DnaJ n=2 Tax=Planctomycetes bacterium TaxID=2026780 RepID=A0A2A5D9N2_9BACT  ali  30  2...SQRDYYEVLGVGRDASDTDIKSAYRKLALKFHPDRNKD------EGASDKFKEATEAYGILSDGDKRARYDRFGHAGVGGGPGGSGGPDFGDIFSQ-FGDIFGGRGGGGSIFESLFGMGGGRGRSQGKP-GRSLRASVEISMQEVLEGTKRTLTLRRNETCESCEGSGAAPGGVK-ETCTGCGGQGAVHQQQ----GFFAVRTACPRCQGEGTVISKPCGTCRGQGLAQKEREIEVRIPEGIEDGAQIRLGGQGESGRAPDGDLFVEIHVTEQEGFHRDGRDIYTEVGLSWPQAVLGDKIIVETLDGEARMSIPSGTPTGKLFRISGQGLPRLHGG--SRGDLLVRIYVEVPTKLTREQKSLVKKMRELEEKKTKKASK....... 371
68 0.000e+00UniRef50_Q26953 TCJ3 protein n=9 Tax=Trypanosomatidae TaxID=5654 RepID=Q26953_TRYCR  ali  28  1MVKETE-YYEILGLEAEATEHDIKRAYRRLGLKYHPDKNPGDQ-----EAAEMFKRIGHAYEILSDEEKRRIYDQHGKAGLEGGSMDEGGLDAADIFSMFF---------------------GGGRRPRGERKPRDLVHEMRVSLEDMYNGKTKKISVTRDRICGACEGGGIKPGAER-RTCVACRGQGVQTFVQELFIGMHQMQQTCQSCGGEGTTVRDICGRCRGSGIVKDQKILEVHIEKGMKHQDVVRFDGEGNEVVGVRGDVLIILAQKPHDVFRRVGNHLIMNYTINLQEALCGFDLPVQHLDKRLLITIPCGIDPGAAWVVRGEGMPLPNTGGLDRGNLVIHFEVEYPTRLSAQQ---LKSIAKALGVTESF.......... 356
69 0.000e+00UniRef50_P31689-2 Isoform 2 of DnaJ homolog subfamily A member 1 n=40 Tax=Bilateria TaxID=33213 RepID=P31689-2  ali  29  1MVKETT-YYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEG--------EKFKQISQAYEVLSDAKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGG---------------------RMQRERRGKNVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGA--VECCPNCRGTGMQIRIHQIGPGMVQQQSVCMECQGHGERIKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRIVITSHPGVKHGDIKCVLNEGMPIYRRPY-EKGRLIIEFKV..................................... 326
70 0.000e+00UniRef50_A0A150V790 Uncharacterized protein n=3 Tax=Eukaryota TaxID=2759 RepID=A0A150V790_9PEZI  ali  25  359.APTTKDPYKVLNVPPTASASEIKKAYYGLAKKYHPDTNKD------AQAKEKFTEAQQAYELLSDEKKKAAWDQYGAAAFDQQGGFDPSGGGGGGGGNPFASAGFAGFNFEDLFSAFGAGARRGRGQEEVLVGENIEVQTNISFMDAAKGVRKDITVTPLSRCRTCDGTGMKKGISR-TACGSCDGTGTRVHFMQ---GGFQMASTCGSCGGTGSKVPKECGTCRGQGAVRERKTVTVDIPGGVEDGMRLRVVGEGDYPPAEKGDLYVFIRVAPDAKFQRSGADVLYTATIPLTTAVLGGEIRVPTLDGEVKVKVATGTGTGDKITLSGMGMKKLSSSSSRYGDLHVQYKVQMPKYLSANQRMLVEMLADEMGDKS............ 754
71 0.000e+00UniRef50_A0A1U7LSJ4 DnaJ 1, mitochondrial n=1 Tax=Neolecta irregularis DAH-3 TaxID=1198029 RepID=A0A1U7LSJ4_9ASCO  ali  26  21.....KNPYTVLGVSKDADAKDIKIAYYSLAKKYHPDSNK------ESNAREKFQEVQHAYEILSDPQKRTQYDQLGSVAFDQGFGGAGAQGESGSFTGFPGFTNIDLGDLFGFANGHGQSSSFGGFGQQTMVGEDIDAPISISFIDAAKGVKRSVHIKPLTTCKTCSGSGLKSG-AKRASCKRCGGSGHRVHIMQ---GGFQMASKCESCDGSGISIPKECSSCGGEGILRESKTVTIDIPAGVEDGMKLRVTGEGDTPPSDRGDLYVHIRVQEHPFFKRKGFNILYTAKVPMTTAALGGQISIPTLEGEVDVKVPQGVSPGDTLILPGKGIPKLQKSRQNPGDMKVEFQIQFPKSWSPYEQLLLEQLADSIGDKN............ 392
72 0.000e+00UniRef50_A0A1Q2CH15 Chaperone protein DnaJ n=2 Tax=Propionibacteriaceae TaxID=31957 RepID=A0A1Q2CH15_9ACTN  ali  29  8....EKDYYKILGVSKTATSDEIKKAFRKIARDNHPDQNPGN-----KAAETRFKEASEANSVLSDADKRKEYDEFGGGFRFNKPGQPGAAGFEDIFRNAGGATNPG---FGDLFGGLFGGPTRRATQRGPRRGADIEGDVTISFEQAVEGATVTMRTVSDRPCPGCRGTGAKAGT-LPRVCPTCEGSGM--QSSRSG-GVFQMSEPCVDCLGRGLIVDEPCPDCDGSGRGRSTKTMQVRIPAGVSDGQRIRIKGKGAAGGGAPGDLYVGVKVTPHKLFGRSGSNLTLEVPVTFTEASLGAEIQVPTLSGKIRLRIPPSTPNGRTMRVRGKGARKPDGTM---GDLLVTIDVQVPDDLSEEAKAALQEYAE.................. 369
73 0.000e+00UniRef50_D2QAE1 Chaperone protein DnaJ n=100 Tax=Terrabacteria group TaxID=1783272 RepID=D2QAE1_BIFDB  ali  25  3......DYYEVLGVDRSASDDEIKKAYRKMSRKYHPDI-------AGPEFEDKFKEVNNAYEVLSDPQKRQMYD----AGVDPN-------DPNXXXXXXXXXXXXDMGDFLNIFGGAFGGGAGAGPRPRTQPGRDALASVTIDLKTAVFGDTAHVRINTFGLCQECAGTGCQKGT-QPTQCPECHGKGFAQRVVRTMLGQMMTTAPCERCEGHGTVIENPCPSCLGHGRVRTTRNVGVSIPAGIGNNTRLRLANQGEVGGGVAGDLYVDVRISSDDTFTRDGDDLHCWIQVPMSWAVLGHDLEIDTFDGPQSVSVPAGCQPEDTVTLKNLGVTHMSGNGD-RGDLVAHVVVQIPTKLSDDERSLMEQFAPTVGAKKGFFSKLKDALR. 382
74 0.000e+00UniRef50_A0A0C9QX16 TSA: Wollemia nobilis Ref_Wollemi_Transcript_2194_1799 transcribed RNA sequence n=8 Tax=Spermatophyta TaxID=58024 RepID=A0A0C9QX1  ali  28  9..SDNTKYYDILGVSKSATSDELKKAYRKAAIKNHPDKGGDP---------EKFKELAQAYEVLSDPEKREIYDQYGEDALKEGGGGSASHNPFDIFESFFGGSPFGGSF-----------GGGSSRGRRQKQGEDVVHPLKVTLEDLYNSISKKLSLSRNIICPKCKGKGSKTGVS--SSCAGCQGSGMRVSIRQLGPGMIQQMQVCNDCRGSGETIKDKCAQCKGAKVIQDKKVLEVHVEKGMQHGQKIVFQGEADQAPDITGDIVFVLQLKEHPKFKRKGDDLYMEHSLILTEALCGFQFPLTHLDDRLLIKSSPGVKPGQYKAINDEGMPQYQRPF-MKGRLYIHFNVDFPESLSPEQCKALESILPPRP............... 367
75 0.000e+00UniRef50_A0A0G1JQ86 Chaperone protein DnaJ n=3 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1JQ86_9BACT  ali  32  3.....KDYYNLLGVSKNSSEEEIKKAFRALAHQYHPDKKSGN--------EAKFKELNEAYQVLSDPEKRKKYDQFGASFEQMGGSATGGAHWEDIMNAFFGGFAGFSFDIGDIFSEFFGGRASSSSMSGASRSRDIEIAIEIEFLEAVTGAERTLELKKFDKCSRCKGNRAEPGT-PLITCKECGGRGEVSQTRQTILGVMRTSGQCGKCGGEGVFPKLNCKHCNGDGMERVAKKIKVRIPAGIQNGEAIRISGEGEENAARYGDLYVGVRIRSHHKFKRDGDDIHSSELISFTQAALGDKIRADTAHGKVELKIPAGTESGTAFKLKHKGVPSLRGGGE--GDHYVTVKIVVPERVSAKAKKLLNELKEE................. 379
76 0.000e+00UniRef50_A0A2M7AF77 Chaperone protein DnaJ n=1 Tax=Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28 TaxID=1973917 RepID=A0A2M7AF77_9BACT  ali  27  4.....RDYYQILGVDRGADKKAIKSAYRKLARKCHPDVNPND-----KRAETRFKEISEAYHVLGDAEKRKLYDQFGDNWFTANAGGPEGFSYD-----------FGGGDFSDVFETLFGQSRRAGRTRATNKGQDIEHEIAVTLDEALSGTTKRVQLSLREPCQSCHGVGGR-----TQTCGACGGSGM----QKQGGGIFNLGSPCPRCHGQGETLSDTCGACHGSGSVDSTRKLDVNVPAGVKDGSRIRVGGQGGSGAGNGADLYLRVRVEKDAFFERRGDDLHCELPISFPEAALGAEVQVPTKKGRVNMKIPAGTQSGQTLRLSGLGAPHLRGNG--HGDQYVKIKIVVPNDLTEEERFLIKEMASKRTENPR........... 367
77 0.000e+00UniRef50_A0A2E1WRH0 Chaperone protein DnaJ n=20 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2E1WRH0_9ACTN  ali  31  4......DYYELLEVDRGASPEDLKRAYRKLARKFHPDANPND-----EQAEAKFKEISEAYAVLSDNEARARYDQFGHEGLRSGGMGGDPFN------------FDLNDIFENFFGGNPFGGGRNRRPAGPPPGEDQEIILDLAFDEAVFGVDKKVEIQTAVACDRCGGSGAAEGTAA-RSCTDCGGLGQVRQMRQSLLGQMVTTAPCPRCSGLGEEIPTPCQSCRGEGRRRDTMSYEVRVPPGIDSGSTLRLRGAAGPRGGPAGDLYVHLRVEESDRFVREGDVLHAELHVTMLQAALGARINFETLDGIVELAIAPGTQPGEIFRLRGYGVPRLEGRGRGRGDLLVSIKVDIPSKLSKDEEEQLRQVAQRRGEDRTVLGKIRSAFQ. 375
78 0.000e+00UniRef50_A0A0G1X7I7 Chaperone protein DnaJ n=4 Tax=Bacteria TaxID=2 RepID=A0A0G1X7I7_9BACT  ali  30  3.....KDYYQILGVAKGATPDEIKRAYRKLALKYHPDK-------GENGNADKFKEVNEAYQVLGNADKRQQYDQFGHSFEGAGPGFGGFDFSGFNTSDF--------GGFEDVFSTFFGGRTSTPRRSREKRGEDLEIAIEISFETAVFGGTQTIHLAKDTLCESCGGTG--SINKQMKRCAKCNGSGHVEQVRQTMLGAIRQSKTCSECKGLGEMPEQTCRHCTGTGRTKQPVAVKVEIPDGIDDGQTVRVPGGAGFRGGKPGDLYVTVRVIPSREYRRDEFNLYKVVTVPFTVAALGGEVKTQTLDGTINLKIPPASQPGDVLRVKGHGVPKI--SATGRGDLYLTIEIQVPKRLTLKQRKLLQELNKEWGKE............. 358
79 0.000e+00UniRef50_A0A067NRF2 Uncharacterized protein n=2 Tax=Agaricomycotina TaxID=5302 RepID=A0A067NRF2_PLEOS  ali  27  16...AAKDPYQVLGVKKDASQAEIKKTYFSLARKYHPDTNPD------KSAQAKFLEIQEAYDILKDEQKRASYDKYGAAGFDPNAFSGFGGRAGG-FQDXXXXXXXXXXXXSDLFSQLFGAFGGPGFGEASTRGADLEATIGISFLEACKGTVRKVNVSPVVNCNTCTGTGLKKG-AKRTTCRTCNGTGTRTFVIDSG---FRMASTCPECSGAGSSVPGECTVCHGVGKLRMKKSVQVDIPAGVEDGMTIRIPKAGDASGSGTGDLLVRVNVAPSKVFVRQGANLYHKAKIPLHTALLGGRVRVPTIDGDVDVRVPGGTQQGEEMVLKERGVASV--YGGDKGDLFIAFSVQLPRSLTPRQRELLQAYAD.................. 380
80 0.000e+00UniRef50_A0A1X6RLK5 Chaperone protein DnaJ n=12 Tax=Bacteria TaxID=2 RepID=A0A1X6RLK5_CHLAO  ali  34  1MAKNKRDYYEILEINKDATEREIKTAYRKLAMKYHPDRNK------EPDAEEKFKEVSEAYEILSDPEKRAKYDKYGHQAFDQAQFGTA---PEDIFADFFKSFQGWFGG-GDIFEEIFGGFGGSNRRNRATPGNDVQISITIDFLDAINGKKTTIPVSQSVICSNCNGSKAENP-SDFKTCEHCNGTGRIEQKVA----FFTTQTTCRHCAGTGKIISKICHLCNGAGLERKQINLDIDIPAGISDEQTIVKKGYGMPSGGENGSLYIVVHVREHKYYERVNDDILLSVPVSMKDIILENKILIPTPYGKVQIKLTRDMKFDKTIKIENYGATIL--GTKKRGNLLVTLKPYIPK................................. 343
81 0.000e+00UniRef50_A0A2E8T9W3 Chaperone protein DnaJ n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2E8T9W3_9CHLR  ali  31  2...TNKELYSILELTREASTEDIKKSFRRLAMQYHPDKNKDD------DAEEKFKEVTFAYNILSDPEKKARYDSFGMEGVVNEGANFSDFS--------------NFGGLGDIFDAFF-QGTASTQKQTNLRGTDIAIELQVSLEEVHKGAKKTIHFEHNTACSKCKNTGQKNG-AQLGECKECNGTGEIRRVERQLFGQFVNVMSCNMCTGQGKIVTDPCEDCSGFGIKLEESTKDIDIPKGIRSGQKIRISNQGNSGGGVPGDLYLHINVNEHKVFKRIEDNLIYEMAISVPDALIGFEKNIPLINEEKKMKFKPGVQHGQLFRIKKKGMPGLNSN--AHGELIVVANIIIPKKITNTQKKLIQELSEQIPEELSVLNKF...... 368
82 0.000e+00UniRef50_A0A061J8K8 Chaperone DnaJ protein n=2 Tax=Trypanosoma TaxID=5690 RepID=A0A061J8K8_TRYRA  ali  27  1MAKETE-YYEILGLSVDAVDHDIKRAYRRLALKYHPDKNPND-----KEAAEMFKRISHAYEILSDEEKRRIYDQHGKAGLEGGSMGDDGLDASDIFSMFF---------------------GGGRRPRGERKPRDLVHELRVSLEDLYNGKTRKVSVTRDRRCDACDGNGIKPGAER-RTCVVCRGQGVQTFVQELFLGMHQIQQTCQSCGGEGTTVRDICGRCRGSRMMKDQKVLEVHIEKGMRHQDVVRFDGEGDEVGGMRGDVLIILAQKPHDVFRRVGNHLLMNYTINLQEALCGFELPVQHLDRRMLIKIPCGIDPEAAWVVRGEGMPLPNTGGLSRGNLIIHFEVEYPTQLSTRQLKGIAAALDAKETLPR........... 358
83 0.000e+00UniRef50_A0A2U9BVW5 DnaJ-like subfamily A member 4 n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9BVW5_SCOMX  ali  29  372MVHET-GFYDLLGVGPKSSPEEIKKAYRKLALKYHPDKNPSEG--------ERFKLISQAYEVLSDPKKRDLYDQGGEQAIKEGGMS-GGTSPMDMFNMFFGGGG---------------------RMQRERRGKNVVHQLSVTLDEVYNGTTRKLGLQKNVICEKCDGYGGKKGA--LEKCSNCKGRGVQIKVQQIGPGMIQQQSMCSDCQGQGEKPKDRCKNCNGQKVERKKKILEVHIDKGMKDGQKITFHGEGDQEPGEPGDVIIVLDQKEHPVFQRQEDNLTMKMNIKLVEALCGFKNTIQTLDDRTLVISSEVIKHTDIKRVANEGMPIYRDPY-EKGQLFIQFQVAFPEKLPEHLMFQLERLLPARED.............. 721
84 0.000e+00UniRef50_A0A1I8A7C5 Uncharacterized protein n=6 Tax=Chromadorea TaxID=119089 RepID=A0A1I8A7C5_9BILA  ali  30  28...DAKDYYKILGLKKDSSAKDIKKAYYKLAKEYHPDVNKG------KDAAEKFQEVSEAYEVLSDEGKRAQYDQFGTDPFGGRSTAGAHPGAGAAGNWNFNGDFDPFKIFRDFDMKMRTGGGFAESMHGF--GSTQQTSINISFEEACRGGNKTIPINVVDDCGKCRGSGTEPGYKKVS-CPYCNGTG---FTTQHIQGFF-MQTNCSHCRGSGAYNKNPCIECEGLGQSVQRRQVTIQVPAGIDNGQTVRVRGK--------GDVYITFNVAESLRFRREHDNIHCDVEISVAQAMLGGTVKVPGIYEDTNIHIPPGTSSHTRMKLSGKGIKRLNHHG--RGDQYINIKVRIPKRLTERQKALIQAWAELETDTPGTVAGIRK.... 387
85 0.000e+00UniRef50_A0A0G1JK59 Chaperone protein DnaJ n=10 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G1JK59_9BACT  ali  30  3.....RDYYEILGVEKKATQEEIKKAYRKLAHQHHPDKAGG--------AEEKFKEINAAYEVLGDGKKRQQYDVSGSADFQNGPQGGAGGNWQDFASH--SGGTGVEFDLGDIFNSFFGGGGQRGAQSRARQGSDLEVRLDLDFLEAVFGAEKEISLRKNVVCTRCSGNGAEPGSEIITCTTC-KGTGTITHTRNTMFGAFSSSSPCHSCAGEGKKPSKACTQCGGRGMKMEEQAIKVTIPAGINSGESLRVSGKGEEYGGRAGNLYVSVRIKEHLLFVRDNDNIKTTKHISFSCAVLGDKIMVETLDGPVSMKINPGIESGTIMKIKGKGVPHLRS--SGRGDHLIKIKIETPKNISRRVKKLIETLKEE................. 365
86 0.000e+00UniRef50_A0A0P1AHB3 RxLR-like protein n=18 Tax=Peronosporaceae TaxID=4777 RepID=A0A0P1AHB3_9STRA  ali  28  46......DFYETLELTMEASEAQIKKAYRKLSLKYHPDKNKGD-----EEAESRFHEISRAYEVLSDPQKRQVYDLEGFEGLERDEKSGG--RPSSPFDAFFGGGG-------------------------KQRGPDAAVDVRVTLEELYNGAQKQAQFSRNVICRKCRGTGAKGG--KTTTCKKCGGSGHVLVQQKMGPGFVQMQQPCPKCGGRGKTFKKACPFCNGNKVVKEDKVLTADIERGMPSQHEIVFERESEQRPGIPGNVIFRLHQVPHSHFRRAGDDLHFDLAISLEEALLGYRKPMKHLDDRVVLASSEVTKPFEVRTVEGEGMPVHN-YPSQHGNLLVHHEILFPTFLTEEQKMLVKKLLPEDP............... 381
87 0.000e+00UniRef50_A0A2P1P7D5 Chaperone protein DnaJ n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2P1P7D5_9RICK  ali  32  2...SQQDYYKILGVSQGASEDEIKKAYRKLAMQYHPDRNKGNL-----EAEKKFKEINQAYDILKDPQKKATYDRFGHESFNSGGFGGGGFGRA-------GGFDFGDIDVENIFDMFGFGGGGRSKSRGPQRGADLQYHMTITLEEAFHGTQKTISFACDTKCGQCNGLGSKTGA--ISTCTTCGGRGAIYMKQ----GFFSIERPCGTCGGAGHIVKDPCSSCGGRGAYQKTKNVEINIPCGVTDGMRLRKTAEGSAGGGASGDLYILISIKPHSIFRVDEANMHCRLPVSFITLILGGKVEVEDINGEKIVTIPQGTEHGHQITIKNKGMSI--TGSKSRGSLIVHVVSTVPKNLTAKQRQMLEELEKDLAQNKSIFDKMKNLW.. 374
88 0.000e+00UniRef50_A0A1M4TWS1 Chaperone protein DnaJ n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1M4TWS1_9ACTN  ali  32  9....EKDYYKILGVSKDASDKEITKAYRKLAKQYHPDANPG--------SEEKFKEISAAYDVLGDQTKRKEYDEARSQGPMGGGFGGGAGANFD----------FKVEDLGDLIGGLFNRGRGTSRGTGPQRGKDLEAEVHLSFEEAAKGATTTVNVVGDSSCSTCGGTGAAPGTV-PQVCARCQGSGSISDNQ----GFFSFSQPCPACGGRGIVVTKACPTCRGTGVERRSRQVKIRIPAGVEPGQRIRIRGGPGKNGGPAGDLIVLVHVGRHERFGRSGNDLTITIPISYPEAALGTVISVPTLEGKISLKVPPGTRSGKTFRVRGRGIPSSKKGGTP-GDLLVTVEVWVPESLDQKQRKLLEELAKYTPEPPR........... 361
89 0.000e+00UniRef50_A0A2N6BCQ5 Chaperone protein DnaJ n=2 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2N6BCQ5_9DELT  ali  33  2...ARKDFYKTLGVSKDATEDEIKRAYRKLARKYHPDVNPGD-----KASEEKFKEISEAHEILSDKEKRAQYDQFGDSPFGGGGQQSWGGG---------GGFNTGGFDFGDLFGNIFGQGGA--QPRGPRKGADLEYELEVSFTEAILGAQKEISVRRNASCQTCGGSGHE-ASGGGQRCPQCQGSGRVSVK----LGPMTSQQPCPSCGGTGRTQGPPCKNCGGSGKNAKNERLRVKIPAGVETGSKIRIAGKGEGGTGGDGDMLIRIKVAPDNRFTRQGNDIISEVEVPLSDALLGGHALVPTLTEQVKMKIPAGTQNGQRFRIKGKGVP-------GKGDLYAAIKVKIPRSLSAKAKETLESLREELK............... 344
90 0.000e+00UniRef50_A0A0L0HI24 Chaperone DnaJ n=1 Tax=Spizellomyces punctatus DAOM BR117 TaxID=645134 RepID=A0A0L0HI24_SPIPN  ali  29  84..SPKRDAYQVLGVNRDASANEIKKAYYKLARDYHPDTSKD------PNAKDKFIEIQEAYDILSDDQKRANYDQFGHSAFTGGEGPSFHGNAQDIFEQLFTGGFGGMPGMGGMGGRGGFD----------AVGRNIKTSMNVSFMDAAKGTTKPITFTSIVKCKPCTGSGMKAGH-KPQRCNVCGGAGQVSFVR----GGFHMASTCQACGGTGVRIPAKCGTCDGVGRVKEKRTVEVKVPPGVYDGLELRLPRQGNAGDGPEGDLFVRLNVQSHPTFKRDGADVLVNADVPLEKALLGGTIRIPTIDGEVELQVPPGTQPMEKKRLRRRGVRKIDRMGDERGDQWVTLNVALPKTLTEKQRKLLEEAFDVEGTGKK........... 472
91 0.000e+00UniRef50_J4H541 Uncharacterized protein n=2 Tax=Polyporales TaxID=5303 RepID=J4H541_9APHY  ali  28  389MVKETK-YYDLLEVSPDASEADLKKAYRKKALRLHPDKGGDP---------ELFKEVTHAYEVLSDSQKRTVYDARGEAGLSESGGM-GGMDPQDLFSQ--------------LFGGGGFFGGGPSRGGGPRKTKDLVHRVHVTLEDLYKGKTSKLALTRNVICGKCNGKGGKDGA--VQTCTTCRGQGVRVTLRQMGPMIQQIQQPCDTCNGTGEMIKDRCKTCNGKKVSSEKKMLEVHIDKGMKGGQTINFRGESDQAPGVPGDVVIVIEEKPHERFRRQDNDLIIDQEIDLLTALGGGQFAIKHLDDRAIVKINPGIKHDELKVIPGQGMPSHRHH--EPGDLFVHFTVKFPESIDPSLISQLEQVLPPRAPIEKFPKSI...... 748
92 0.000e+00UniRef50_A0A0S6VQY4 Chaperone protein DnaJ n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0S6VQY4_9BACT  ali  30  6......NYYKILGIPEQADDTEIKSAYRKLALKYHPDRNAGD-----KFAEEKFKQVTEAYRVLSDEKKRAEYD-LGRSPSHQESRAASARNKHANFDEVF-----------DIFDNVSSSKTSSSHKRQQVRGADLTHELSISFEEAALGTTRVIEVTRMEQCLRCRGTGIEP-RTYPMLCPACLGKGRIRQSH----GFLGFTQVCQECNGSGRVYQKDCAECRGDSRLPQTRKISVRIPPNVHDGASLKVAGEGEHGGGGTGDLLIHVHVEPHEFFGRKDNDIWCEVPLTITQVVLGDTIEVPTLEGKVRIRVPAGTQPDRIFRLAQKGVPSQADG--QRGDLFVKVKLQIPTEVTPRQRQLLEEFGRLSGERS............ 356
93 0.000e+00UniRef50_W6TV90 Chaperone protein DnaJ n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=W6TV90_HOLOB  ali  34  3......DYYKVLGVPSNASIQDIKKAYRKLALKYHPDQHQNSSSAEKQKAEKIFKEVTEAYEVLGDEKKRRMYDQMGPDAFRQSSSGGGGF----------EGFSEAGFDFSSIFEDFFSNFGSSSQPT-VSKGRDVLIKISITLEDAFKGVNQSVEFSTIVRCDSCSGTGGEKG-SKVVQCTTCHGKGEVGISQ----GFFMVRQTCKRCQGTGTYIAVLCKKCRGSGCMRDRRVLDFRVPPGIEHESQLRLHGEVGERGGPCGDAIIQVNVQSHSLFRRKGANLFMNYPLSISQAALGCVVQIPTIEGEVSVTFREGTQFKEKTVVHNKGMP----YSSGRGDLIIEADVYVPLKLTQRQKELLQDFLEEEPETTGFFAKLKNFFKT 372
94 0.000e+00UniRef50_A0A0G1Q7M7 Chaperone protein DnaJ n=20 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1Q7M7_9BACT  ali  31  31.....KDYYKTLGVARNATKEEIKKKYRELAHKHHPDKGGD---------EARFKEVNEAYQVLSDERKRNQYDQYGHVFDGSGGGAGAGQGGFEDFGQEGGAGSGDFDFTDVFDDFLGGFGGGGRAKARSKRGKDIQIELEIKFEESILGGKKEFSFARLGRCGRCEGSGGEP-NTKIKECPTCRGQGSVQKTQRTILGSFTQVATCQECHGSGKRPESLCSHCRGRGVEEITENLEVVIPRGINNGEILKITGKGEASGGTPGDLYIKLRVLPHPVFRRQGDDIIMHLPLKLSQAILGDMVDVETLDGAIQLKIPEGTQSGDILKVRGKG--AFSSSGYGRGALLIEIKVEIPKKAGREIKDIAHKLKSE................. 394
95 0.000e+00UniRef50_A0A1Y1Z840 Uncharacterized protein n=3 Tax=Basidiobolus meristosporus CBS 931.73 TaxID=1314790 RepID=A0A1Y1Z840_9FUNG  ali  34  71....KEDAYELLGVSRNASQSDIKKAYYKLAKKYHPDTNKD------KAAQEKFVKIQEAYEVLSDEQKRASYDQYGHAAFNGNAPPGAGGNADDIFSQMFGG----------------GFGRRSNPASQFTVGDDIQVNLAIDFLEAVKGATKRITISPVSVCDPCHGEGLKSGKQK-ETCKVCGGTGQTTYS--IGIGMI--ASTCNSCSGTGKSIPSQCPSCNGVGRVKKPKTVNVNIPAGVDEGVKIRLSNEGDMGKGTAGDLYVRLRVKPSSIFRREGPNVFVDAKVPLHIAILGGNIRVPTLDGDVELKIPVGTQPEDVSILRNRGIKKLNRN--AHGDQYVKLKVEIPRNVTPHQRELIEEFVREQE............... 425
96 0.000e+00UniRef50_A0A2H5ZZT2 Chaperone protein DnaJ n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5ZZT2_9BACT  ali  30  3...AVKDYYEVLGVSPEASAEEIKKAYRKLAKRYHPDANPND-----PSAAEKFKEVSEAYSVLSDAEKRKQYDRYG--AFAGTGAGSTRFEGFDFGDLGFGGFGGLGDLFSSIFG-----------RSRRAAVEPIEVTVPVSFATAARGGKVTVEIPVNETCPACGGSGAAPGT-RVAACAECGGRGTVTF----GHGGFSVSRPCPACRGRGRHVAQPCARCMGQGEVRIGKRVVVTVPPGTEDGQTVRLRGQGHPSGGPPGDVLITFRVEPDRFFRRDGLDVYCTVPLNLAQALLGTKVRVRTLDGKVVLKIPPGTSPGKKFRIPGQGI----EKNGRRGDQYVEIAVNLPERLTPEQERLFRQFADSLG............... 352
97 0.000e+00UniRef50_B4FTR0 Chaperone protein dnaJ n=6 Tax=Mesangiospermae TaxID=1437183 RepID=B4FTR0_MAIZE  ali  32  57.PVAARDYYDVLGVSKSASQAEIKKAYYGLAKKLHPDTNKGDA-----DAERKFQEVQRAYETLKDEQKRSLYDQVGPDQYEKTASGGGGTGFEGGFGNPFEDIFGGGGGMNDFFRNIFGDRDFG--------GRDVKVALELSFVEAVQGCSKTVTFQTSVTCEICGGAGVPPGTT-PETCLSCRGSGFIFMQT----GPFRMQSTCTKCGGSGKTVKEFCKACRGNKVVPGRKSVRLDILPGSDNEDTIKVRSGGEDPDGRPGDLYVTLEVREDPVFRREKGDIHVDAVLNVTQAILGGTVQVPTLSGDVVLKIKPGTQPGQKVVLRGKGIKTRNSPY--HGDQYVHFNVNIPENLTSRQRELIEEFAKEEQGE............. 415
98 0.000e+00UniRef50_A0A1Y1V606 Uncharacterized protein n=4 Tax=Neocallimastigaceae TaxID=29007 RepID=A0A1Y1V606_9FUNG  ali  30  80...TKKDLYEVLGVKKGASAKEIKTAYYKLAKTYHPDTNK------SKEANEKFIEIQNAYEILSDDKKRAQYDQYGHAAFDPNARAQGFQGRGDIFEQMFRGFGRAGNMGGFGNMGGMGGMGGQYDPYRKHHGRDIKTTMTIDFMDIVKGTKKELKYYHMVFCHDCDGTGTNNKSTPGK-CPKCNGTGQEFIQH----GGFGMARPCSQCHGEGFYIPKRCKKCDGKRLVRKLDTVEVPIPKGVDSMVQLRLAGKGDAGKGPFGDLYISVNILPHPIFKREKNDIHVNVNLPLTTAILGGKVTIPTVDGDIEMDLPAGIQPEDKKILRARGLYIMDTN--VRGDEWIHFKVEIPKHINKKQRELLKLFQEEEE............... 453
99 0.000e+00UniRef50_C9RP33 Chaperone protein DnaJ n=33 Tax=FCB group TaxID=1783270 RepID=C9RP33_FIBSS  ali  33  2..AEKRDYYEVLGVGKDASADEIKHAYKKLAIKYHPDKNPGD-----KEAEEKFKEAAEAYDVLSNPEKRKNYDQFGFNAXXXXXXXXXXXDINDIFSQF--------GDXXXXXXXXXXXXXXSSRKAGPPRGNDLQIKVALSYKEIFEGCTKKVRLKRYTPCTECNGKGG----TNVKTCDTCHGTGRVRRVS---GGFFQMVSVCPTCSGMGEVIANPCSHCHGEGRVQETEEISIKIPAGVSEGQYLNLRGEGNPRGGACGDLLVVIAEKPDDFFSREGDDLHCEVKVPVHKLVLGGTQRIPTISGDEIIKIAAGTQAGSVLRLRDQGLWPLKKQGD-RGSLYVQIGVDIPKDISREXXXXXXXXXXXXXXXXSFLEKMKNLFK. 380
100 0.000e+00UniRef50_A0A1Z3LIW9 Chaperone protein DnaJ n=10 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1Z3LIW9_9MICO  ali  27  3......DHYEALGVARDASTDEIKKAYRKLARQLHPDVNPG------AEASERFKTVTHAYDVLSDPKQRQNYDR--GGSGNGQGGGFDAGNFGDIFETFFGGGGGGSRGPRSRRE----------------RGQDALIRVELDLDEVIFGTHRDIEVDTAIVCATCSGTCCQPGTSPV-TCDICHGTGSIQRAVRSLLGNVMTSSPCGSCRGYGTIIATPCVTCQGQGRVRARRTVPVDIPAGVDTGLRLQMPGSGEAGGGPNGDLYLEMKVRHHDVFSRDGDDLLCTLEVPMTDAILGATATVKALDGDIEVELRPGVQAGEILTVKDRGVTRLRGNG--RGDLRVGVQVLTPTKLDHKERELIEAFAALSQFQQGLFAKLRDRF.. 366
101 0.000e+00UniRef50_A0A0N1I257 Putative chaperone protein DNAj n=32 Tax=Kinetoplastida TaxID=5653 RepID=A0A0N1I257_LEPSE  ali  27  61..SAKKDLYSVLGVPRNATAEQIKSAYKKRAKALHPDVNP------SPTAAEDFAEAKQAYETLSDPQKRSMYDMTGNAAAGGNPFANMGGNPFANAGGQGGQGGFSFNDFEEIFQKMSGSGKKTRKPQGPEPGADIHYKLTLAFLEAVNGCQKEISYNTMRRCGACTGSGFQDTGSRAK-CPHCGGRGKKVMST----GFFHMQQDCTHCGGTGELGRTTCTQCSGKGIVKDRSVQTLPVPKGVDNKERLKVTGKGEAGNGPPGNLYIEISVEEHPVFHREGSDIHVITPITLSTAVLGGTVRVPTLTGEVETRVPVGTQQGDKLVLRGRGV--HRPNQNKTGDFFIHFAVMLPKSLTEAQKKAIADFAKDEKPSDTELQELKGRYRS 459
102 0.000e+00UniRef50_A0A2G5B4I5 Uncharacterized protein n=1 Tax=Coemansia reversa (strain ATCC 12441 / NRRL 1564) TaxID=763665 RepID=A0A2G5B4I5_COERN  ali  28  75...ASQDFYDVLGVNKDASQSEIKKAYYQLAKKYHPDANK------EPDAKDKFVKIQEAYDTLSDENKRRSYDQFGTADPGEGAGFSGFGNMEDILSQ---------MFGGGFSGMGGSGRGGAGGGGFVSVGEDVEAAVTISFMEAVKGTKTSVTITPVVKCQPCAGQGTKKG-ARRDKCKTCRGTGRAMFQM----GGFHVQQPCPECGGEGSTIKDKCSSCGGNGRVRERKTVPVDIPPGCDNGMRVKLQGLGDAGAGPSGDLYVRVRVIPSKIFRRKGADLYYDLSLPFTTAILGGTVRVPTVDGDVEVKIRPGTQPGDELRLRSKGAQKINS--SVRGDQYLSLNVKLPKKLSTTQRNLIEQFADVQGKPPS........... 440
103 0.000e+00UniRef50_A0A2E4FX39 Chaperone protein DnaJ n=1 Tax=bacterium TaxID=1869227 RepID=A0A2E4FX39_9BACT  ali  30  2......DLYQVLGIDTSATDSEIKRAYRKLARQYHPDVNKD------PNAQTKFNDLQKAYDVLSDSQKRAQYDQYGVTDDQPXXXXXX------------XXXXXXXXNMEDIFDSVFGGGGRRGNH-GATQGDSLRYDCTVTLEDVVDGCSRTIEYDHLAFCKTCDGTGAKTGSS-VATCSRCQGTGEIRHVQQTMLGQFAQVSTCPECQGEGKMIKEKCLGCKGHGVSKKKKSLDLNIPGGISSGTKLRVGGNAGQRGGPPGDLYVVIQVRNHAKFDREGDDLYSEETISIVEALLGVQLDVKTIEGTATLRIPEGTQPGTRFRLKSKGIKHLKGFG--RGDQYVKVSVNIPKKLSKQQREIIQSF.................... 344
104 0.000e+00UniRef50_L7J6T2 Chaperone protein dnaJ n=2 Tax=Magnaporthe oryzae TaxID=318829 RepID=L7J6T2_MAGOP  ali  28  339..AAHKDPYKVLGVDKTASASDIKKAYYGLAKKFHPDTNKD------PTAKEKFGEIQSAYEILSDATKRQQYDQFGAAGFDPNQGGGDPFNMEDLFSAFTGQKGPXXXXXXXXXXXXXPFG------PQTVVGDNIEVQASISFAEAAKGTSKTVTINPLVSCKTCKGSGLKAG-AQRTTCKTCQGTGARVH---TINGGFQISSTCTKCSGTGSVTPSDCGTCHGDGVTRERTTIKVDIPGGVEDGMRLRVDGEGDAGGADPGDLFLLVRVQADPKYKRTGSDIVYTATIPLTTAILGGEVKIPTLDGDVNVKVATGTNTGDIITLSGMGMKKLGSRYAGKGDLRVEFKVAMPKYLSANQRTIVEMLAEDMGDK............. 733
105 0.000e+00UniRef50_A0A1H3P6Q3 Chaperone protein DnaJ n=20 Tax=root TaxID=1 RepID=A0A1H3P6Q3_9PROT  ali  28  2...........LGIARDVDQKAIKDAFRTLALKYHPDRNK------EPGAEERFKEIAEAYAILSDPAKRAEYDARGFAGV-------AGTSREDLFSGIFEDIFGGLNFDFGMGNLFDGFFRRHKKQAESIRGANIEMDLYVTLERVAAGGEEVVHLTRPVACSACHGTGGEGGIAPRK-CKTCGGTGRMTYSHRKEHLLIQQIVPCSACHGRGSINDHPCPQCHGSGEVEQEETLTVKIPAGIEEGMALRIAGKGMPGDGVAGDLFVVVRTREDARFERAGADLWHTVTLPLSDAVLGATLKVHTLDGAIEVTVPAGTQSDAILRLKGKGLPVFKSDRL--GDLYLRIRLKVPEHLSHEERELYEQLRAIS................ 353
106 0.000e+00UniRef50_R5Y0I1 Chaperone protein DnaJ n=8 Tax=Proteobacteria TaxID=1224 RepID=R5Y0I1_9PROT  ali  28  1MSTTTADYYEVLGVTKTASGEEIKKAYRKLAMQYHPDRNPDXXXXXXXXXXXXXXXXXX-----XXXQKRAAYDRYGHQ--AFTGGFGGAGAGANPFNGFDFTGAGFADVFSDIFSE-FTGQGRARQRSYAQRGDDIRYDVTLTLEEAYVGLEKEINITSSKECETCHGHGTADGKEPP-VCATCGGSGKVRTQQ---GGFFVFETVCPQCRGAGRVILDKCKKCRGTGKEKLEKSLKIKIPAGIENGTRMRVAGEGEAGGGPKGDLYVFITVKRHKTYERDGADLFTVSPISMAMAAMGGKFRLKGIDGEEIVEVKPGTQPNDKLRIKGKGMRYMNS--DRRGDLFVEFKVLIPTKLTEAQKECLKQFAAAPEEEKSFWAKL...... 373
107 0.000e+00UniRef50_A0A225ADS2 DnaJ-like protein 1, mitochondrial n=7 Tax=leotiomyceta TaxID=716546 RepID=A0A225ADS2_9EURO  ali  27  80..QAMKDPYKVLGVDKNASSSDIKKAYYGMAKKYHPDTNK------EPGAKDKFAEAQSAYELLSDTKKRETYDRYGSGAFDQNGGFAAGGNPFAGAGGFHGFGSGFGGNFEDLFGAFTGGAGRAGRRRASPHGEDIEVQTNISFMEAAKGAAKDIHITPLVGCNTCSGSGLKKG-AKRTQCKSCNGSGTRVHFMQ---GGFQLASTCDACNGSGMVTPSDCGTCSGQGVVRDRRTVHVDIPGGVEDGMRIRVAGEGDSPPTQRGDLYVSIRVAPDHRFSRSGSDILYTASLPLTTALLGGEVTVPTLDGEVKVKVATGTGTGDRITLSGMGMRKLGGNFSSTGDLRVEFKVQMPKYLNANQRTILEVLADEMGDKS............ 473
108 0.000e+00UniRef50_A0A2D5C614 Chaperone protein DnaJ n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D5C614_9FLAO  ali  33  1MV---KDYYNILEVDRSASERDIKKSYRNLSKKYHPDKNPDN-----KESEDKFKEVAEAYSILSDKEKRGNYDTFGDPNGQPQNPFGDMGDMNDIFSQFFGGGRNPFGG----------------RGSRRKKGGDIRINVHMTLEDMYNGEHKTIKYRRNKKCGTCDGTGGES-----TTCGNCKGHGVVNQIQKTPMGRVQSTVTCPSCGGTGKIITNPCGDCSSNGVISSEERLSFDIPKGIMDGESLRVTGKGNSKDGVDGDLFINIIEKPHPTFRRSGLDIHQRVNLSYKDLVLGSPIEVDTIDGKIRMTVKSGTQVGSMLRVPQKGFIRDN----QRGDMIVEVWLDIPKEVTEEEKKIIETL.................... 337
109 0.000e+00UniRef50_Q6FNQ1 Uncharacterized protein n=37 Tax=Dikarya TaxID=451864 RepID=Q6FNQ1_CANGA  ali  28  1MVKDTK-LYDTLGVSPGASDAEIKKAYRKSALKYHPDKNP------SEEAAEKFKEVSSAYEILSDSQKREVYDQFGEEGLSGNGGAGFPGGFEDIFSQFFGGATGG-------------------RPRGPQRGRDIKHEMAASLEELYKGRTAKLALNKQILCKSCEGRGGKEGA--VKKCSSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIKDRCKSCNGKKVDNERKILEVRIEPGMKDGQKIVFKGEADQAPDIPGDVVFVISEKPHKHFQRAGDDLIYEAEIDLLTALAGGQFALEHVSGKVDIVPGEVIAPGARKIVEGKGMPIQK--YGGYGNLLIKFNIKFPENHSEENLKKLEEILPPR................ 354
110 0.000e+00UniRef50_A0A0V1FKJ5 Mitochonrial uncharacterized protein n=4 Tax=Trichinellida TaxID=6329 RepID=A0A0V1FKJ5_TRIPS  ali  28  224..AEKLDYYEILGVPRNASAKDIKKAYYQLAKKYHPDVNKND-----PQAARKFQQVSEAYEVLSDENKKAQYDQWGSTDFGTASGGQGFHDPEELFRKIFGDIGFPGWNFDEFAESKFGFGSTQ------------EYVMHLSFQEAAKGVTKTASINTVDVCQKCGGKKTELGY-KMVSCPYCNGSGMETFSQ----GPFIMRQTCRKCSGTGQFNKNPCLECEGTGHTVQRKTVSVPVPAGVEDGQTLRMQGKKE--------LFITFRVSKSDIFRRDGADVHTDVSISISQAILGGTVRIPGIYEDVYLQIPPATSSHTRLRVAGKGIKKVNSYG--YGDHYVHVKIEVPEKLSDAQRAIIMAYAEMETNTPGTIRGV...... 593
111 0.000e+00UniRef50_G4M0M8 DNAj homolog subfamily A member, putative n=13 Tax=Platyhelminthes TaxID=6157 RepID=G4M0M8_SCHMA  ali  27  31.VSLLKDYYSILGVSKSASQSEIKKAYYQLAKKYHPDVNKND-----KSAAQKFQEVSEAYEVLGDENKRNQYDKFGSASTQNNFGGGQSHNPEELFRRIFRDSEFVFNEWSSGDKGFAESIFGSDATK--------EIPINLTFEQAARGVNKEISVNMVTNCPHCQGSRAEPGTDK-STCPSCRGTGTENMNT----GPFLLRSVCRRCHGTGTIIRNPCRECEGKGRIVGRKRVNVSIPAGVEDGQVLRMSVGND--GLRNNEIFLQIRVEKSRHFRREGADIHSDITVSLSQAALGGKMRVQGIYENMLITIPAGSCSDDRIRLPGKGISRINGYG--YGDHYIHIHIQAPKKLTDLQRALLLAYAETENNVTGSVEGV...... 398
112 0.000e+00UniRef50_UPI0009E279BC dnaJ homolog subfamily A member 3, mitochondrial n=5 Tax=Euteleostomi TaxID=117571 RepID=UPI0009E279BC  ali  27  25..SAKEDYYQILGVPRTASQKDIKKAYYQLAKKYHPDTNKDD-----PKAKEKFAQLAEAYEVLGDEVKRKQYDTYGTADFEQASAGAGQVDPEELFRKIFGEFSGSFGDFQSVFD-------------QPQ-----EYIMDLTFTQAAKGVNKEMVVQISDECERCHGRRNEPGT-KVQHCHYCNGTGMETINT----GPFVMRSTCRRCGGRGSVVTTPCVLCRGSGQTKQKKKVMVPVPAGVEDGQTVRMPGKKE--------IFITFRVQKSSTFRRDGADIHSDLHISIAQAVLGGTARAPGLYETISIVIPPGIQAEHRIRMSGKGIPRVNSYG--YGDHYIHIKIKVPKSLTERQRALMLSYAEDEKDVEGTVNGV...... 377
113 0.000e+00UniRef50_A0A0C9M6J7 Uncharacterized protein n=2 Tax=Mucoraceae TaxID=34489 RepID=A0A0C9M6J7_9FUNG  ali  27  20..VSAKDYYDILDVPRDAQKAQIKRHFKKLSRVYHPDKNAGD-----EAASQKFMEIANAYEVLMDDEKRSIYDRYGEEGLKQNGGQGRFHDAFDIFSHFFG-------------------GGRQHQGHQEKRGPDILIPFQVTLEDLYNGADIQLDVSKQVLCDHCHGSGARKP-EDIHICDQCEGRGMIIKRAQVGPGMFQQQQACHKCDGKGKVIDHVCPVCAGKKVRRGNEDYSLHIERGMQDGQRIILDEESDEYPEIPGNIVFEVRTAPHATFERRGDHLYTKQHITLIEALVGFKKTMTQLDNSIIELVREGTQYGFVQTIKGQGMPHQDNH-SQHGDLFVEYQVVFPKEIDPETIEYLKK..................... 367
114 0.000e+00UniRef50_A0A292PSR9 Uncharacterized protein n=1 Tax=Tuber aestivum TaxID=59557 RepID=A0A292PSR9_9PEZI  ali  25  59..AAVKNPYSILGVGKTASTSEIKKSYYSLAKKWHPDQNKD------PSARERFQEVQAAYEILSDPAKKEQFDQYGEAAFDPDSGFSPGAGAGPGQGGFSGFSGGFTADFS--FEDLFGSFGRSGGGRGSRGGDNIEIEVTISFMEAASGTSKDIRIHPLVQCKACSGMGVKPGTMK-KQCSLCYGTGTRVHHMQ----GFQMASTCERCRGTGTVTPSECGTCSGSGVTKEARTITIDIPAGVDTGMKMRVDGEGDASGKKRGNLFVHIRVTPHKEFSRKGSDIYYTATIPFTTALLGGQTKIPTLDGHVDIKVPMGTNTGDMIAISGKGMPGPNSPGRI-GDLKVEFKLNPPRTLTPRQRILLEMLADEFKDKN............ 438
115 0.000e+00UniRef50_A0A1S3AZY1 chaperone protein DnaJ isoform X1 n=26 Tax=eudicotyledons TaxID=71240 RepID=A0A1S3AZY1_CUCME  ali  30  110......DHYSTLNVSRNATLQDIKNSYKKLARKYHPDVNK------EPGSEDRFKEISAAYEVLSDDEKRYLYDQLSEAGVQGDYGDSQGVDPFEIFDAFFGGSDGLFRERDGI------GGINLNQRSEKIQSLDIHYALHLSFEESVFGGEQAIQFSFFETCGKCDGTGAKS-NSCIKLCANCHGRGGVVKTQKTPFGMMSQVSICSECGGDGKKITELCRSCGGSGQLQSIKKMNLVIPPGVSDGATMKIQREGDKKRGMTGDLYIMLHIGEKHGIWRDGIHLYSNISIDYTEAILGTVVKVETVEGLKDLQIPAGVQPGDRVRLPFMGIPDIN-KPSVRGDHLFIVNVQIPKRISDSERTKIKELALLKASTKN........... 473
116 0.000e+00UniRef50_A0A2N3G7B6 Chaperone protein DnaJ n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=A0A2N3G7B6_9ACTN  ali  27  7.....RDLYEILGVAQGVSSDEIKSAYRGKARECHPDVAQHDL-----ESEEKFKELTFAYEVLSDPEKRRTYDAFGLDGLRRGAGASGFGSISDLFDMFFGNG--------------YGFSRQRPARGGKERGRDMEMLMTVSLDDVLSGLEKDIEHTRMATCSLCDGSGMKPG-ARMNRCAVCQGTGDIRKTQRNVFGTFIRSQPCPTCAGQGEVVTDPCQNCEGAGRERITEKLRVSMPPGVERQDRIRIKGEGGARGGPSGDLYVVIDVASDDRFERNGKHLYTCVEVGMIDAALGAEIDMKVLDGTHKLKVPAGVQPDDVLKIKGKGLPP--RYGGRRGDIFVRVRISVPKQLTGKQRNLLESYRESEKAKAS........... 361
117 0.000e+00UniRef50_UPI0007112FCF molecular chaperone n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI0007112FCF  ali  29  7..........VLGVPRDASKAEIKKHYFELAKKYHPDQNKGD-----ENAKQKFIEVSEAYEVLKDDEKRARYDQFGEMGVNGAGYGQANVDMDELLRHFADIFGGEARSYXXXXXXXXXXXXXXYSGEMNNSGSDIAVSISIPFLDGINGCQRDLRVSKEVECSMCHGSGTGPNNQK-QQCPQCKGKGMIYSNR----GIMMSMSPCPRCNGSGSINTDVCTKCHGSGTQHSVSTISVKIPAGIDNGDTIRLVGQGNKGGGSSGNLY--INVEPDSFFSRRGADIYCNVPISVTTAILGGTITVPTLSGAVDVHVPAGTQCNTKMRLRSKGIRPMRSTFV--GDQIITFDVHIPKNITEEQRRLITEFGKDEKGVQSVVTRIKSFLDS 383
118 0.000e+00UniRef50_B0CP71 Predicted protein (Fragment) n=37 Tax=Agaricomycotina TaxID=5302 RepID=B0CP71_LACBS  ali  25  1..AGPKNPYDVLGVKANATAAEIKKSYFALARKYHPDTNPD------KNARDKFVEIQDAYDILKDKDKRAAFDKYGSSSQQPGFDPNAFQGGGFGSFGGFSQGFGGAGSHADIFESLFGGGGRESRSTGPQRGEDLEAAVGVSFLDACKGTTKTINVSTVVDCGTCSGSGLKAGASRSK-CGTCGGSGTQTFV---LNGGFHMASTCSTCSGTGTTVPRQCSSCGGIGKVRVKKTVQVKIPAGVEDGMTLRLDRMGDAGAGVNGDLLVRVNVARSQAFTRQGSNLYHDARIPFHTAVLGGRVRVPTLEGDVDVRVPGGTQPGEEMVLKGRGVPPL--YGSGSGDLFVRFAVTLPRSLSKRQRELLQAYADDTEGR............. 370
119 0.000e+00UniRef50_A0A0E9DT00 Chaperone protein DnaJ n=49 Tax=Bacteria TaxID=2 RepID=A0A0E9DT00_CHLTH  ali  31  2..AAQENYYDILGVAHDADAKTIKRAFLKKARQLHPDINK------EADAEEKFKKVNEAYSVLSDEQKRANYDRYGSAD-GPAGFHSDYVDMSDFFR-------GSGFDVDDIFSSFFGGARRSSGAAAPNRGRDMSMNFTITLEEAASGCSKKIAYERLAPCDDCNGKGAA-ADAHEVTCSHCKGTGVVTQVQQSIFGQVQSQTVCSACGGMGKVFDHPCDTCQGQGRTPSRERVSVEIPRGIHSGQTMRVAHRGEAGGAASGDLLLRIVIAEHKTFERQGDDLFCELTIDSLQAIVGCTKEVQGIDETVEVHIPSSCEYGQRISVSGKGMP--RRQTSARGSLVAVVRVVSPKGLSKADKACIKKLVDGRN............... 361
120 0.000e+00UniRef50_Q9ZDY0 Chaperone protein DnaJ n=107 Tax=cellular organisms TaxID=131567 RepID=DNAJ_RICPR  ali  30  3.....QDYYQVLGVSKTASQADIKKAYLKLAKQYHPDTNXXXXXXXXXXXXXXXXXXXX-------XQKRAAYDRFGHDAFQSQQARGGGNNGNDIFGDFFSD---------------FMGSGRRKQTSSKIRGSDLKYDLTIKLEEAFHGIEKNISFSSEVKCDTCHGTGSEKGET-ITTCDACGGVGATRIQQ----GFFTLEQTCHKCQGNGQIIKNPCKKCHGMGRYHKQRNLSINIPAGVENGTRIRHTGEGEAGGGNNGDLYVDIAIKPHDIYKVDGANLHCKLPISFVHAALGGEIEVPVIEGKVKLTIPAGTQNGDQLRLRSKGMSKVRST--IRGDMLTHIHVEVPKNLSKKQRELLEEFKKEKENDSSFFNKMKSMW.. 369
121 0.000e+00UniRef50_A0A0S8BTD4 Chaperone protein DnaJ n=4 Tax=Bacteria TaxID=2 RepID=A0A0S8BTD4_9DELT  ali  31  2...TKPDYYEVLEVSREVTTTELKRAYRKKALEYHPDRNPDN-----PEAEEKFKVCAEAYAVLSDPQKRQMYDRF-GHAGLGGAAAPGFGDIGDVFSQFQDIFGDLXXXXXX--XXXXXXXXXXXDPNAPMRGADVRTDLRLSLREAAFGTTKQIDLSHPSPCEACRGTGAEGGE--LVACTTCGGRGQVARAQ----GAFVLSTTCPTCRGRGMQAKAACAECHGAGEVQTERVVKINIPSGVDTGQSLRLSGRGQEGGGPAGDLYVTVHVDRDDVFERQGFDLVHRLSVTYPQAALGAKIEVPAFEEDQELKIPSGTQPGETLTIRGGGVPRLNG--RGRGDLLCVVEIEVPKHLTREQKRLLKDLSRTFEPS............. 364
122 0.000e+00UniRef50_Q8WW22 DnaJ homolog subfamily A member 4 n=114 Tax=Eutheria TaxID=9347 RepID=DNJA4_HUMAN  ali  27  1MVKETQ-YYDILGVKPSASPEEIKKAYRKLALKYHPDKNPDEG--------EKFKLISQAYEVLSDPKKRDVYDQGGEQAIKEGG-----------------SGSPSFSSPMDIFDMFFGGGG---RMARERRGKNVVHQLSVTLEDLYNGVTKKLALQKNVICEKCEGVGGKKGS--VEKCPLCKGRGMQIHIQQIGPGMVQQQTVCIECKGQGERIKDRCESCSGAKVIREKKIIEVHVEKGMKDGQKILFHGEGDQEPEEPGDVIIVLDQKDHSVFQRRGHDLIMKMKIQLSEALCGFKKTIKTLDNRILVITSEVIKHGDLRCVRDEGMPIYK-APLEKGILIIQFLVIFPEKLSLEKLPQLEALLPPRQKVR............ 354
123 0.000e+00UniRef50_B3S716 Uncharacterized protein n=1 Tax=Trichoplax adhaerens TaxID=10228 RepID=B3S716_TRIAD  ali  30  85.....KDYYKVLGISRNASADEIKKAYYKLAKQYHPDRNKDD-----KEAAKKFTEISEAYEILSDASKRSQYDQYGTAFAGAGGAGYSQASAEDIFKEFFS-RDGPFRGFTDFGGSQF--------------TDSTQFLLRLTFMEAVKGCRKEIEIPISANCDRCKGSGSEPG-SKIVTCTTCNGTGQQYIQT----GIFNMAATCQRCGGRGRIVTKPCRSCRGRGTVKKRERISIHVPPGVQKGQAMGIPSKSEE-------VSVVFEVSESSVFERDGYNIHSEIEISVTQAILGGTIRVDGIHGAVNIKIPRGTHSHETIKLSQRGVQKLQSTG--KGDHFVHIKIKVPRSLTPKQQALISAFAEEENERKGTVNDVNDSPES 439
124 0.000e+00UniRef50_Q93Q66 Chaperone protein DnaJ n=337 Tax=Lactobacillales TaxID=186826 RepID=DNAJ_LACLC  ali  28  6.......YYERLGVDKNASQDEIKKAYRKMSKKYHPDLNKXXXXXXXXXXXXXXXXXXX------XXQKRAAYDQYGEAGRNGGFGGGGFGGASG--FSGFGGRSGGFGGFEDIFSSFFGGGGAQVNPNAPRQGDDLQYRINLKFEEAIFGVEKQVKYNREELCHTCGGSGAKAGTH-PETCHKCGGRGQINVVRDTPLGRMQTQTTCDVCHGTGKEIKEKSTTCHGSGHEKVAHTVKVTVPAGVETGQKMRLQGQGDAGGGPYGDLYVVFQVEASDKFERDGAEIYYKMPMDFVQAALGDEVEVPTVHGNVKLKIPAGTQTGANFRLKGKGAPKLRGSGN--GDQYVIINIVTPKNMNQAQKEALQAFAKASGGQKGFFDKFK..... 379
125 0.000e+00UniRef50_H3G867 Uncharacterized protein n=3 Tax=cellular organisms TaxID=131567 RepID=H3G867_PHYRM  ali  31  1MEPSKRDFYDVLGISRDASKNDIKKKYYQLAKKYHPDTNKAD-----PNAAKKFAEATEAWEILGDDDKRQKYDAYGHAGVDEQAGYGGAGGF---------QGQGFEDIFGEFFGGQGFGGRSRHSANQPQRGGDIQVDITLSFMEAVKGATRDLNITANVECDSCDGSGAKPGTKK-KTCPTCNGSGVQIMQQ----GFFAVETPCRRCHGEGSIIESPCGKCRGKGAVKKPRTVEVKIPEGVDQGMNLRLAHQGEPGGGPSGHMYVGIHVLPDPFFKRRGTDVLVEVPISVAQAVLGGTVVVPTLTGEVEMRIPRGTQPDTVLQMRGKGIKELNSNR--RGSQMVNLQ...................................... 332
126 0.000e+00UniRef50_A0A075B398 Chaperone DnaJ domain-containing protein n=1 Tax=Rozella allomycis CSF55 TaxID=988480 RepID=A0A075B398_9FUNG  ali  29  21..KTSKDYYKVLGVSPDATERQIKKAYHSLALKYHPDRNDG-----SKEAEAKFVEISNAYEVLSDTEKRRRYDQFGDAGLNNEGDDFAFHDPFDIFAQY---------MANCYLTYRFAGGFRKNRHQQQRKGATVSMSLTVSLEDLYLGKVVEVDVSKQVVCPKCHGSGAEN-ENDIRNCPSCQGRGRHIQIIQFGNMIQQIQSDCDTCNGKGKIFKSKCSKCQGHKVVRGGTPISITIDRGMRNGNEIHFEEEADQHPDIPGDLKFVIETVPHPVFKRDGDNLYMTLTITLREALRGFKRSFKHLDGKEIVQRTEVTQPGFVQTIKNQGMPR-NAQSYEYGNLYIKYQVVLPD--TPQQ---VRKFLDE................. 374
127 0.000e+00UniRef50_A0A2B7XJF6 Chaperone DnaJ n=6 Tax=leotiomyceta TaxID=716546 RepID=A0A2B7XJF6_9EURO  ali  28  77..QAARNPYDVLGVKKDASAAEIKKAYYGLAKKYHPDTNKD------ASAKERFTEAQSAYETLSDPEKKQAYDRFGAAAFDQNG----GFDPNAAGGPFGAGAGGFHXNFEDLFGAFANAAGRGQGQSTVVVGEDIEVQTSISFMEAAKGAAKEIFITPLVKCGTCKGEGVKPGK-KRSECKSCGGTGTRTFTQ----GPFQMASTCGTCGGAGVSIPSECGTCRGDGVVRERKTVHIDIPGGVEDGMRLRVSGEGDEAGGQRGDLYVFIRVAPDHRFSRSGADVLHTAAIPLTTALLGGEVTVPTLDGDVKIKVATGTGTGDRVTLSGMGMRKLEGRRGQQGDMKVEFKVNMPKYLSANQRTILEVLADEMGDK............. 467
128 0.000e+00UniRef50_A0A287VH26 Uncharacterized protein n=6 Tax=Hordeum vulgare subsp. vulgare TaxID=112509 RepID=A0A287VH26_HORVV  ali  30  71.PVAARDYYDVLGVKKDAGQGEIKKAYYALAKKLHPDTNKGDA-----DAERKFQEVQKAYETLKDEEKRTVYDQVGRAAAGGGGPGGFEGGFGNPFEDIFSGGAGRTGGMNDFLRNIF--------KDRESGGQDVKVKLELSFMEAVEGCKKTINFQTLVTCETCNGAGV-PAGTKPETCLACRGSGYMILQT----GPFRMQSTCSQCGGSGKTVKDFCKSCRGKKVVPGIKTVSIDIAPGTDDEDVMKVSGQADPDGLRPGDLYVAIKVREDPVFRREKGDIHVDAVLNVTQAILGGTVQVPTLAGDVVLKVKPGTQPGQKVVLRGKGIKTRNSY--SYGDQYVHFNVKIPVNLTQKQRMLL....................... 422
129 0.000e+00UniRef50_L1IHL1 Uncharacterized protein (Fragment) n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1IHL1_GUITH  ali  31  1.....KDLYEVLGVPKSASSQEIKKAYFQKAKKLHPDVNKED-----PKAQEKFSELNNAYEILSDEQKRRMYDMGGMDANGNAAGGFGGFEGFQGFQNFGGDPM-------DIFEELSGMFGGRKNSRRRGAGKDVHVQIDLSFMEAAKGCSKTIRVRKKDTCKPCNGEGAEPGT-KRRTCPTCRGTGEVME---TAMGFIQVQSVCSTCNGEGSTVDTPCKRCRGSGKVEAEEEITVQIRGGLDPDVRLRMPGKGESGGQPPGHLYISVNIKSHPFFWREGADVHLEYPLSVSQAVLGCKIKVPTLEKEQEIALPAGIQPGSTRVLTGHGARHMDGNR--FGNLVVHFKVVVPKNMTEKQKEMMKQFAEEE................ 352
130 0.000e+00UniRef50_P25491 Mitochondrial protein import protein MAS5 n=233 Tax=Eukaryota TaxID=2759 RepID=MAS5_YEAST  ali  28  1MVKETK-FYDILGVPVTATDVEIKKAYRKCALKYHPDKNP------SEEAAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGAGG-------------FPGGGFGFGDDIFSQFFGAGGA-QRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGA--VKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGKVGIVPGEVIAPGMRKVIEGKGMPIPK--YGGYGNLIIKFTIKFPENHSEENLKKLEEILPPR................ 356
131 0.000e+00UniRef50_A0A2G5B4P2 DnaJ-domain-containing protein n=1 Tax=Coemansia reversa (strain ATCC 12441 / NRRL 1564) TaxID=763665 RepID=A0A2G5B4P2_COERN  ali  27  33.AASGKNYYKILGVTQDASQQEIKRHYKMLSRKHHPDKNPGDS-----EAHERFIEVAEAYEVLSNDEKREIYNRYGEEGLKSQGGGPEFHDPFDIFAQFFGGNVRFD---------------RRGGERAKPRGPDVHIHMPVTLQELYTGVEVDVDISKQAICSHCDGSGAASLD-DIEKCTVCGGSGMRVVKQILGPGIVQQQSKCDECGGKGKTINNPCPHCKGARVMREPDMLAVRVEPGMADGEEIVFEGEGDQHPDESGAVVFHLQEQQHETYERHAEDLHAEVAVTLVDALIGFNHTITHVDGKIKLQRHGVTPPGHVQRLAGKGMPRRHSGSSKHGDLLITYWVQFPVSIDDK............................ 379
132 0.000e+00UniRef50_Q99M87 DnaJ homolog subfamily A member 3, mitochondrial n=186 Tax=Vertebrata TaxID=1261581 RepID=DNJA3_MOUSE  ali  28  88.SLAKDDYYQILGVPRNASQKDIKKAYYQLAKKYHPDTNKDD-----PKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGTSGGPSVDPEELFRKIFGEFSSPFGDFQNVFD-------------QPQ-----EYIMELTFNQAAKGVNKEFTVNIMDTCERCDGKGNEPGT-KVQHCHYCGGSGMETINT----GPFVMRSTCRRCGGRGSIITNPCVVCRGAGQAKQKKRVTIPVPAGVEDGQTVRMPGKRE--------IFVTFRVQKSPVFRRDGADIHSDLFISIAQAILGGTAKAQGLYETINVTIPAGIQTDQKIRLTGKGIPRINSYG--YGDHYIHIKIRVPKRLSSRQQNLILSYAEDETDVEGTVNGV...... 441
133 0.000e+00UniRef50_B5Y7H3 Chaperone protein DnaJ n=4 Tax=Coprothermobacter TaxID=68335 RepID=B5Y7H3_COPPD  ali  29  2.....KDYYEILGVPEDASVDEIKKKYRELVKQYHPDLNKGD-----EEAAKRMAEINEAYQVLTDPKKRAEYDAMRKGGVGFSSEYYRPGQGFDFFDSIFRDFFTDFPFGSSFFN--------RTATKTKPRGTDINLEVTLSLKDVVTGCTKSLRFFRDELCEECHGTGAKDG--KTKTCERCHGTGVVENRQSTPFGVFITQTTCPTCHGAGSVPEQVCPVCHGTGVVKRQRTLDLQIPPGIENNDVITLKGQGNAKDGASGDINVTVKIIIPPPWRRKGKDLYTEVHVPYYHAILGGKIKVTTATGEEKLLLEPGTQPDQEYILANEGVPDK--SGRYRGDLHVTIKVDLPSKLSPQERKFLEEIRKLEGDNKKRF......... 362
134 0.000e+00UniRef50_Q96EY1 DnaJ homolog subfamily A member 3, mitochondrial n=211 Tax=Euteleostomi TaxID=117571 RepID=DNJA3_HUMAN  ali  29  90...AKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNKDD-----PKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDPGASGGPTVDPEELFRKIFGEFSSSFGDFQTVFD-------------QPQ-----EYFMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGT-KVQHCHYCGGSGMETINT----GPFVMRSTCRRCGGRGSIIISPCVVCRGAGQAKQKKRVMIPVPAGVEDGQTVRMPGKRE--------IFITFRVQKSPVFRRDGADIHSDLFISIAQALLGGTARAQGLYETINVTIPPGTQTDQKIRMGGKGIPRINSYG--YGDHYIHIKIRVPKRLTSRQQSLILSYAEDETDVEGTVNGV...... 441
135 0.000e+00UniRef50_A0A0L0SIT6 Chaperone DnaJ n=1 Tax=Allomyces macrogynus ATCC 38327 TaxID=578462 RepID=A0A0L0SIT6_ALLMA  ali  28  40....KRDLYEVLGVKQGASEKEIKRAYYQLAKKYHPDT------SSDPSAKDKFVEIQNAYDVLSDSTKRQQYDTMGHGAFEQGGPGGPXXXXXXXXXXXXXXXDPASMFASMFGMGGRGGPFGGPRAAPPRPGPDLETQLAISFEEAVKGTSKTINLATHVRCDPCKGSGLKEGT-KLSRCRMCNGSGQQIFSQA----GMQIAATCMACGGAGQSVPSNCKSCNGEGRVQETKTVRVDIPAGVESGMRVRVAGKGDEDPGFAGDLFVRILVRPSPIFQRMNNDIIYTAKVPLSTALLGGTLRVPTIDGDVDLKVPEGTQPGERKVLRSRGVTHVN-APSRRGDQYVDVKVELPRNLSSEQKDKLKALLSEIEESGS........... 413
136 0.000e+00UniRef50_A0A2N1W589 Chaperone protein DnaJ n=1 Tax=Candidatus Goldbacteria bacterium HGW-Goldbacteria-1 TaxID=2013807 RepID=A0A2N1W589_9BACT  ali  31  4.....KDYYKVLGLTDKASGDEIKKAFRQLAKKYHPDAHPGD-----KAAEDRFKEISEAYEVLSNPEKKAQYEQAGGYDFSNVGRGGQNGNYQGDFSSIFGDMFGRSGGFSDIFDMFFENGPQRRGQSQPQKGDDVIIRIKIPFDLSLKGGETIVKVPRDSQCTLCNGTGAAPGTSA-QQCPTCSGSGSIHFSQ----GGFMINKPCPKCDGRGTVIITPCMKCAGTGSEKEIEKIRIKIPQGVTDGIKIKISAHGDYGKGGRGDLYVIFGVEESNQFERRGDDLYYGASINLAQAVLGSEIEIPLMDGAVKVKIPAGTQPGSAQKIKGKGAKSIKTG--KTGDLIIVINVEIPSKLSDKEKKLMQELAKLKD............... 374
137 0.000e+00UniRef50_A4S1T8 Uncharacterized protein n=5 Tax=Viridiplantae TaxID=33090 RepID=A4S1T8_OSTLU  ali  28  10..STDTKLYDLLGVSKGASAAEIKKAYRKMAVKHHPDKGGD---------EQKFKEISAAYEVLSDDEKRQLYDEYGEDALKDGGMGGGGGSPFDIFEAMFGGNPFXXXX----------XXXXXXXXXXVRKGEDVVHGLKLGLDDLYNGVTKKLSLSKNVICQKCDGKGSKSGASG--TCNGCRGAGVKVVVRQIAPGMVQQMQTCNDCRGTGQTIKDKCEKCHAQKVVQEKKVLEVHIEKGMKHNQRVVFQGEADEAPDVPGDIIFVVQQKEHPVFTRKGDDLFMEKEISLVEALCGMKMTVDHLDGRQLVISTEVIKPGQFKAVFDEGMPK-HTMPFQKGRLFIHFTVKFPADLSEDDLKALEKILPARPQ.............. 369
138 0.000e+00UniRef50_A0A1G2FXY1 Chaperone protein DnaJ n=1 Tax=Candidatus Ryanbacteria bacterium RIFCSPHIGHO2_01_45_13 TaxID=1802112 RepID=A0A1G2FXY1_9BACT  ali  31  2.....KDYYKILGVDHNASKEDIKKAYRRLAHQYHPDKHTD--EKMRKEAETRFKEITEAYHILSNDQRRSQYDTFSTSGF-------HGSDAGWDFSGFGQSGFSDFSDIGEIFGDFFGFG---RAKHAPRRGRDISIDIEITFDESVFGTERRMLIRKMALCSGCGGSGAEEGF-GEKTCSRCHGSGTIRTTKQSFFASFSQLVECDLCGGIGKLPEKACKKCSGSAVIPQSEEVRIVVPPSVRSGEMIRLSGKGEAARGDYGDLYVKVHVLPHKVFRRENDDIHMQLIVPLSQAMIGGEQEIETLDGKIKIKIPHGTQTGDMLRVRGKGF---VREGDDRGDLIINVIVRMPKRVSKKLRAIAEEIHRE................. 355
139 0.000e+00UniRef50_U9T922 DnaJ homolog subfamily A member 2 n=172 Tax=Opisthokonta TaxID=33154 RepID=U9T922_RHIID  ali  28  1MVKDTK-LYDILEVPPDASDSELKKAYRKLALKYHPDKNPNT--------ADKFKEIGHAFEILSDREKRDIYDQLGEEGLANDGGM-GGMSAEDLFSS----------------FFGGNVFGGGRSRQGPRKGKNLKHVLKVSLEDLYLGKTSKLSLNKNVICSKCEGRGGKEGA--VKKCSNCNGTGVRVLLRTLGPMVQQIQQPCDTCGGEGEIIKDKCKNCSGKKIVSERKVLEVHIDKGMKNGQEITFAGEADQSPGEPGDVIIQIEEKSHDRFQRRGNDLYYTAKINLLTALAGGQFAIKHLDERLVVNIEPGIKPGQLKAIRHHGMPSQR--FHEPGTLYIQFDIEFPPSVDKQVIMSLEKILPPRPE.............. 353
140 0.000e+00UniRef50_UPI0007754D23 chaperone protein DnaJ isoform X1 n=5 Tax=Petrosaviidae TaxID=1437197 RepID=UPI0007754D23  ali  29  62.....KDYYATLNLRRDATLQEVKTAYRTLARKYHPDMNKD------PGAEEKFKEISAAYEILSDEEKRSLYDRFGEAGLTGDYGGGDGIDPYELFNAFFGGPDKLFRD------SMGAGRFHYGTKVTDNRGLDIRYDLLLSFEESIIGGKREVSIFRYETCGTCHGTGAKS-SNDITECTQCRGQGRLMKTQRTPFGIVSQISTCLNCDGKGKVITENCTSCCGSGKIQVERNIRVDIPGGIHDGSAIRITRGGDNQRRATGDLYIFVHVNKKEGIHREGLDLFSDVTIDYTDAILGTTVKVETIEGFKDLYIPPGTQPGERLKFAQLGAPDIK-NPTIRGDHNFVINVKIPKSISNQERTLVQEIAALKGKRRSLWRSIRNLFR. 470
141 0.000e+00UniRef50_Q6A662 Chaperone protein DnaJ 2 n=128 Tax=root TaxID=1 RepID=DNAJ2_CUTAK  ali  28  1MSTAEKDYYKILGVSKDAKPEEIKKAFRKIARDNHPDSHPGD-----KAAEARFKEASEANDVLSNAKKRKEYDQFGSAGGFPRGGAQTSVNVEDFLRT-----ASNGDGFGDLFGNLFGASGGRRTASRPRRGADVEGETTISFDDAVSGTTVTMDMVSQAPCQACRGTGARAGTV-PRVCSTCQGSGM---HASSAGGVFEMTEPCPDCHGRGMIVEDPCQVCHGSGRAKSTKSMQTRIPAGVEDGQRIRIKGKGSPGGGKAGDLYVKVTVRPHEIFGRDGHNLTVTVPVTFPEATLGAEVEVPTLAGTVRLRIPAGTPNGRTFRVRGRGVPRSDG---SRGDLLATVEIAVPESLDDDARHVVERLRDSLPQ.............. 371
142 0.000e+00UniRef50_A0A2E0JQY1 Chaperone protein DnaJ n=188 Tax=cellular organisms TaxID=131567 RepID=A0A2E0JQY1_9EURY  ali  28  1MSV-KRDYYEVLDIKRDASQSEIKKSFRSLARKFHPDKNPND-----PESELKFKEVQEAYAILSNPEKRK-YDTYGHNGPGGSPFGAGGXQGVNISEDLFG------GGFESVFSSIFG--SSSPRRNKRQRGSDLLVSHSIPFEALMNGCEESLEFEVLKTCNDCNGLGSKNMD-DVRECPACDGRGRIQRIERLGPFTQQVVSDCPSCKGEGRIIQNPCSNCRGQGRANQTKKVQFTVPPGIENGQRLRMSGYGESSNGDPGHLYIEIDVQEHEWFERDGADLLMALPLTFTDLVLGTTVEIPHLDGEIKIKIPPGSKPSQTISVKGRGLPS-NRARNGRGSIMVLLKLDMPEKITRTFKKKLIDIRDEMNSNEELEEKIRKEARS 379
143 0.000e+00UniRef50_A0A1Y2HEY9 Uncharacterized protein n=1 Tax=Catenaria anguillulae PL171 TaxID=765915 RepID=A0A1Y2HEY9_9FUNG  ali  30  72.SAPKRDFYETLNVPKSASEKDIKRAYYQLAKKYHPDT------SSEPNAKEKFVEIQQAYDVLSDTSKRQMYDSMGHAAFDPSMGGPGAGDPNDILNQMFGGMFXXXXXXXXXXXXXXDPFGAAARGP-----EDIETELRISFDDAVHGCQKPLRLALNVQCSPCTGSGLKPGT-KVSTCRACHGSGTQVFYQA----GFQIQSTCRVCSGTGKSVPSACNECHGAGQVQRSKTIMVDVPAGVDDGMKVRLSGKGDEASGRAGDLYVRLKVMPSAVFTRRDMDILVAAKVPLRTALLGGVVKVPTIDGEVELKVPEGTQPGEKKLLRNRGVVNVN-KPSLRGDQVVELKVEIPKNIDSDLKDKLRAILDELDGIK............ 454
144 0.000e+00UniRef50_A0A2E4HN07 Molecular chaperone DnaJ n=3 Tax=Thaumarchaeota archaeon TaxID=2026795 RepID=A0A2E4HN07_9ARCH  ali  30  2...AKRDYYEVLGVDRNTAPDEIKKSYRKLALKYHPDRNKSN------NAEEKFNEISTAYGILSNPEKRRIYDQTGHDGIDGRFTQEDIFKHTD-FNEIFQGTGFGGVDLGSLFGSLFGSGFGGSDNRASPQGQDLRHDVELSFEQAYHGEHLNIIIPRTIICDSCNGSGAYDISSSITCSSC-NGKGQVQLVQSTGFARFVRVQDCSQCQGKGKLITKPCKHCKSIGMIQKKQKIDLKIPPGTDEGTRIRLKGYGDAGNGPYGDLYIITHLKHDSRFIRDGDLLIHESEISFPTATLGGELTVPTLDGNANIKIPSGTQPETIFKLKGKGFPKLRGFG--RGDMLVKVHLSIPNKINSKTRKLIETLSEEMG............... 366
145 0.000e+00UniRef50_A0A1V5R8E8 Chaperone protein DnaJ n=7 Tax=Bacteria TaxID=2 RepID=A0A1V5R8E8_9BACT  ali  31  2....KRDHYEVLGVGRDASLDEIKKAYRRLAMQNHPDQNPGN-----KEAEERFKEAAEAYAVLSDSEKRRHYDQFGHDAPQAGGFQFDP-NQFADFEDILGRFFGGGIFGDFFGGMGGRRRPGQGERG-----SDLQYTLRLDFKESVFGVDKEVEIPRLEACGTCRGSGCADGTS-PQTCPQCRGQGQVAVRQ----GFLQMYAPCPRCEGRGMVIPSPCAACRGEGRIHRRSKVKFRIPAGIDRGQRLRLEGEGEAGGGATGDLYIVFDIAPDSTYERDGFDLHRRLDVPWPLLVVGGSHPVETLYGTEHLRLQAGTPADQVVKVPNAGIPKLRG--SGRGDLYLHLRVEVPRKLTSDQERLVKELLAAFQEDEGFLAKV...... 370
146 0.000e+00UniRef50_A0A2H6IPX2 Chaperone protein DnaJ n=3 Tax=Bacteria TaxID=2 RepID=A0A2H6IPX2_9BACT  ali  33  1MASGTDDFYERMGLKKGASEAEIKKTYRRLARKYHPDLNPGDESK-----EKKFKEINEAYEVLSDPKKRSEYDQFGKAAFEGGQGHGG-------FRSQDFGGFEGFGGQEDIFANLFGGGG---QRQGPSRGPDLSTHLDISLEEACKGVTRSISLRRDVSCKSCGGTGAES----YQTCPYCKGSGSIKQSR----GFFNLGQPCPQCRGTGKSVTKTCTACSGNGSTLTTSNIKVKIPAGTDTGSKVKLMGGAGAKGGPPGSLYIELTVRPHPIFKREGNNLFVDVPVNISEAVLGGKIKVPTIDGSVTMTLPPGTDSGKKFRLKGKGVP--NRKGGITGDEFAVIKIVVPRNVTDKTKEALKEIGKAYE............... 351
147 0.000e+00UniRef50_UPI000D1C8F4C chaperone protein dnaJ GFA2, mitochondrial-like n=2 Tax=Selaginella moellendorffii TaxID=88036 RepID=UPI000D1C8F4C  ali  30  84......DYYDALGVSKTASAADVKKAYYALAKKHHPDVNKED-----PDAEKKFQEVQQAYEVLKDDEKRNLYDQLGHEAYVQRADGGPGAGFGSVFDMFTGG--GRGANMEDIFSTVFGGK------------KNTYENVYIDFMEAVNGCARKITYRTQIRCDKCRGSGVPSGV-KPQMCKSCRGAGRVFMQK----GFFSFESSCTNCRGTGEYVKEHCNGCQGSGVVMGVKEVFIDIPAGVESGTDIKVVGEGGARGQRAADLIVRVEVKPDPVFRREGADVHVDAPVTMIQAALGGNVQVPTLGGSVMLKVRPGTQPGQKQVMRGKGMRMVQRPG--YGDQYVHFRVSIPVTMSDRQRQLLEEFAREESPNE............ 433
148 0.000e+00UniRef50_A0A2N3EQL8 Chaperone protein DnaJ n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-9 TaxID=2013654 RepID=A0A2N3EQL8_9ACTN  ali  29  2..AAGKDYYDILGVKRDASADEIKKAFRRLARKHHPDTG---------GSEEKFKELNEAYEILSDAEKRKQYDQYGQYFGGNVPPGAGGAGAGGWPGGVPGGWGGDMGDLGDIFGSVFGGGGFXXXXXXXXXXXDLTYDLTISFDDALNGSSARVEVQRAETCAVCKGSGAKEGT-GRTTCPTCKGSGHINQ----GGGMFAFSRPCPRCQGAGTVIENPCPACKGAGRVVRAKPITVNIPPGASDGGKLRFKGKGEPGGAPPGDLYVITRVRKHPYFTRDGADVLLDLPVTIAEAALGTTVTIPTPDGKKKLKIAPGTQDGKVHRLAGKGAPKL--SGKGHGDLKVRMRVVVPEKLNGKQKDLLQEFASAYDED............. 371
149 0.000e+00UniRef50_A0A1A8DCY1 DnaJ (Hsp40) homolog, subfamily A, member 3B n=37 Tax=Osteoglossocephalai TaxID=1489341 RepID=A0A1A8DCY1_9TELE  ali  28  83.VSSKQDLYEVLGVSRGASQKEIKKAYYQLAKKYHPDTNPDD-----PEAKEKFAQLAEAYEVLSDEVKRKQYDTYGAAGFDPNRAGGATIDPEELFRKIFGEFTGGMG-FGDMNNMF---------DQRP------EYLMELTFSEAAKGANKELSVNIDDVCPRCRGKASEPGT-KVSQCHYCKGTGTETINT----GPFMMRATCRRCGGKGSIISTPCALCRGSGQIKKRQWVTVPVPAGVDNGQTIRMPVGTKE-------ILITFRVQSSPVFRRNGADIHSDAFISVAQAILGGTATTQGLYETVSMAIPAGCQADQVIRLQGKGIRRLNSY--SYGDHYVHIKIKVPKKLTRRQRSLLLSYAEEETEVQGSVNGV...... 439
150 0.000e+00UniRef50_H0YT89 DnaJ heat shock protein family (Hsp40) member A1 n=167 Tax=Metazoa TaxID=33208 RepID=H0YT89_TAEGU  ali  28  2MVKETT-YYDVLGVKPNASAEELKKAYRKLALKYHPDKNPNEG--------EKFKQISQAYEVLSDPKKRELYDKGGEQAIKEGGSGGGFGSPMDIFDMFFGGGGRMQRERRGNFCSFT--------------GKNVVHQLSVSLEDMYNGAMRKLALQKNIICDKCEGRGGKKGA--VECCPNCRGTGMQIRIHQIGPGMVQQQSVCIECQGHGEHIKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGEPGDIIIVLDQKDHSVFTRRDEDLLLSMDIQLVEALCGFQKPITTLDNRIIITSHPGVEHGAIKCVLNEGMPIYRRPY-EKGRLIIEFRVIFPESLSSDKVSLLEKLLPTRQ............... 358
151 0.000e+00UniRef50_A0A2K5JF61 DnaJ heat shock protein family (Hsp40) member A3 n=138 Tax=Gnathostomata TaxID=35060 RepID=A0A2K5JF61_COLAP  ali  28  90...AKEDYYQILGVPRNASQKEIKKAYYQLAKKYHPDTNQDD-----PKAKEKFSQLAEAYEVLSDEVKRKQYDAYGSAGFDSGASGGPTVDPEELFRKIFGEFSSSFGDFQTVFD-------------QPQ-----EYIMELTFNQAAKGVNKEFTVNIMDTCERCNGKGNEPGT-KVQHCHYCGGSGMETINT----GPFVMRSTCRRCGGRGSIIITPCVVCRGAGQAKQKKRVMVPVPAGVEDGQTVRMPGKRE--------IFITFRVQKSPVFRRDGADIHSDLFISVAQALLGGTARAQGLYETINLTIPPGTQTDQKIRMGGKGIPRINSYG--YGDHYIHIKIRVPKRLTSRQQNLILSYAEDETDVEGTVNGV...... 441
152 0.000e+00UniRef50_A0A0S8FZW7 Chaperone protein DnaJ n=1 Tax=Planctomycetes bacterium SM23_32 TaxID=1704029 RepID=A0A0S8FZW7_9BACT  ali  31  2...ADRDYYEVLGVQQDASQADIKKAYRGMALRYHPDRNPGD-----PGAAERFKEAAEAYEVLGNEEARRRYDLYGKAGLQGVPLHE-FSSVDDILN-VFSDFFGGAGFFDDFF--------GRTRARQPTRGRNLRVSVEIGLRDVLTGTQRTIALTRSEICESCAGRGA--PEEGMRTCSQCRGHGEVESRQA----FFRMRTTCPRCGGRGTVITAPCGACGGSGRRQQQVQVVVSIPAGIESGTRLRVRAEGEPSDGPRGDLFCDVFVSEDAVFARNGTELLCEVPVSYPTAALGGSIEVPSVDGESCLVVPRGTQSGDVLRMRRLGLPAM--GRGGRGDMLVRVIVETPQRLTRRQEELLRELAEIEDRRKTFLAKLKSYI.. 369
153 0.000e+00UniRef50_UPI000C9D2E72 uncharacterized protein LOC111784933 n=1 Tax=Cucurbita pepo subsp. pepo TaxID=3664 RepID=UPI000C9D2E72  ali  31  83......DHYSTLNVSRNATLQEIKVSYKKLARKYHPDVNKN------PGSEEKFKEISAAYEVLSDDEKRSLYDQFGEAGLQGEYSGSPGVDPFEIFDAFFGGSDGLYGERDGI------GGINLNKRSGRNQNLDIHYDLHLSFEESVFGGEKEIQLFCFEACENCDGTGAKT-SNCIKVCASCHGKGGVVQTQRTPFGMMSQVSTCSECGGDGKVITELCQSCGGSGQMKSFRKMDIVIPPGVSDGATMRIQREGDKKRRMAGNLYVTLRVDEKHGIRRDGIHLYSNISIDYTEAILGTIVKVETVEGLKDLRIPAGVQPGDKVSLSRMGVPNIN-KPSVRGDHLFIVNVQIPTSI............................... 426
154 0.000e+00UniRef50_A0A2N5SYE4 Uncharacterized protein n=12 Tax=Basidiomycota TaxID=5204 RepID=A0A2N5SYE4_9BASI  ali  31  78...APKDPYSVLGVKKDAASSEIKKSYYALAKKYHPDINK------EAGAKERYQSIQEAYETLSDEKKRAAYDQFG------PMSQQPGFDPNNPFGDMFGG-GDPGDVFSSLFGAFGGRSGARGQSQQVFVGDDLEATITIPFEEMAKGTSRSIDTTPIVNCPPCNGEGIKQG-AKPQTCRACNGTGTMTFVVQSG---FTMASTCQSCGGSGKKVDDKCGSCGGIGKVRDRKQVNVKIPAGVEDGMRIKLAGQGNAKGGRPGDLYVKVNVAPSKTFRRQGSNLYTEVKIPFHAALLGGAVRVPTLEKEVEVQVPRGTQPGEELVLKGRGVKHL--YKEWLGDLIVKFNVTIPRSLTEDQRIALEAYAALEGKSTN........... 453
155 0.000e+00UniRef50_S6BFB9 DnaJ C terminal region domain containing protein n=13 Tax=Alveolata TaxID=33630 RepID=S6BFB9_BABBO  ali  31  82.....KDPYSVLGVSRNATNDEIKRKFRELAKKYHPDLNP------SPDAKQKMAEISSAYELLSDPKKRQVYDQTGMNA------GDGGYDPTAGFSG-FGDSSFMFTDFAEMFSRMAGGHGNNNPFTGTSRGDDIQTEITISFMEAVKGCSKNINIPARVACGDCKGLGRQPGTN-IEVCKVCNGTG----VQRMERGPIIIGVPCRSCSGTGQVIAHPCRACGGSGDRAQTKSVNINIPAGVRQGMQMRVPNQGHVGGGKSGHLFVNINIQPHQIFKWIDDDIHVHIPISLKQCLLGGNVVVPTLDGHTELTLTPNSQPFFIKTLINKGPPKIDSRNN--GNLIVHLELKLPDQLTPKQRELVEEFDKES................ 431
156 0.000e+00UniRef50_A0A1Q9N0V3 Chaperone protein DnaJ n=1 Tax=Candidatus Lokiarchaeota archaeon CR_4 TaxID=1849166 RepID=A0A1Q9N0V3_9ARCH  ali  32  1MPDKKRDYYETLGVAKDANDDDIKRAFRTLAKKYHPDLHPDD-----KTAEEKFKELQEAYSVVSDPEKRQRYDQLGFAGVEGTVDSGNGFNFSDLF-----------GGIGDIFGSFFGGGRNRGQQPRQQVGEDVEKEVHVTLEDTVFGTKREVKFKRAIPCSHCNGIGAEPG-SDVKKCPQCKGQGQVRQGRQTVFGTQVYITTCPQCRGEGKTFDKPCTACKGRKIEFEERTVNINIEPGIEHGTILKAPGAGHAPGAMPGDLLVGILVEPHSIFGREGNDLYCMLEIDFVTTIFGGEVDCPVIRGIKKLRIPPGTQFATELRVRDEGVPYLRS--SQKGDMYVKLKILLPKDLTKDQTVLLKRFQDLYHGKK............ 367
157 0.000e+00UniRef50_F9VKP5 Chaperone protein DnaJ n=5 Tax=Candidatus Arthromitus TaxID=49082 RepID=F9VKP5_ARTSS  ali  31  2...SNKNYYEVLGVSSNASESEIKSAFKKQAIKYHPDRNKGNA-----EAEKKFKEINEAYQVLSDSSKRASYDRVGHDAYTKGASYGSSSAGGGF------EGFDMDFDLGDIFSSFFTGGGFGGGRSKPKPGEDLEYRLTLTFDEAVFGCTKDIFIRRKDRCGTCSGTGSKTGT-DRTTCDKCHGSGQIKVQRNTPFGSMVSMTTCSKCSGVGKINLNPCATCRGSGKVNTEKKITIDIPRGIDTGQVISMRGEGEVGGAPSGDLYIAINVMSSNKFKRKDNDIFTDHHIPIWIAILGGDSVIETLDGEHKINIKEGTQSGTVHVLKGKGVYKVNSNF--RGEHHVRIVVDVPSVHNDSQRQAVELMREAYEGSQ............ 365
158 0.000e+00UniRef50_M5BIE7 Casein kinase 2, alpha polypeptide n=2 Tax=Rhizoctonia solani TaxID=456999 RepID=M5BIE7_THACB  ali  26  353.SAAQKDPYQVLGVKKDATAADIKKAYFALARKYHPDTNK------ETSAKDKFIDIQSAYEILGDSEKRTAYDQYGSASQQQGFDPNAFAGARGPFGGGGFGGFSQADIFETLFGSAFGGVRGNRRTQESVRGSDIETSVGIEFLEACHGTSRTINVTPVVDCKPCSGSGLKPG-AKRSTCGSCRGTGTRTFVIQSG---FQMASTCTECGGTGTTVPNQCGDCGGLGKVRIRKTVKVDVPAGIEDGMSVRVSGAGDAGTGSPGDLLVRINVAPSKTFRRQGVNIHHDARIPLHTALLGGKVRVPTLDGEVEVRVPGGTQQGQECVLKGRGVPAL--YGSEKGDLFVSFAIQIPRTLTQRQREILQQYADDVEGRSS........... 737
159 0.000e+00UniRef50_A0A2V2ETF1 Molecular chaperone DnaJ n=2 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2V2ETF1_9FIRM  ali  31  2...ADKNYYEILGVDRKATEADIKSAYRKLVKMYHPDLHPNDA-----NAAAKFKEVNEANEVLSDPQKRAAYD---YELDHPGMRGGAGGFSGFGGAGGFSGFGGFSDIFNDIFSGFGGGG---AQQTAAAQGEDITKEVVLSFLDAAKGCTKEVRYYRNEPCPTCKGTGAKNGTA-YKTCDKCGGSGQVRYTQDTLFGRTIRMATCDACGGTGKKITDMCPDCKGKGYVRKETVVTLNIPAGADTNSYIRKKGFGQASGGVPGDLIVIFRVEPHKIFKRKDKDLYIELPISYKTAVLGGKIRVPGIDDTFEYLIPEGTQSGTVFCVRGKGLKT----RVGTGNMYITVQVEVPTKLTRDQKKALEEL.................... 353
160 0.000e+00UniRef50_A0A2H5ZHR1 Chaperone protein DnaJ n=7 Tax=Bacteria TaxID=2 RepID=A0A2H5ZHR1_9BACT  ali  28  3....EKDLYAILGVPRNASQEEIKRAYRKLARRYHPDVNPGN-----KEAEEKFKEISEAHEILSDPEKRKLYDEFGMAGLQAGFDAERARAYEQWQQQGFGGGFGRFESFEDIFSDLFG----ERARPGPRPGADLETEVEIDLLDAVRGRTMEISLQRPEICGTCLGSGEDIASS--TTCGECLGSGRIQVAR----GPVRFSRTCPRCGGAGRISTRACPKCAGSGQTVQVERLQVRIPPGVDEGSRVRLQGKGGAHGGPAGDLYLRVHVRPHPLLERRGDDLYMNVPITVGEAISGASITVPNPGGSLRVQVPPGSQSGKLLRIRGRGVPHLHGGGA--GDLYLRLMIHVPTQDTQAVREAARTLDEQTRPHPR........... 368
161 0.000e+00UniRef50_J9YYI2 Chaperone protein DnaJ n=4 Tax=unclassified Pelagibacteraceae TaxID=1655516 RepID=J9YYI2_9PROT  ali  29  4......DFYDTLGVSRDASDADIKSAYRKLAMKYHPDRNQGDAT-----AEQKFKDVSQAYEILKDPKKRQTYDQFGHAAFEQGGGGAG------------GFGQQGFGGFSDIFEDIFGAFGEGG--QRESRGDDLRYDVTIDLEEAFHGKTLDVTIPKMVNCPE---------QHSYKSCSTCDGYGKVRTQS----GFFSMERTCGRCGGTGQEMKGRCSKCSNTGRVKQNKKLQIKIPAGVETGNRIRMSGEGEAGGGSYGDLYVFININNHKLFQRERDNIICDVAIPFTTAALGGKIEVPTIEKKVNVSIPKGMQSGHKLRIKEKGMSILRTQR--RGDMIVRVHAETPVNLSAEQEKLLNQFNDSLTKKEGFFDKVKKMF.. 358
162 0.000e+00UniRef50_A0A1F5NX54 Chaperone protein DnaJ n=1 Tax=Candidatus Delongbacteria bacterium GWF2_40_14 TaxID=1817817 RepID=A0A1F5NX54_9BACT  ali  32  2...SKRDYYEILGVGKNATKDDIKKAYKKLALQFHPDRNQGN-----KESEEKFKEVGEAYSVLSDDNKRAKYDRFGHEGLRGSGQGGGGFDFGGG-SFDFGDAESIFEQFFGGSFGGSSRGRRSGAGNAHRRGNDLQISIKLTLEEISKETTKKIKINKFIKCTSCSGSGAKSISSVSKCSSC-GGTGEIRTVQRSILGQFVNVSPCHACDGMGEVILEKCPLCGGDGRIRDEKTVNVTIPPGVSEGQYLTLSGEGNAGGGQPGDLIVIIQEKEHKYFNRDRENLYYDLQLSVSEAALGTEIEVPIIEGKVKLKVPSGTQPGKKLMLKDKGLPVLNGYG--KGDLIIRISIWIPTKLSKKAKELFEQLEKPKSSEKGFFEKIKD.... 381
163 0.000e+00UniRef50_A0A2M6WKK0 Chaperone protein DnaJ n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2M6WKK0_9BACT  ali  29  3.....KDYYEVLGVDKKASSETIKKAYRKLAHKYHPDKADGD--------EARFKELNEAYQVLSDSNKRAQYDQFGSSFSQGAGFNPGGFNIN----------MDDLGDFSDIFEQFFSGG---RARRTYNRGNDLQIAQEITLEEAYTGVKREIEFHALTRCEGCSGLGYFD-KDGTKDCVKCDGKGEVKEVKKGFFGSFAQVRVCSDCNGRGKIPNKPCKDCHGSGRINSNRKIKVDIVPGINDGQLIKVTGAGEAGGAVAGDLYVQVRIKRHELFVRKEDDLYTKKKISLIDVLLGKDIIIKTIDKETSIEIEPGSHLNEMILVKAKGMPRLHGSGQ--GDLYIKLDVTTPKKLSKKAKQLIEELKKEYES.............. 351
164 0.000e+00UniRef50_A0A1Y1WBM0 DnaJ-domain-containing protein n=1 Tax=Linderina pennispora TaxID=61395 RepID=A0A1Y1WBM0_9FUNG  ali  26  36.....KDYYKILGVSRDASQSEIKRQYKTLSRKHHPDKNPGD-----EAAHERFIELAQAYEVLSDSEKREIYNRYGEEGLKNQGAGGGFHDPFDIFAQFFGGHVKFD--------------RRGGGGRAKPRGPDVHIHVPVTLLELYAGAEIDVDISKQAICPHCDGSGAASPD-DIDTCSTCGGSGVRIIKQMLGPGIVQQQTTCDECHGKGRKVTKECPHCKGTRVTRASDQLTIRVEPGMADGELVAFEEEADQHPDEPGSVVFHLQQEPHKVYERRGDDLYAEETITLADALVGFDRTLLHVDNKSKVEIKAVTPPGYVQRLAGKGMPRRGAGASKFGDLFVTYWIQFPKELDAASKDEVRRLFGHESKAK............ 392
165 0.000e+00UniRef50_A0A1V5ULT8 Chaperone protein DnaJ n=2 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1V5ULT8_9BACT  ali  31  4.....KDFYSILGVSQDASKEDIKKAYKNLAKKYHPDANSGN-----KSAEDKFKEVTEAYEVLSDDEKRSKYDRFGDGNFDFSGAGGAGANFEDILSSIFGGGRGGAGDFGDIFGSFFDRGGASGFRARPSRGEDIEVKLELTLKQAVGGGNLKLKVNRRDICGYCSGEGG----SGNAACQSCRGTGSISRSQ----GGYAISQPCPRCSGRGKIKTNTCANCSGHGFVSDIKQIKVNIPEGVADGQLIRIPGEGHAGNSPRGNILITVSIKPDDQFSRSGDDLYYELVLKFTEAALGAVKMVPTIRGSAKVNIPAGTKSGSKLKLKGQGVKNHKTG--ATGDQIITVKIDVPSVLSEEAKKLLKELEK.................. 371
166 0.000e+00UniRef50_A0A2A5DHC6 Chaperone protein DnaJ n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A2A5DHC6_9BACT  ali  28  1MNAAQKNYYDLLGVNKEASNDDIRKAYRGLAKKYHPDKTGGD-----EKAEDYLKEINAAYDVLKNTDKRKEYDT------QQAYGGGAGFGG--------YDFSGGGGGFEDMFSAFGGGRQQAARHNAPRRGRNLETNVTIGLLDVLDGTTKTIQLYRKETCDDCKGSGAAPGTSPV-TCPDCHGTGQVSRN----NGLFNTNQACGRCRGAGSTIATPCGACSGSGLVKEQRTISVSIPKGIQDATRLRVAGEGEAGGGPHGDLFVAVSVMAHPLFRRNGADIVCDVPITFATAALGGTVEVPTLDRKAKLTVPASTQNGTQLRMKGMGLPT--GAGSKRGDELIQIVVEIPQKLNKEQKVLLSEMYGIDPDXHPLLDKFKNLLKS 367
167 0.000e+00UniRef50_A0A1W9LN00 Chaperone protein DnaJ n=8 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1W9LN00_9BACT  ali  31  2....TKDYYQILGIKKDASKEDIKKAYRKLAHEYHPDKKGGN--------EAKFKEINEAYQILSDEQKKQQYDRFGRAWGKPGGGRERDFDFEDI------SDFGGMNDLSSIMEEMFGFGGQRGGERGKKDGKDIRIDIEIPLKEVMQEQKKNIILEKMSSCSRCQGKGAEPGT-PIKECFSCRGVGYVQQIRKTFLGSFTQRVVCPECKGEGNRPEKSCNVCMGEGRIKGNETITFSIPAGVDANQVIKMEGKGDAGGGRPGNLYIRISVGSHPVFQRKADDLISGFPISFSQAVLGGEIKITTIDEKKIIKIPSGTQSGKILRVSGEGIPHF--SGRGRGDLYIQLTINTPQKITKAQKDLLEKLKEE................. 381
168 0.000e+00UniRef50_A0A258W3W4 Chaperone protein DnaJ n=2 Tax=Bdellovibrio TaxID=958 RepID=A0A258W3W4_9PROT  ali  29  2..SSQQDYYQTLGVAREADADTIKKAYRKLAMQFHPDRNPGD-----KAAEDKFKEAAEAYDVLSNSEKRAQYDRFGHAAFKQGGRGFQGGSADDIFSSF-----------GDIFGDLFGGGGSSRSRTEPRKGADLRYLCEISLKDIITGLEKEIEFETEENCKDCNGSGAEKG-SQVETCSMCGGQGQVVTRQ----GFFSMQTACPQCRGEGQMIKKPCRTCKGAGRMEKSKKIQVTIPAGVDTGTRLRISGEGEGGYRGPGDLYVEIRVKDNDKYERHGSDLHTILKVPYVQLLLGGQVDVSTLTSEEKLEIPKASQPGSQVKLAGHGFPSLRSQR--RGDMFFHLEAEYPKKISAEEEKLLKEIAKETDPKSGFFGKKK..... 372
169 0.000e+00UniRef50_A0A143X9G1 Chaperone protein DnaJ n=36 Tax=Coriobacteriia TaxID=84998 RepID=A0A143X9G1_9ACTN  ali  28  3.....RDLYEVLGVSREATEDEIKKAFRRRARELHPDVNK------APDAEEQFKELNEAYDVLSDATKRAQYDRFGTVPGAAGGAGPYGGGYVD-----FEDLFGGGFGMGDIFSSFFGGAAGGRAPQR-REGRDMGVGLRLTLEEVAAGAKKEIVYDRLAPCPDCDGSGLGP-DGREVTCPDCHGQGRVVTVQRTFLGDMQTATTCKACGGTGRTIENPCPECEGQGRVPDRQRVTVEVPVGIRDAQQLRLSGFGEAGGARPGDLIVTVRIQPHEFFERDGDNLHARANVSIVQATLGAEIEIDGIGEKVQVRIPEGCQNEQVVRVRNFGMPKFRS--ESRGDMFVHVNVVVPKKVTKKQRELLERLAQEMGEDRTPLQKLRDAF.. 377
170 0.000e+00UniRef50_R7K4C7 Chaperone protein DnaJ n=2 Tax=Bacteria TaxID=2 RepID=R7K4C7_9FIRM  ali  36  2...AKKDYYAILGVSKTASQDEIKSAYRKMAKQYHPDLHPDD-----KQCAEKFKECNEAYEILGDPERRRKYDS-GEMDFENFNFGGPGR----------GFSTAGFEDIFDIFSSFMGGGSRSGAQRQTPRGSDVTCSVNVSFLEAALGASKEIKLNRLERCPDCNGTGAKD-SSSVKECDECHGTGRVQYVRDSFFGRQVTVGTCRKCGGAGKIVTERCKKCSGAGVVSKKKILTIHIPAGTENGAIMSINGYGNASGGVNGNLLVIINVEQSKLFKRDDCNLYVDVPIPFSVAVNGGDVEIPTLSGSVTHRLEEGTANGETLRIRGKGIK----NGRRTGDLFVRLLVEVPSNVDKTNKKQLAEF.................... 351
171 0.000e+00UniRef50_A0A0A8GV09 Chaperone protein DnaJ n=35 Tax=root TaxID=1 RepID=A0A0A8GV09_9PROT  ali  33  5.......YYEILEISKTSDKETIKKAYRKMALKYHPDRNQGN-----KEAEDRFKLVNEAYEVLSNDEKRSIYDRYGKEGLKGQASGFGGFNDFDL-----------GDIFSSFFEEGFGFGKTSRQKKESKYPRDLKISIKITFKEAVFGCKKKVDFTYKTFCKTCNGSGSENG--KESTCEHCGGKGQVGIRQ----GFMTFVQTCEYCSGSGNVIKDKCKICQGKGYEEIKDSIELDIPEGIDNGMSLRAQNKANELPNKRGDLYIKIIVEEDEKFIRHEDDIYTIVPVFFTQAALGKTIKVSTIRGEADLKLPVGAKDKEKFELVNQGVKNLHSGKL--GSHIVQIDIKFPKTLNDEQKNLLQQLEKSFGEQESLFDKIKSWF.. 370
172 0.000e+00UniRef50_D5U3V3 Chaperone protein DnaJ n=12 Tax=Brachyspira TaxID=29521 RepID=D5U3V3_BRAM5  ali  31  2..AEKRDYYEVLGVAKTATNDEIKKAYRKLAMQYHPDRNPGXXXXXXXXXXXK---------------KRAQYDQFGFQGVHSDFADAYGRGGFD-FSQMFGGS-GGFGDLDDIFSSFFGGGFSGRSSRSQRRGNDLRHDITLSLEDAVFGKKMEIKLDKNDICDVCHGTGAEPGT-KTQTCPTCGGSGEVRMAQ----GFFSVRRTCSKCNGSGSIVTTPCKKCRGTGTVKKNKTISVNIPKGIEDNTQLRVSGEGEAGGGVAGDLYLYIHVAPHQYFVRDGIDLITEVGINIVQAALGADIYIQTLDKKVKIKIPAGTNSGQVFKLKGSGAAHIN--RSGRGDLFVIVNIDVSSKLSSEEKRLFNELKKVMPNN............. 363
173 0.000e+00UniRef50_A0A1W9PIT5 Chaperone protein DnaJ n=1 Tax=Thermotoga sp. 4484_232 TaxID=1968524 RepID=A0A1W9PIT5_9THEM  ali  32  2..SPRKDYYEILGVPRNASQEEIKKAYRKLVKQWHPDLHPEN----KEEAERRFKEIQEAYEVLSDPEKRAMYDRFGYVGEPPPSHQYTPHETKSIFEDIFRDFEEFFD--RDIFDIFFGERTRERTRRARRG-EDVEIHVNVDFRTVVSGGEVIVEYERYERCDHCGGSGVEPG-SGYMNCPRCHGTGVLREERRTVFGFFVSERPCDYCGGTGKVPKERCKVCKGSGRVLRRVRRAVKIPPGVEEGSRIRIPGGGNAGVEGYGDLYVIVHTKMDSRFKRSGNDLYYTVTIDYVQAILGTMVEIPLPEGSTMLKIPPGTQPDTIFRLKGKGISDP--SRGKKGDLYVTIKVELPKSISREEKRLLEEIARIKN............... 366
174 0.000e+00UniRef50_A0A0C7CCJ9 Putative Proprotein convertase PC7 n=1 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0C7CCJ9_9FUNG  ali  32  13.SSAKRDPYEVLGVKKNATASEIKKAYYALAKKYHPDTNKD------KDAREKFVQIQEAYEILSDDEKRKQYDQFGHGFDGGGSGFPGGFDPNDIFSQXXXXXXXXXXXXXDPFG-------------RPSAGDDIQIPLTLSFMEAVKGATKYVQVNRVTDCQSCRGSGVRPGKSK-ETCKVCHGAGVQTI---MMGGGFGMQTTCQACGGEGSSIPPGCPACNSMGKVRERKTVQVTIPPGVDQNSRIRVSGEGDAGKGPSGDLFVTLNIQPSKIFRRQDSDVFVDAKIPFYKAMLGGRVRIPTIDGDVELKIPSGSQPGDNIALRGRGIQRFRGT--TRGDQIVTLKVELPRSLRGRQKEIIEEYASLVDEE............. 378
175 0.000e+00UniRef50_A0A2C9CKF5 Chaperone protein DnaJ n=17 Tax=Planctomycetes TaxID=203682 RepID=A0A2C9CKF5_KUEST  ali  30  3...EKKDYYDLLGIAKNASKEDVKSAYRRLAKKFHPDLNKDNP----KSSEEKFKEISEAYEVLIDDNKRAKYDSYGYAGVESDFGKEGFSDLEDIFGH-------------DIFSDFFGARSGYGKPERKIR----RVQVEISLEQAYRGVSTEVAIPHMEKCGDCNGSGAEKGTS-LKICNRCDGRGEVKQEQLQEFGRIIKIGVCPVCNGRGKIIEKFCQSCHGTGEIQRLDKIKIKIPPGVDNGTTLRIA------PDKSGNIYVYISIQPHPFFRRQANDVYIKKEISLIDATLGSKVEVPTLDGNAIMKIPQGTQTNTLFRLRNSGMPYLRGHG--HGDQYVRVIVKTPKNITKRQRELL....................... 349
176 0.000e+00UniRef50_A0A1Y4DG98 Chaperone protein DnaJ n=11 Tax=Bacteria TaxID=2 RepID=A0A1Y4DG98_9DELT  ali  29  3...SKRDYYEVLGVPRNATQEELKKAYRKLTFQYHPDRNPGXXXXXXXX------------------NKRARYDQFGFDGVDQ---GQGFASTSDIFSQ--------------FGDLFGDFFGFGGSGTAAMQGADLRYELTITFEQAARGDEAKLVLPRHETCGTCHGSGAAPGT-KVETCPRCKGTGHIHRSQ----GFFSLATPCPYCHGTGQHIPRPCPTCHGEGLVKKTKELYVRVPAGVDSGTRLRVHGEGEPGGGPPGDLYVIVRVEPSKVYERQGQDLIYTTEISFTQAALGCRIEVPGLNGELPLEIPKGIQSGTILRIANEGLPYI--GRSQKGSLLVDVKVITPTKLTERQIELLREFEELSQKPDSLFD........ 353
177 0.000e+00UniRef50_A0A146HND9 Uncharacterized protein n=2 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146HND9_9AGAR  ali  27  212.PRAQKNPYDVLGVAQDASAAQIKKAYFALARKHHPDT------STDKGAQEKFVEIQAAYDILKDEEKRKAYDQFGEPGFDPNAFSGFAGGNFSGFQNF--GGSFGRGDAADLFSQLFQGGGNTRSGFQTSRGSDLEASVRISFLEACKGTSRKINITPVVDCAPCSGNGLKPG-AKRSTCTTCKGSGTRTFVIDSG---FQMASTCNTCGGSGSTVPSECSHCGGVGKVRSKSTVQVEIMPGVEDGVTLRIPRRGDAGKGKPGDLLVRIHVTASKDFTRQGTNLYHKTRIPMHTALLGGKVRVPTLDGDVDVRLPGGTQQDEEMVLKGRGVPSPHGGGV--GDLFVSFSVQLPRSLTARQRELIQQYADDVEGRQS........... 584
178 0.000e+00UniRef50_A0A1R2CSF3 Uncharacterized protein n=3 Tax=Stentor coeruleus TaxID=5963 RepID=A0A1R2CSF3_9CILI  ali  30  18....KKDYYSILGISRSASEAEIKKAYFSLAKKYHPDVNK------SSDAKEKFAEINLAYETLGEAEKRKTYDSTGMTGDEQDQAKNSGFDPGSSNFNPFTNFTGSGFNFKDAFNEFDSFFTGHEDQEKMNKGEDISIVLEISFIDAVKGIQKKIQFERKSLCSTCNGTKIKPGTSPIK-CSSCGGKGNIEIQM----GSILMQSICNKCKGKGSILKTPCTSCRGVGMGNKECEEVVNIPPGVSNGQSLRMANKGHSGRGIQGDLLVKIVIAQHPIFRREGQDIHSDVFISIPQAALGTSLDVETIHGKTKINVEPGINPGDQKRISGSGIQHLPPNQSRRGDHVITFKLKVPKKLTDEQRKLYEQLAREEGSNTQTPNKFKTFYK. 396
179 0.000e+00UniRef50_T1JTA4 Uncharacterized protein n=2 Tax=Tetranychus urticae TaxID=32264 RepID=T1JTA4_TETUR  ali  29  1MVKET-GYYDILGVKPTATSDELKKAYRKLALKYHPDKNPNEG--------ERFKAISQAYEVLSDPDKRRLYDDYGEKGIKE--GGHSGSSPMDLFEMFFGM------------------GGSRQRHAGPRKGKDVVYQLGVSLEQLYNGSTKKLAISKKVACDKCEGRGSSDPKKGYVTCEKCHGSGRQVRVQQMGPNIVQQVQTCGSCNGAGEFPKDRCKTCDGARIIKQKKIIEVHIDKGMSDGQKITFSGEGDFEPGQSGDLIVVIDEQEHPMFKRSNADLIMAMEITLTEALCGMQKGIKTLDDRTLVISSEVIKHGAIKCIMNEGMPHWK-NPYEKGRLIIQFTVKFPDNLDPVIIPQLENLLPPRP............... 355
180 0.000e+00UniRef50_A0A1V5SQ81 Chaperone protein DnaJ n=6 Tax=Bacteria TaxID=2 RepID=A0A1V5SQ81_9BACT  ali  36  3....KRDYYEVLGVSRNASDEELKKAYRKLALQHHPDRNPGN-----KEAEEKFKEAAEAYAILSDAEKRSRYDQFGHS------LGGHGFSGFEGFQDAFGGFND---IFGDLFEDFFXXXXXXXXXXXXXX-XDLEYPVELTLEEVLTGKTIDLEVPRRETCSECQGSGAEKG-SKKRTCADCGGRGEVRISQ----GFFTMRQTCPGCGGEGESIEKPCHACRGEGRVKKVRKLQVKIPCGIENGSRLRVTGEGEAGQGGAGDLYVHVLVKKHDSFERRGQDLYAEAVIPYTVAVLGGKAEVPTLEGLTELKIGSGTPSGKIMKIREKGLPAV-GMQARRGDLYVRVQIEVPVKMSR............................. 339
181 0.000e+00UniRef50_A0A1Q7RF32 Chaperone protein DnaJ n=7 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7RF32_9BACT  ali  27  3......NYYDVLGVDRKARLADVKKSYRKLARKYHPDLNPGD-----KRSEERFKQISEAYDVLSDPEKRKKHDQYGEGFAAGAEGRPFGSGPAADMGFDFGDLGGSASNFASFFSEILGRRDGDQEDTAPRRGEDVTHALNVGFFDALRGLTTELTIDAETACPRCNGSGTVPSRAR-RPCPDCAGTGRISHVS----GALRFATTCRRCGGQGSLGSEGCGNCRGTGVLRRRETIKVHIPAGVDNGSRVRVGGKGRAGGGPNGDLYIVTNVGPHPFFRRIGDNIHCTVPITVSEAALGSRIDVPTIDGSASVKIPPGTASGQKFRLRGKGAPLLRG--SGRGDQYVEVQIVTPRANDEKSRQLLRELGALTPGEE............ 368
182 0.000e+00UniRef50_R9YIB8 Chaperone protein DnaJ n=1 Tax=Candidatus Tremblaya phenacola PAVE TaxID=1266371 RepID=R9YIB8_9PROT  ali  33  3....KRDYYEVLGVGRDASAEDIKRAYRKLAMKYHPDRNQ------ESKAEEQFKEVREAYETLSDVQRRNTYDQFGF----QSVGRGSGVN-----ESADQDVGSFSESFGNIFEDIFGQSTRSSKNQRARRGSSIHQKVELTLEEADSGKEVDVVISHSVSCQNCKGSGIKRGT-KAKTCNACGGYGAVQMSQ----GFFRVRQTCSACNGTGTVTPHNCSNCRGTGRTKTKESVLVKIPEGVEEGSKIRIQGYGNVGSSERGDLIIEVTLKPHPIFERRGCNLHCNVPIRFGIAALGGSLSVPTLTSNVVFEIPEGTQSHRTFRLRGRGAKDTRLGG--FGDLHVQVLVEVPSQLTENQKSLLLRLLKHRPLEKGWIEKLRAF... 372
183 0.000e+00UniRef50_E1RID4 Chaperone protein DnaJ n=18 Tax=root TaxID=1 RepID=E1RID4_METP4  ali  28  4.....KNYYDVLNVPKDANEQEIKKAYRTLTKKYHPDVCK------EEGAEEKFKEINEAYSVLSDSQKRAQYDHMGHETFTNASKGQYTGG-----GFGGAGFNADFGGFGDIFDAFFGGGGQRRGPRGPQPGADLLMRVQVTLKDAVLGTSKDIDVMHTEACEECEGTG--SSTKKTRVCPRCGGSGQERRENRTPFGSFVSMTTCSQCRGRGKIPEQTCSKCGGSGHKKVKRTITVNIPAGIESGMRLRMEGYGEAGGASNGDLFIEVDVLADSKFKRLGDNLETSVSVSAAGAAVGTKVDITTIDDRVELKVPAGIQHGTALKIPGEGVRRRGRP----GDLLVRVNISIPKDLGDEEKELYKRLLEIESEKKGFFQ........ 371
184 0.000e+00UniRef50_A0A2W4IBU0 Molecular chaperone DnaJ n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A2W4IBU0_9BACT  ali  32  2..TSKKDYYETLGVPKTASAEEIKKSFRNKARHLHPD-NKDSGD------EQAFKELAEAYEVLSDQQKRATYDRYGHEGVKGAGQGFDNFD----FSNFSGFGMDDIVDMLDSFFXX-XXXXXXXXXXXPEQGAHLKFDMEIEFLDAVFGTEKTINVRRLEDCESCSGSGAAPGSNPV-PCVTCAGVGQVQQVINTFFGQALRVIACPACQGSGSKIDKPCKDCKGEALVRKQKEFQIKIPAGIDSGTRLRVQAGGDKGGGPFGDLFVVLHIKEHETFVRDGETIHIRQPISYSLAALGGEILVPTVEGAKPLKINAGTQTGTTVQMKNLGVPRFTGQQRRRGDQIVHLLVETPTKLSGEEKKLLEKLAELRGER............. 367
185 0.000e+00UniRef50_A0A0F8VHI1 Chaperone protein DnaJ n=5 Tax=root TaxID=1 RepID=A0A0F8VHI1_9ARCH  ali  34  1MSSKKRDYYEVLGVSKDASLKEIKVAYRRLARKHHPDLNKTN-----PKAKEMFIELQEAYEVLSDEGKRRNYDRYGHGGVQSDFFSGGIPGIDELFKGIFGDFSPFGGLNG------FGSRSRRRSAPRREVGQDIEDLIEITFEEAMFGVKKDLVIERYTPCDMCEGTGAEDPSS-IKSCPECEGSGRVRKMSQSGFGMIIRESSCYTCNGTGQVIAKKCTVCNGKKVIPEEKTIHVPIPPGIEDSVHLKIQGAGHSTNAIPGDLYLGVRIIDNEKFLRRGNDLYTPTNVDIVTAIIGGKITVPTLDTEKELSLPPGTQPGTEFRIKNRGVSYMRRKG--KGDQYIIVNIEIPKKISDKQKDLLLKFREMNK............... 371
186 0.000e+00UniRef50_P63967 Chaperone protein DnaJ 2 n=584 Tax=Terrabacteria group TaxID=1783272 RepID=DNAJ2_MYCBO  ali  30  1MA---RDYYGLLGVSKNASDADIKRAYRKLARELHPDVNPD------EAAQAKFKEISVAYEVLSDPDKRRIVD-LGGDPLESAAAGGNGFGGFGGLGDVFEXXXXXXXXXX---------XXSRGPIGRVRPGSDSLLRMRLDLEECATGVTKQVTVDTAVLCDRCQGKGT-NGDSVPIPCDTCGGRGEVQTVQRSLLGQMLTSRPCPTCRGVGVVIPDPCQQCMGDGRIRARREISVKIPAGVGDGMRVRLAAQGEPGGGPAGDLYVEVHEQAHDVFVREGDHLHCTVSVPMVDAALGVTVTVDALDGLSEITIPPGTQPGSVITLRGRGMPHLRSN--TRGDLHVHVEVVVPTRLDHQDIELLRELKGRRDREGGLFSRLRETF.. 379
187 0.000e+00UniRef50_F8C204 Chaperone protein DnaJ n=14 Tax=Thermodesulfobacteriaceae TaxID=188711 RepID=F8C204_THEGP  ali  31  4.....KDYYAILGVPRDATQEEIKRAYRRLALKYHPDRNPGN-----KEAEEKFKEISEAYEVLSDPEKRAIYDAYGYSGLRSTGYRG------------FEDISDIFKAFSDIFEEFFDFSFEEKVHTRPRDGADLSYEIALDLEDLFQDKKVKLEIEKFEVCDFCKGLGYDP-EKGVKTCEVCKGTGRVTYTE----GFFRISYTCPDCKGKGKAYIARCEKCKGSGKVWKKKELEVVIPAGIEDGSILRIPKEGEPGGGKPGDLFLRVKVKPHRYFYREKNDIIGQLKINFISAILGDKIKIPYFGEELEIQIPPGIQPGEEIIIEGKGLPDIKTG--KKGNLILKIQIEIPKKISKEGEKLLRKFAELEGIKNS........... 354
188 0.000e+00UniRef50_T1J3S1 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1J3S1_STRMM  ali  26 1389MVKDTT-YYDILNVKPGCTPDELKKAYRKLALKYHPDKNPNEG--------EKFKQISQAYEVLSNPEKRRVYDEGGENAIKEG----------------FSSSGGGFTSPMDIFDMFFGGG---SHRRRERKGKDVVHQLSVSLEELYNGTLRKLALQKNVICDKCEGRGGKKGAS--EKCPNCRGTGMQVRIQQLAPGMVQQQSMCPECLGQGERIKDRCKHCSGRKVVRERKILEVHVDKGMQDGQKITFNGEGDQEPGEPGDIIIVLDEKEHPVFRRSGRDLIYRLELDLTEALCGFQRTIKTLDDRELLITCEVIKHGDVRAILSEGMPQYKNPF-EKGKLIVQFLVRFPPAIPVEQIHQLEALLPPRP............... 1740
189 0.000e+00UniRef50_D1JCH5 Probable chaperone protein dnaJ n=1 Tax=uncultured archaeon TaxID=115547 RepID=D1JCH5_9ARCH  ali  28  3....KKDYYEILGVSRDATDKAIKKAYRKLAKQYHPDTYQGD----KKEAEDKFKAISEAYEVLIDTDKRAKYDQIGSDAFGPEGFDWSHFDVEDIFGSAIFDSFFGFDGSGGIFDTLYGGGEGI---ERAARGADVRLRLDITLEEAARGIAKRIEVPMSRPCKACGGSGTRSGKA--TACPQCRGTGQIRNVQSRGGTRVITAAVCPQCKGTGRATYDLCEACGGAGTVSTRTKIELKIKKGVSTGYEIKIPRAGRPPGGEPGNLYVVLNVLPHPIFKRQGDDLYMKTPISFAQAALGDDVMITTLDGKVKLKIPTETQTNTKLRLRALGMPKLD--AVAHGDLYVEVVVQTPRNLTDKQKEQLQQ..................... 374
190 0.000e+00UniRef50_A0A095XA24 Chaperone protein DnaJ n=2 Tax=Actinomycetaceae TaxID=2049 RepID=A0A095XA24_9ACTO  ali  30  3......DYYEVLGVSREATESEIKKAYRKLARTLHPDV-------AGPEGEERFKMVSEAYEVLSNTEKRRMYDLGGTDALRGGQA---------------GGFGAGFSGFEDIFSNLFGAGASARGPSRARRGGDALVQADLSLSDVVFGTEKEISVDLNLECGVCHGSMTAPGTEPV-TCSDCGGSGSVQRVTNSLFGQMVSSSACSSCHGYGTRIVTPCAECSGEGRVRSVQKMKIQIPGGVEEGMRLRLPGKGDAGGGARGDLFVQIHVLPDAVFAREGDDLLAVMEVPMTVAVLGTESEIRTLDGMKKIKIAPGTQSGTVQVLRGLGVRKMN--RSARGDLRIQINVLTPTGLDSAQKKLVRELAHKRGESESVFAKLRDKF.. 371
191 0.000e+00UniRef50_A0A1N5RW83 Chaperone protein DnaJ n=208 Tax=root TaxID=1 RepID=A0A1N5RW83_9MYCO  ali  26  1MSS----HYETLGVSRDASPEEIKKAYRKKARTLHPDVNP------SPEAAEEFKRVSHAHDVLSDPEKRRIYDATGNE------------NGTAXXXXXXXXXXXXXXXXSDIFETFFNGQSSRGPASRARQGQDALITVRIDLREAVFGAEKEVMVDTAVTCPECSGKGTQDGTE-PETCEVCHGRGQVQRQVQSILGNVVTTAECPHCHGFGTVIKHPCQECYGEGRVRQRRPLTVKIPAGVSTGTRIRLSGEAGTGGGPNGDLYVEIRVSPDEVFTREGDDLHASITVPMTAAALGTSVTLETFDGPREVTVEPGTQNGQTVTLRGLGATRLRG--SGRGDVIAHLQVTTPTRLNDEQRELLRKLAQLRGEDQGFFSRLRDRFQ. 378
192 0.000e+00UniRef50_A0A1H9W618 Chaperone protein DnaJ n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A1H9W618_9CORY  ali  28  1MA---RDYYGILGVDKNASDQDIKKAYRKLARKYHPDVN------DTAEAEERFREISIAQEVLLDPQKRRIVDMGGDPMEQSQGAPXX-------------XXXXXXXXXXDIFEAFFGGGGQRGPRSRVQPGSDALLRTTITLEEAFKGVKKEVTVDTAVVCNNCTGTGSES-KAKPVTCDNCQGSGSVQEVQRSFLGNVMTTMDCPKCAGFGEIIPDPCTKCDGQGRVRERRDLIVNVPAGIADGMRIRMADQGEHGGGPAGDLYVEITTQRHPVFVREGDNLHMNLRVPMLDAALGTAVKCTDLAGEFEVHIDAGTQPGAQILLEGEGMPHLRAAG--RGNLVAHVQVTIPTDLDDKGRAALEDLRETEDEDSGFFSRLRDRFK. 378
193 0.000e+00UniRef50_A0A1W9SSM2 Chaperone protein DnaJ n=27 Tax=root TaxID=1 RepID=A0A1W9SSM2_9GAMM  ali  30  2...AKKDYYQILGIPKSAEEREIKKAYKKLAMKYHPDRNQGD-----KTAEGKFKEIKEAYEILINEEKRSAYDQYGHAAFENGQSNSTY------------STFTNSADFSDIFGDVFGDIFGGNRTQRAKKGADLCYNMEITLEEAVKGIKKEIQIPTLQKCKTCYGSGTRTGT-KPRSCSTCHGKGQIHIRK----GFFTVQQSCPTCHG--------------------------------NTNDRIRLNNEGEAGGAQSGDLYVQITVKKHPIFEREGNNLYCEVPINFTMAALGGEIEVPTLDGRVKLKIPYETQSGKLFRIRGRGVKSVQN--RNQGDLLCRVVVETPVNLNEQQKNLLHELEKNSPRSKRFFDGVKRFF.. 340
194 0.000e+00UniRef50_A0A1F8YI04 Chaperone protein DnaJ n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F8YI04_9DELT  ali  30  2...AKKDYYDILGVNKTAVEDEIKKAYRKLAKKYHPDVNPGN-----KNAETRFKEISEAYEVLSDTQKRAQYDRMGSFPFKPGFEGGGGFNIGD-----FGFDIGNIGGIEDIFGDVFG--KKGSQWPDVNSGRDIEYRVELSFEEAVKGTEVRVTADKEIVCSACGGSGAKPGAEK-RQCTVCHGKGQKEVTK----GGFTIRQTCTACAGTGTTIAEQCYVCHGQGRDILREGITVRIPPGIDDGSKVRIAGSPGIGGGKPGDLYIITSVRSHPYFLRKGNDIYIDLPVTIVEASLGAKIKIPTVDGTTLLTIPPGTSAGQKLRLKGKGIENKKSK--TRGDQYVIIQIITPRDLSQKAQDLLKEFQKTHPYDPR........... 367
195 0.000e+00UniRef50_J3LLI0 Uncharacterized protein n=12 Tax=Poaceae TaxID=4479 RepID=J3LLI0_ORYBR  ali  31  60...SGKDYYATLNLRREATLQEVKTAYRTLARKYHPDMNK------SPGAEEKFKEISAAYEILSDEEKRSLYDRFGEAGLSGDYGGGDGIDPYELFNTFFGGSDKCFGD------SMGPGRFHYATKVMDNRALDIRYDLLLSFEESIIGGKRGVNIFRYETCGTCDGSGAKS-SNDITECTQCRGQGRLMKTQRTPFGIVSQISSCLNCDGSGKVITEKCTSCCGSGKVQVERNIRVDIPGGIHDGSAIRFTGGGDNQRRTSGDLYIFVHVNKKEGIHREGLDLFSDVTIDYTDAILGTTVKVETIEGFKDLYVPPGTQPGERLKFPQLGAPDIK-KPTIRGDHNFVINVKIPKTISNHERALVRELAALKG............... 422
196 0.000e+00UniRef50_A7SJW2 Predicted protein (Fragment) n=1 Tax=Nematostella vectensis TaxID=45351 RepID=A7SJW2_NEMVE  ali  31  12....RKDYYKILGVPPNANQKEIKKAYFELAKKYHPDTNKD------KSASEKFQEVSEAYEVLSDDGKRKAYDSFGFSGAQGGPFGGAGFDAEDILKSFFGGQSGPFGGGFRAGGMDFEDIQQAQ-----------QYMMNLSFMEAVKGCNKDITINTRVTCDRCDGKKAEPGTTHSK-CTTCNGTGQETVNT----GFFYMKSTCRKCAGQGYIISTPCRKCRGKGRVNESRKITVPVPAGVDNGQTVRI-------PVSFGEVYVTFRVSESKIFERDGINIYSSASISFTQAILGGKIRIPGIQGDMDLKIPPGTQSHQQMRLTGRGVPRIDGLG--KGDHYVSFKVHIPKYLNEKQKALILAFAELEDDVSGTVDGVSK.... 364
197 0.000e+00UniRef50_A0A098E7B2 Chaperone protein DnaJ n=1 Tax=groundwater metagenome TaxID=717931 RepID=A0A098E7B2_9ZZZZ  ali  30  3....EKDYYKILGANKNTTKDDLKQAYRKLAMQYHPDRSPPDKKKEYEEKFKE---ISEAYAVLSNDNKKAQYDRVGSAGMGNASQEDIFRNAFSDFQDVFSGYGEGFGNVDEIFKGVFRGGKGRQRSGYETTGEDLEYTLSINLKESAFGTEKEIRFFHNAKCKVCNGTGSKDGS--RTVCDKCHGRGVVQIHRRAGFITFTSAQTCPKCHGTGVVIQSPCRTCHGTGNVKEEAKVNVRVPGGVNTGDNLKMTGYGNYGADGSGDLYIKINVTDDNLFKRKGDDIYCNVKIPFTLAILGGKIDVPTLQGTASLNISEGTQPGTTLRMKDMGI--HNEMRNHTGDQFVVAEIEIPEGLNEKQKKLLIEFDEEMKKSKNRFK........ 376
198 0.000e+00UniRef50_A0A0L0HUA8 Chaperone DnaJ n=7 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A0L0HUA8_SPIPN  ali  30  28......DYYGVLGVDRSATKRQIKKAYKELSKKYHPDKNPGD-----KDAEAKFVELAQAYEVLADDEKRRIYDQYGEEGLKG-GGHQQFHNPFDI---------------FAQFAGFGGGFGFGHQHAQQRKGPEVAMNLEVTLEELFLGTTIEVEINKQIICPTCRGLGAKR-AEDVVKCTACNGAGIRIVRQMLGPGMYQQQTTCDACGGRGKLVKSKCPACEGNKVKRGSHQLTVTIERGMYDGQRIVMDREADESPDTPGDLIFTLSTLPHPTFTRKGDNLYVKEVITLKEALLGFEKKLKHLDGNEITIRREGTQPGFVQTIKGQGMPT-HEFPSERGFLYVEYGVVLPEKLTEAQISQISKLFDS................. 373
199 0.000e+00UniRef50_A0A2N2EV26 Chaperone protein DnaJ n=4 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A2N2EV26_9BACT  ali  30  2..TDKRDYYDILGVARDAATADIKLAYRKLALKHHPDRVG---ESEKKSAEEKFKKISEAYAVLSDPQKRQQYDRFGHEGIDSR------YSTEDIFRGAFGDFADILRSAFGSGAAGFGSFGGGRGRGGAQAGQDIETRMVITLEEAFTGTEKEITYSRAKKCDACGGSGAKPGT-KASTCPLCRGRGVVTE----GSFIFSMQRPCPECGGRGQIIKQKCPSCAGHGLVKKKENLKVKVPKGVLSGTSLRVKEKGYESPGIAGNLYVLIEVLPHKDFERREGELYTKIEIPFPVAVLGGTIKAQAINKTVQMKIPPHCPDGQVFRLRGYGMPRLNAAYS--GDLFVTVVIHVPKKVPSKAKKLLEDYMTIMEEEQKPF--YKNLFE. 371
200 0.000e+00UniRef50_A0A257RYU8 Chaperone protein DnaJ n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A257RYU8_9ACTN  ali  28  1MAVASANLYEVLEVDASASQEELKKAYRRLARQLHPDANPGD-----PSAEARFKEVSQAYEILSDPDRRANYDRFGQDGAGAQGNPFGAGSVQDIFD-----------------MFFGGMGGHGGGRRGPQPGPDAEVSLEITLEEAAFGATREMTITLPLRCETCEGSGAAPGTAPV-NCLECAGTGEVRRVRNSILGQMVTSSVCTRCNGLGTRVESPCADCRGEGRRNQSTTLSIHVPAGVEDGSTMRLRGPAGPRGGANGRLFVHLSVIADERFERHGDDLHHQAHVTFTQAALGTTINVPTLQGSYELEIDAGSQNGTVHRVRHEGVEHLHG--RGRGDLYVHLVVDVPSELDEASEALLRQLAALRGE.............. 354
201 0.000e+00UniRef50_A0A139AQT1 Uncharacterized protein n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139AQT1_GONPR  ali  29  36..APKRDAYEILGVQRNAAASDIKKAYYALAKQYHPDTNKD------EGAHEKFVEIQEAYEILSDEQKRAAYDQFGHSAFSGPGGDPSXXXXXXXXXXXXXXXXXXXXFTSDLFEQLFRGFGMGGAAGGRGGGEDINAALRIGFMDAIKGVQRPLTFQSIIKCSTCSGSGLKTGQ-KLKACEGCGGTGRKVFVR----GGFQMVSECPTCQGAGTIIPKRCTSCEGHGRVRDKRTVMVSIPAGIDDGMKVRLAGQGDQGNGSPGDLYVSITVSPHPTFRREGNDIHLDVPLPFTTAILGGSIRIPTVDGDVELKVEPGTQPEARKRLTKRGAPIVRSAMGDRGDQWVTLKVQVPKRLTSRQQELLKEWIAEDE............... 411
202 0.000e+00UniRef50_B7IFE0 Chaperone protein DnaJ n=28 Tax=Thermotogae TaxID=200918 RepID=DNAJ_THEAB  ali  32  2...AKKDYYEILGVSRNASQEEIRQAYKQLIKKWHPDRN----HQNRKEAEEKFKEIQEAYEVLSDPEKRAMYDRFGYVGDVPPNAXXXXXXXXXXXXXXXXDIFKDFGDFNDIFNIFFGDQRSRQKQRRAKRGEDINITVDVPFEQVFTGTTIPIEYDRYEVCSHCNGEGVEPG-SGWVSCPKCHGTGVVREERRTFLGVIVNQYTCNQCGGTGKIPGETCHVCGGSGRIRKRHRVEVKIPAGVDNGTVIRVQGNAGYNGGGYGDLYVNVRITGHIDFERRGNDLIKEIKIDYVEAILGTKVKIKMPDGRVKVKIPSGVQDGENIYVYGEGVPDMRTGR--RGDLILKIKVDIPKRVSRSEKKLLKEIAKLRGKD............. 374
203 0.000e+00UniRef50_A0A1Q9NQU0 Chaperone protein DnaJ n=1 Tax=Candidatus Heimdallarchaeota archaeon LC_3 TaxID=1841598 RepID=A0A1Q9NQU0_9ARCH  ali  32  1MSQ-KRDYYEILGVSKNSSNSELKKAYRKLAMNFHPDKKGIDKKEAEEKFKE----ISEAYGVLSDSEKRSVYDRFGHEGLQGRGMGGDFGGFEDILSDLFGGIFGGSSR-----------RRSSSTRRGPQRGSDIQMILEISLVEAYNGAEKEIVPPMPAICPTCNGSKAKPGT-KPETCRTCRGQGQVQQTQRSFFGVVNTITTCPTCRGEGQAISKKCPECKGEGRIPQKRKIKINIPPGIDDGNQIRIPREGRHGGGDSGDLFLVLRVEEHPVFKRDGADLHRTLLIPFHTAVLGGKINIPYLDGSIIFTIPKNIKPDEKIKVERKGMPVRKGGRL--GDLYIYVNIGAPEKVNKEQKEYLQKFEQLFGE.............. 364
204 0.000e+00UniRef50_A0A2D6P316 Molecular chaperone DnaJ n=2 Tax=archaeon TaxID=1906665 RepID=A0A2D6P316_9ARCH  ali  32  2...TKNDYYEILGVNKDSSKEEIKKAYKKLAKKYHPDLNK------EEEASEKFKEISEAYAVLSDDDKKQTYDNYGHDGFDQRYSQEDIFRGAD-FDSIFQDIFRGQGGFGGIFDNIFGGG------RQRTKGNDLSFNLEISFKEAALGVKKKIKLPKKVKCEDCEGTGAKNG--KLTTCNVCKGNGQVRRVTRIAFGAFTQVSTCYNCKGYGKMAKEKCGSCK-DGLIEKVKEITINIPEGVDDGNTLRVENEGEEVRGEAGDLYVVINVDEDDVFERKGSDLFLDYYISFPQAVFGTTLSVPTLKDKIKVKVPSGTQSGTVFRVKDSGVKNLNGYGS--GDLYVKTNVKTPTKLSSKQSKLLKDFSTDRKEKVEFFDKIKDIF.. 375
205 0.000e+00UniRef50_UPI000D1C9F7B uncharacterized protein LOC9640501 isoform X1 n=4 Tax=Selaginella moellendorffii TaxID=88036 RepID=UPI000D1C9F7B  ali  33  79MAV---DYYETLGVPRTATILEVKHAYRKLAKKYHPDKAPGN--------EEKFKAISAAYEVLSDPEKKEYYDKYGDADFQNGVPP---TNPFDIFRSVFGEMAGM--------------------RPENFQGADLGYELHLEFTEGIFGAEKKIEVSHLETCNSCDGSGAYLG--KVKPCKGCRGRGQTFETQQASYGTFSRVSVCTDCEGRGEVILDYCRTCGGEGVVLTKKTIDVKVPAGVKNGNTLRVPHEGHAGPRPPGDLYISLKVKDYPGIKREGNNLVSTISVSYVDAILGTLVEVNTLGGKAVIRIPPGTQPGDTVVLPNQGVPRL-GSPRTRGSHIFTIQVKIPRSLSSEEIQLVERLAHLQRLKSDW--KTKNTF.. 428
206 0.000e+00UniRef50_W2V038 Chaperone protein DnaJ n=1 Tax=Candidatus Xenolissoclinum pacificiensis L6 TaxID=1401685 RepID=W2V038_9RICK  ali  27  3.....EDYYQILGVSKDADASAIKKAYYRLAREHHPDKGGKPED---------FHKIKQAYDVLSNPERKANYDRFGTDDVGGATGGSSDGN------------FGGGAEFTDIFREFFKTNFGRTKESASARGSDLRYDMRITYNHAYKGVTMPISYTTQVMCTPCNGTGGKNGARQV-NCGVCHGSGYSRTQQ----GFFTIERTCGTCSGTGKVIKDVCHQCAGQGRYKKQVNLDVKIPAGVDDGSKVRVAGKGEAGGGDTGDLYIFITLEPHELFTREGSDLYCTVPVSMVTAALSGEIEIPTLTSNLKIQIPRGTQNGDTIKVKGKGMKKLN--YNAYGNLIVKIAVETPVDLNSNQERLLQEFADASPKSTKFLKKVKNFWK. 366
207 0.000e+00UniRef50_F4NXT4 Uncharacterized protein n=2 Tax=Batrachochytrium dendrobatidis TaxID=109871 RepID=F4NXT4_BATDJ  ali  29  78.SMAKRNPYDVIGVSKTSTANEIKKAYYQLAKQYHPDTNKD------PSAKEKFVEIQHAYEILSDEQKRAQFDQYGNVDDSSRQGEHGFSGGFPGGFPYGFSGFGGEDFGGDIFDQIFQKFGGQSNARGASTGESVLAGTRLSFMEAIKGAKKSIVFVGIRGCAPCSGSGTKPGHKK-TTCITCKGSGQMSLHR----GGFQMFTNCPTCGGLGTSIEAKCTSCNGAGLVRERQSVTVDIPAGVEDGMKVRISGQGNAGQGPNGDLIVTVQVAGHPIFKRDGADVHIQATVPLHIAILGGSIRIPTVDGDVDLTIPPGTQPNERKVLRQRGAPNVSSGSSSRGDQWVTLEVEIPKSLTSEQKRLMME..................... 444
208 0.000e+00UniRef50_A0A1F7D753 Chaperone protein DnaJ n=13 Tax=Candidatus Peregrinibacteria TaxID=1619053 RepID=A0A1F7D753_9BACT  ali  28  3.....KDLYAILGLKRGATKEEIKRAYRTLSKELHPDRNKD-----SKESERRFKEVNEAYEVLSDEKKRAMYDQ--FGTTGGPGGAGGAGSGPFGGFDFSGFNTGDLGGLGDLFETFFGGGGARRGRREQRG-RDLQIEIEVALTDVVEGIDRSLQLERQRPCKKCGGSGAEEGTKQV-TCKECGGTGEITRTTQSFFGTFRQAAQCEACGGTGKTHEHPCKNCGGDGRVRSHEPVTIHIPAGMQDGQTLRVRGEGEAGGGAIGDLFVTVRIRPDAKFEREGDAIRSTVTIPVTDSLLGTEVPVHTVQGSVTLRVPAGTQPGQVFRLKGKGMPVLNS--SRFGDHYVTVNVEIPTKLSKAEQKLVEEWKKMRG............... 362
209 0.000e+00UniRef50_F2NBX3 Chaperone protein DnaJ n=2 Tax=Desulfobacca acetoxidans TaxID=60893 RepID=F2NBX3_DESAR  ali  28  3....ERDAYEILGVARDASDAEIKKAYRKLARKYHPDVNPDN-----KEAEKKFKEISAAYDILANPEKRTQYDQMGAAAYYATPEAARGY-----------EEAFTGRDFSDIFRD---FFGGGAAYGGPTPGEDLAYALEIDFLEAVRGTHKTITLEKQIICPGCKGSGYEYAG---QVCPACGGRGVVEKKVD----NVRMLINCAACQGTGRTGQQSCRRCGGRGVVLGSETVEVKIPPGVDQGTKLRLAGKGNPGGGPAGDLFLIISVRPHPQFTRQGRDIYYKTTLSLFDAVLGGKITVPTLDKTVSLTIPPGTQNGQRFRLKGKGV---GTGGARTGDQYVEVHVTIPKQLSPKAKELFQSLKDSL................ 344
210 0.000e+00UniRef50_A0A1G2BFY5 Chaperone protein DnaJ n=6 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1G2BFY5_9BACT  ali  33  3.....KDYYNILGVAKDASPEEIKKAFRKLAHQHHPDKEGGD--------EAKFKELNEAYQVLSDTKKRQAYDQFGEAGVNGQGGFSGGGNWEDMMRQSGNSGGPGEFDLGDILGDFFGNGRRRGSRQ-KQGGQDIQMDMEIDFIEAVFGIKKTVELYKTEKCGHCHGNGAEPGT-PIKECKTCQGKGTVSQVRQTMIGNIRTQAVCPGCQGEGKIAEKKCAQCQGGGVEKKQVQIEVSIPAGIDSGQTIRLEGKGEAGGSASGNLYLNIYVRKSAEFERQEDNVLSTIKVPYEIFVLGGKVTVKTLDGEAEMKVPSGTESGKLMRLRNKGIPHLQ--ASGRGDHLVKLEVDIPKHPGRKYKKLLKELSE.................. 365
211 0.000e+00UniRef50_A0A197K9C8 Uncharacterized protein n=1 Tax=Mortierella elongata AG-77 TaxID=1314771 RepID=A0A197K9C8_9FUNG  ali  27  81.SASQQDPYTLLGVKKTASQAEIKKAYYQLAKQYHPDTNKD------PAAREKFVQIQEAYEILSDEQKKAQYDEFGHAGFNGNSPHGAXXXXXXX-XXXXXXXAGGFGNFEDVFDFFGGGFGGSRSSGFSSVGEDLEVPLVIDFMEAVKGASKKVLVDPIRTCQPCHGHGTKNGKA-PETCKVCHGTGQQKISLQ----GFHMAAPCQACGGVGTMLQKECHTCGGVGRVRVHESVDVHIPPGADEGVRIRLGGKGNQGEGKAGDLFVRLRVKPSPFFKRQGADVYTETVIPFTTAALGGSVKIPTVDGDVELKIPSGTQPNDVSRLAKRGIQRLN--RSDKGDQFVTLKVALPKTLSKAQREILEKYAEITNP.............. 448
212 0.000e+00UniRef50_A0A0G1D2H6 Chaperone protein DnaJ n=1 Tax=Parcubacteria group bacterium GW2011_GWC1_43_12 TaxID=1618909 RepID=A0A0G1D2H6_9BACT  ali  28  3.....KDYYKILGLAKSASPDEIKRAYRKLAQEFHPDKGGDP---------EKFKEINEAYQVLSNPDKRSQYDKFGVNFEQAKAGGGDFSSFADAF-DFFGGSQNRDFGFEDIFENIFTAGSNGSFG----RGQDIGADMEISLEEAYRGVEREISIYRNGVCRECDGSGAKFG-SKMKDCVQCRGTGKIEHKGGGGFFNFSQIRICPACRGKGKKAEKECEACRGEGRVKEHKKLKIKIPPGIRDGQTISLVGQGEAGGEQTGDFYINIHVNPDSRFIREGDNLLSELPISFSQAALGDKVEIPTMDGWLKLKIPEGIESGTMIRLEEKGMPRLH--RRGFGDMMIKVKVKTPKRLSKKAKYLLENLKKE................. 365
213 0.000e+00UniRef50_A0A2A9NLK4 Uncharacterized protein (Fragment) n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NLK4_9AGAR  ali  25  4.SAAPKDPYQVLGVKQDASQAEIKKTYFSLARKYHPDTNPD------KKAQEKFLEIQEAYDILKDEKKRADYDKYGAASQQQGFDPNAFSSAPGFQGFGASFGATGRGDPSDLFEQLFNFGGGRARGSDSMRGADLETTVNLSFLEACKGATRRVNISPIANCGTCSGSGLKKG-AKRSTCSACGGSGHRTFVIDNG---FQMASTCNACGGVGSTVPRQCSSCDGVGRVQVKKTVTVTIPSGVEDGMTVRVPNAGDSGKGQTGDLLVRVNVAPSKLFVRQGSNLYHKAQIPLHTALLGGRVRIPTLDGEVDVRLPGGTQQGEEMVLKGRGVPALHG---STGDLFVTFMVLLPRSLSKRQRELLQAYAD.................. 380
214 0.000e+00UniRef50_E0NIU0 Chaperone protein DnaJ n=25 Tax=Firmicutes TaxID=1239 RepID=E0NIU0_9FIRM  ali  30  8.....RDFYEILEVKRESTQTEIKSQYRKLAKKYHPDLNPGD-----EEAAEHFKEVNIAYEVLSDEKKRQMYDAYGEDGINGNAGS---------YGGGFGDIFGDIFDMFGQGFGGFGGYSEAEYRNRPIKGDDVRVDIIIDFKESIFGAKKDINVKRTETCKTCNGEGTAPGTHK-HTCDKCNGTGKIRTTTSSPFGRFTQVSACDKCKGTGEIIDTPCPDCKGHGTRVVNKKITIDIPKGIDDKMILTLREEGDAGGGPAGDLYVYVRVKEDQIFKRMGNDLYMELPITYTDAVLGGSIKVPTLTKLVDYDIPAGTKSGATFRIRGEGVPYLR--KDGKGDLVFKVDIHVPKKISDLEELRKKEGKEIKKERETFLDKVKKFFE. 380
215 0.000e+00UniRef50_A0A1C7MQP8 DnaJ 1, mitochondrial n=2 Tax=Agaricomycetes TaxID=155619 RepID=A0A1C7MQP8_GRIFR  ali  27  247..SSPKDPYQVLGIKKDATPAEIKKVYFSLARKYHPDTNPD------KNAQDKFVEIQEAYDILKDEKKRADYDKYGAASQQQGFDANAFENAXXDFSSVFGSGRGGGGNFEQLFGAFSGRGRTGAGFTESMHGGDLEASLGVSFMEACKGTSHTINITPVVNCGTCSGTGLKAG-AKRSTCTSCGGSGTQTFVIDNG---FHMASTCSKCHGSGTTVPSQCGECAGAGQVRVRKSVKVDVPAGVEDGMTIKVRGAGDAGKGRPGDLLVRIHVASSKVFRRQGPNIHHDARIPLHTALLGGRVRVPTLDGEVDVRIPGGTQQGEEMVLKGRGVASM--FHGSKGDLFVTFNVQLPRSLTKRQREILQQYAD.................. 625
216 0.000e+00UniRef50_A0A1Z8NC16 Chaperone protein DnaJ n=1 Tax=Planctomycetaceae bacterium TMED10 TaxID=1986833 RepID=A0A1Z8NC16_9PLAN  ali  30  2..TEKRCYYEVLSVTQTASTDEISVAYRKMAIQYHPDKNPEDETAIG-----RFKEAAEAFEVLSDADKRSRYDRYGHAGLE--GSGQQFHDLSDIFEAFGDMFGGGIFG-------------GGSRGRRTRRGADIECDLSIDLFAAARGIKKQVSFSRHQRCEDCDGNGAAGGTA-LESCPYCGGHGQVIQSS----GILRMQTTCPSCHGAGSTIREKCDNCRGDGYQEEAVTCDVAVPGGIDDQMQIRLTGQGHPSGGPPGDLYCLVHVEEHPLFTRQGNHLICKVPITYSQAVLGGTVEIPTLDGPESIEIKSGIRAGSVIKLSRRGMPDPRGRRA--GDLHIQIDIDVPKKLSDEQEQAIRKLAELEPHRKSFLDTLKGYF.. 366
217 0.000e+00UniRef50_A0A0E9ME69 Chaperone protein DnaJ n=7 Tax=Bacteria TaxID=2 RepID=A0A0E9ME69_9PROT  ali  30  2...........LGVPKNADGKAIKDAFRKLALQYHPDRNK------EPGAEERFKEIAEAYAVLSDPKKRSEYDARGFEGV-AGFSREDLFGGID-FEDLFGGLNFDFGPGGGLFNHFF-----HRRQAGPVHGSNIEVELTIPLERVVSGGEEKVRLPYQTACSACHGSGAAAGT-QPRVCSACNGTGQQTTRRRKSNVLIQQISVCPACLGRGSVIDKPCPSCGGTGKTTHEEVLSVTIPVGVEEGMALRIPGRGMPSGGQSGDLFVVVRSAPDPRFERDGADLWRSETITVADAVLGTKLKVPTLDRSAEVTIPPGTQHDTVLRVRGKGLPEF--GGRKHGDLFLRIRVHIPEHLSAEERELYQKLRDLAGEPHR........... 359
218 0.000e+00UniRef50_A0A2D9WKC9 Chaperone protein DnaJ n=5 Tax=unclassified Chloroflexi TaxID=167963 RepID=A0A2D9WKC9_9CHLR  ali  32  1MAAAP-DLYETLGVGREASSSDIKKAYRLLAKEFHPDVNK------SEGAEERFKEVSTAYEVLSDPEKRGRYDQFGHAGIGNAGAQX--------------XXXXXXXXXXXIFDSFF--RSTGARRAGPQQGSDLRTTIEINLEDVLLGIEYPLNFSRVVRCQPCRGTGEADAAERPK-CDECSGTGELRQVQRSLFGQFVNVTVCNICQGEGTKVRNACKSCRGRGLTESDVERSISIPAGIDNGETLRIRGEGDQGGAEAGSLYAEIRIKEHSKFLRYGRDLVTECELNIVEAMLGTELEVNTLDGSIKLAIEPGTQSGDRRVLRGEGVPDVRG--RGRGDLYLQIRVMTPTRLSTEQESIIREFGKSLTEEESMFDRIKSAF.. 370
219 0.000e+00UniRef50_A0A1F9V3X3 Chaperone protein DnaJ n=20 Tax=Bacteria TaxID=2 RepID=A0A1F9V3X3_9BACT  ali  31  1MASN--DYYRLLGVARNAGDDEIKSAYRKMALKYHPDRNPGND-----EAEANFKEINEAYEVLSNSDKRKIYDQFGAEGLKNGGGGRGGFGGF--------PGADMGDVFGDLFENLFAQGGGQRGQPRSRRGADLKYEAQITLEEAFNGVKIPVSFDRTELCAECDGTGAR-GKTGVKKCPTCRGAGRVQYSQ----GFFAFSQACPECGGQGEVITSPCKACGGQGRSKKGVSINVKIPAGVEEGAVLRVGGDAGAKGGASGDLYIEVRLKHHSHFERNKRDLVYECPVAVWQAALGGEVDVPLIEGRTKIKIPSGTQHGKTFRVSEKGMP--GPGGRPRGDLMVKVKLEIPHDLTPRQRELFSELAEVPEEEKGFFKKI...... 369
220 0.000e+00UniRef50_A0A2G9Y4K0 Chaperone protein DnaJ n=1 Tax=bacterium (Candidatus Stahlbacteria) CG23_combo_of_CG06-09_8_20_14_all_34_7 TaxID=2014295 RepID=A0  ali  32  1MSS--KDYYKVLEIEKNASPDEIKKAYRVLAKKYHPDLNRDNKKESEKKFKE----ISEAYEVLIDPKKKSIYDQYGYEGISQQFGQDGFFSHFEDISDIFGNIFGGGFSHDSIFESFFGGRKSSRNRQKNNRGSDIKIVMKLTLEEMYSGTEKTIKYHRFEKCYSCNGLGGAK--NDLKRCPDCNGTGQRKYKTQSMFGTMIQVAVCPTCQGEGTIIEKKCKDCYGEGRIKKEHTLKVSVPAGVFDNAYMRMESEGNYGGGESGDIIIVFQQIPNQKFIRENDNLSTEIRISYPEAVLGSEHEITSIDGKTILRIPEGTQSGKIFVLKGKGMAELHS--SRHGDLFVRVVVDIPKRVDHKIRAILKELDK.................. 372
221 0.000e+00UniRef50_A0A1Y2GN61 Uncharacterized protein n=1 Tax=Lobosporangium transversale TaxID=64571 RepID=A0A1Y2GN61_9FUNG  ali  27  81.SASQQDPYALLGVKKNATQAEIKKAYYQLAKQYHPDTNKD------PAAREKFVQIQEAYEILSDEQKKAQYDEFGHAGFGGNSAQGAXXXXXXXXXXXXXAGFGNFEEVFDFFGGGFGGPRGARSSGFTSVGEDLEIPLVVDFMEAVKGSSKKVMIDPIRTCEPCHGFGTKSGKA-PDTCKVCQGTGQQKISLQ----GFHMSAPCQACGGVGTVLQKECLTCGGVGRVRVHENVDVHIPAGADEGVRIRLSGKGNAGEGKAGDLFVRLRVKPSPFFKRQGADVYTETTIPFTTAALGGTVKISTVDGDVDLKIPSGTQPNDVSRLAKRGIQRLN--RSDKGDQFVTLKVALPKTLSKAQREILEKFAEI................. 444
222 0.000e+00UniRef50_A0A1S8VVR9 Chaperone DnaJ n=7 Tax=Eukaryota TaxID=2759 RepID=A0A1S8VVR9_9FUNG  ali  30  24...AGKDYYDILGVARSASKKEIKKAYRARSRQYHPDKNPGDEI-----AEAKFVELAIAYEVLLDEEKRRLYDQYGEEGLKGHGQ-KARQNPFDIFSQF--------------------GGSGGGGHRAERRGPSINMKMDITLEELFNGIEVEIEINKQIICPICRGSGAKS-HAHVHTCTTCGGSGIRIVRQQIAPGFYQQVQTCDACAGKGKIIKAKCTACDGHKVKRGSSQMAVQIERGMADGQTIIFEGEADQSPDHAGNVKFTLNTAPHELFTRHDDSLSMSETITLREALLGFERTIKHLDGNLKFSRTAVTQHGFVQTIKGQGMPK-HEFPSERGDLFIDYQVILPAKITAEQKELVEKLFP.................. 366
223 0.000e+00UniRef50_A0A2E8RXH2 Chaperone protein DnaJ n=1 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E8RXH2_9DELT  ali  31  17...SRRDYYEVLDVGRDASDQDVKRAYRKLALKYHPDRN------SEPEAQELFKEASEAYEVLRDPEKRRIYDTHGHAGLEGRGFTG------------FDDVGDVFSNLGSIFEDIFGFSGQGRSRATSGRGKDVSAVLNISLEEAAEGLERDIKVRRSIPCGSCGGSGAASPN-DVRSCSTCAGRGQVTHAQ----GFMMITSTCPDCQGQGRVVTKPCTVCTGAGREQEMIDLPLKIPAGIDHGDRLRVRGSGDVGPGGPGDLYIDIMIEPHPEMERQGFHIHSVLELDIAEAALGKNVSVNTLLGATEVKVSAGVQPGDTLRLKGKGVP--KRGGYGRGDHYIHVRVTVPTKLSRKAKKSLQDYLKER................ 361
224 0.000e+00UniRef50_K8Z206 Chaperone protein n=2 Tax=Nannochloropsis gaditana TaxID=72520 RepID=K8Z206_NANGC  ali  33  104.....KDYYDILGVSRSATKQEIKKAYRKLALRWHPDVCK------EEGAADKFKEVNKAYEALSDEEKRARYDRFGEAGVEGRGFGGGAQ--FVDDFDIGDIFDSFFXXXXXXXXXXXXXXXXXXXTPQVVPGDDLRLDLTVPFSTSIFGAEEKVRINHLETCKTCNGSGAKKG-SPSRVCGKCQGNGVVVQVQRTAFGIMQTQVVCDQCDGTGEVVAEKCGDCKGAGALQTNKQIKIDIPAGVQDGTKLRIKGEGDAGGGPSGDLYVFLSVEVDKRFRREGIDLYTDLSIDYLDAILGSEKPVPTADGKEVVQIPSGTQPTTRITLKGKGVPRL-GQPNLRGDQIVNVVVNFPTKLSSKEKELLQKLR................... 461
225 0.000e+00UniRef50_A0A2T2QYZ3 Chaperone protein DnaJ n=1 Tax=Parcubacteria group bacterium SW_4_49_11 TaxID=1919225 RepID=A0A2T2QYZ3_9BACT  ali  29  2...ANRDYYEILGVSRDASEKEIKKAYRKLAHKYHPDKEGGD--------EDKFKEINEAYQVLGDQEKRKQYDQFGTAGFQGGAGGQGGMNFEDLFRQXXXXXXXXXXXXEDIFSEFF--GGAGGGGQRSARGRDMQTEVELTLKEAHEGVKRTMTIHKTSACDRCHGSGGDP-DANWQTCSTCQGAGKQRHQVQTMLGNFVEERVCTTCNGQGKIPDKKCTQCNGSGTVTGPEEVEIEVPQGIQDGQTIHVPGKGEAAGGQSGDLYVNVRVKNDTTFRRDGDDLYMDRRVPFTTLVFGDKVNVATLDDSIRLKIPAGTQSGERFRLSGKGM--YRLYGRGRGDVYVTVRAETPDNVSKEVKKRLKELQE.................. 366
226 0.000e+00UniRef50_A0A1F5V5H8 Chaperone protein DnaJ n=1 Tax=Candidatus Fischerbacteria bacterium RBG_13_37_8 TaxID=1817863 RepID=A0A1F5V5H8_9BACT  ali  29  2...TEEDYYSILGIGRTASLSEIKKAYKKLVRKYHPDLNPNDSS-----SEEKFKKIQEAYSALNDPKKKEVYDKYGKAGLGSDFSNYRVYNPSDIDFEGFDFTNFGTSSFKDVFSHLFDNMRTSKKQQYKTETLDIVYPMSITFMESIHGLTAEISLSRMVNCYMCSGTGF-SKQAQEVVCSICNGTGRMSKAR----GYLRFETSCNTCDGKGKITKGKCLHCGGKGKVSKTERMKVKIPPGTDNNSRIRVTGKGNEGKSKTGDLYLAITVNPHPIFTRKGDNIYLTIPITITEAALGAKIEVPTIDGHTTMKIPPNTKSGQVFRLKGKGSPSLRGNY--KGDFYIEVVIWMPEIYDEESRDLLKKFNLRHNENPRT.......... 370
227 0.000e+00UniRef50_UPI0009E302F5 dnaJ homolog subfamily A member 3, mitochondrial-like isoform X1 n=4 Tax=Hexacorallia TaxID=6102 RepID=UPI0009E302F5  ali  29  82....RKDYYKILGVSPNADQKQIKKAYFELAKKYHPDTNK------SAGAAEKFQEISEAYEVLGDDDKRRSHDNFGTADFGGAAGGNPFGG---------GSPFGQSVDAEDIFRSFFEGRGGSFGGFQTSTGEQVQHVINLSFMDAAKGCDKDITTRMRVTCNRCDGKRAEPGTT-YSQCSTCKGTGEETVNT----GFFHMRSTCRRCGGQGHIITTPCKKCRGKGSVHETKTISIPIPAGVEDGQTVRV-------PVGAGEIFVTFKVSESKIFERDGANVSSTVTISFTQAILGGTLRAPGIHGEIEIKIPPGTQSHQKIRLSGRGIPRLNGMG--KGDHFVNFKIHIPKYLNDKQKALILAYAELEDDVNGTVNGVDK.... 438
228 0.000e+00UniRef50_A0A2C9T0S3 Chaperone protein DnaJ n=43 Tax=Actinobacteria TaxID=201174 RepID=A0A2C9T0S3_9MYCO  ali  30  1MA---RDYYGLLGVSKGASDQEIKRAYRKLARELHPDVNPD------EEAQHRFKEISAAYEVLSDPEKRRIVDL--------------GGDPLEG-AGGAANGFGGFGGLGDVFEAFFGGGGSRGPIGRVRPGSDSLLRMRLDLAECATGVTKQVTVDTAVLCDVCQGKGTH-GNSAPVACDTCGGRGEVQTVQRSLLGQVMTSRPCPTCRGVGEVIPDPCHRCAGDGRVRARREISVKIPAGVGDGMRVRLAAQGEPGGGPAGDLYVEVHEQQHDIFVRDGDDLHCTVSVPMVDAALGTTVTVDALDGLTEITVAPGTQPGSVVTLRGHGMPHLRSG--VRGNLHAHIEVTVPGKLDARAKELLAEFKTAEPEVKGLFNRLRETF.. 376
229 0.000e+00UniRef50_L1JV00 Uncharacterized protein n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1JV00_GUITH  ali  29  14.AAAEKDLYKILNVPRNADEKAIKAAYRKLSLKYHPDKNKD------PDAKERFSEVAAAYEVLSDSEKRRIYDQQGEEGLKRHQGGGQAHNPFDIFAQMFG---------------------HRSAGSEEQRGPDINMEMEVSLKDLYLGKQTDILLKKQIICRQCGGSGARSP-EDVKRCSACGGSGVRVVRQQIAPGFVQQQTTCEECGGKGKKVAHKCPKCKGRKVQSGSETITVDIERGAPDGHEIVYEQQADENPDKSGDIKFKLRQLPHPLFRRDGKNLKMKMRLSLREALLGFERKVSHLDGHVVTVSDSGTQHGRVRTVRGEGMPEHN-FPSSKGDLLVEFEVEMPTKVS.............................. 346
230 0.000e+00UniRef50_A0A076FBF1 Chaperone protein DnaJ n=8 Tax=Campylobacterales TaxID=213849 RepID=A0A076FBF1_9PROT  ali  35  4......DYYEILEISRDADGDTIKKAYRKLALKYHPDRNQGD-----KEAEEKFKKINEAYEVLSNEEKRGIYDRYGKDGLNSSGGFGGFEADFDL---------------GDIFSSFFGGGFNGTKSKRSDKYNDLEVGIRLEFYEAVFGCEKEIKYKYKTPCKTCNATGAKDGKKA--TCSHCGGRGKISQRQ----GFMSFVQACPYCSGTGEQIKEKCKDCYGNGYNEIEANITINIPEGVDDDMRIRVAGKGNVGTKDAGDLYVRISVKEDENFVRHGDDVYIEIPVFFTQAMLGESIKIPTLRGDTELKLGIGAKDKEQFVFENEGIKNTRTKKNGR--LIAQISINTPKKLTDEQKELLEKLQNSFGDGDGIFDKIKSWFK. 365
231 0.000e+00UniRef50_Q7ZUP5 DnaJ (Hsp40) homolog, subfamily A, member 2 n=84 Tax=Euteleostomi TaxID=117571 RepID=Q7ZUP5_DANRE  ali  27  4.VADTK-LYDILGVSPSASENELKKAYRKLAKEYHPDKNPN--------AGDKFKEISFAYEVLTNPEKRDMYDRYGEQGLREGGCGGGGMD--DIFSHIFGGGLFGFMGGQGRSRNGGRRRG-----------EDMVHPLKVSLEDLYNGKTTKLQLSKNVLCSTCNGQGGKSGA--VQKCTACRGRGMRIMIRQLGPGMVQQQSVCTDCNGEGEVIKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQKITFGGEADQSPGEPGDIVLVLQEKEHETYRREGNDLHMTHKIGLVEALCGFHFTLKHLDGRIVVKYPAGIEPGSVRVVRGEGMPQYRNPF-EKGDLFIKFDVQFPDNLSPEKLKELEDLLPTRADAP............ 363
232 0.000e+00UniRef50_Q7V3Q3 Chaperone protein DnaJ n=53 Tax=cellular organisms TaxID=131567 RepID=DNAJ_PROMP  ali  28  3......DFYQILGVSRDADANTLKSAYRKLARQYHPDVNKD------PGAEDKFKEIGKAYEALADPETRARYDQFGEAGIGGAAGMPDMGDM---------------GGFGDLFETFFNGFGGRSQRRGPQQGDDLRYDLNIDFKDAIFGQQREINIPHLETCEVCRGTGAKKGTGPTTCTTC-GGSGQVRRATRTPFGNFTQVAECPTCNGVGQIISDPCTSCGGNGVKQVRKKLRINIPAGVDSGTKLRVSGEGNVGGGPPGDLYVFIKVKNDSNLKREGINIYSEISVSYLQAILGDTVDIITVDGKVNLKIPSGTQPNSTLSLENKGVPRL-GNPVARGNHQVLVKVKLPTRITEDERNLLEDLASKYTENSGLFSRL...... 369
233 0.000e+00UniRef50_A0A1F8ZLD8 Molecular chaperone DnaJ (Fragment) n=1 Tax=Deltaproteobacteria bacterium RBG_13_51_10 TaxID=1797828 RepID=A0A1F8ZLD8_9DELT  ali  28  1........YDLLGLNQSATPEEIKKAYRRLAHQFHPDKNPGN-----PSAAEQFRHITEAYEVLQDAKKRVAYDRYGASVGRGSFAGFREPEDFSPPGNFFDDLWG------EIFEEFFG---SRRQRFTRTKGVDFRYNVEVSLEEAAFGMETEIKVPRLSVCPLCRGSRCAPGTLPM-TCPACRGLGSLRAQR----GFFITETTCQRCGGEGKVIVRPCSQCRGTGHIKLTRIIRIHIPPGVDNGTRLRLRGEGEMGGGLPGNLYVMVSVRKHSIFSRSGNDILCQIPITLIQAVRGAEIEVPTLRGKAKLKISPGTPAGKSFTLKGYGMPILQGIG--RGDQKVKLQVEIPSKLNRRQREILDEF.................... 342
234 0.000e+00UniRef50_A0A1Q5PMZ5 Chaperone protein DnaJ n=2 Tax=Actinomyces liubingyangii TaxID=1921764 RepID=A0A1Q5PMZ5_9ACTO  ali  30  3......DYYEILGVERDASAEEIKRAYRKLARKLHPDV-------AGPDAEDRFKEVTVAYEILSDPQKRQQYD---LGGEGGDFFGGMGFDAADLFSTFFG-----------------GTAAQRGPVPRGRRGQDSLATLDVTLEEVTFGAEKEVKINTAIKCSKCEGSCCEPGTS-LRTCGTCGGSGSQMRQARTLLGMVQTSVPCSTCAGHGTIIETPCGECAGEGRVRSSRTLKVDVPAGVEHGTRLRLSGEAGPGGGPNGDLYIEFHELRHPTLRRRGDDVHTQITVPMTAAALGTVVEIETLDGMKEVNINAGTQPGASIRLSGLGVTHLN--RRGRGDLHVLVDVAVPTGLNEEQRELLEKLAEVRGEEPGIFSKLRDK... 361
235 0.000e+00UniRef50_A0A0E0PT21 Uncharacterized protein n=6 Tax=Viridiplantae TaxID=33090 RepID=A0A0E0PT21_ORYRU  ali  30  12........................................GATILIDPGAEQKFKDISNAYEVLSDDEKRSIYDKYGEAGLKGAGMGTGDYNPFDLFESLFEGFGGMGGM------------GGRAARNRPMQGDDEAYNLVLNFKEAVFGVEKEIEITRLEGCNTCDGTGAKPGT-KPTTCKTCGGQGQVVSSTRTPLGIFQQVSTCNTCGGTGE-FSTPCNTCGGDGRVRKTKRISLKVPAGVDSGSRLRVRSEGNAGGGPPGDLYVFIDVLSDPVLKRDGTNILYTCKVSYIDAILGTTVKVPTVDGMVDLKIPSGTQPGTTLVMSKKGVPLL-GKSNARGDQLVRVQVEIPKRLSSDERKLIEELANLNK............... 333
236 0.000e+00UniRef50_A0A1Y1I4U3 Putative DnaJ protein n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1I4U3_KLENI  ali  29  119..APKKDFYEVLGVKKGASTSELKKAYHKLAKQFHPDINKDD-----PSASKKFQEVQQAYDVLKDDEKRNMYDQLGPDGFQQAESGGMPGGGFQGGPGMGGFDMGGGGGFEDLFGNMFNMGGRGQR--GPIMGPTVQVQITLDFMDAVKGTERDISYEAPARCRTCSGTGLPPG-EKPVTCKDCKGSGRI---QQGGRGVM-MEYLCPTCQGTGTIVKNHCRTCAGEGVELQVKRTRIKIPAGIDTGQEMKLVGQGGEAPGPPGDLVVIVAVMEHPVFKRQGYDIHVEASVSMTQAALGAKVRVPTLTGDVLLKVPEGTEAGDQTVMRGKGIKHIR--QDRYGNEFVHFHVVTPKKLTSRQRQLLEDLSKEFGEREG........... 491
237 0.000e+00UniRef50_A0A1Q7YS68 Chaperone protein DnaJ n=34 Tax=Bacteria TaxID=2 RepID=A0A1Q7YS68_9CHLR  ali  27  4..TAKQDYYELLGVPRKATAKDIRTSFRKLARKYHPDLNPGD-----KSSEEKFKQLQEAYDVLSDSKKRQIYDQYGFYSDNMPPGGPGAGPGQDGDFGGGAGTAGGGASFRDLFSQFFSGSRGSTAEPEHEPGGDLEYQIEIDFWDAVRGAVKKLSITRLDTCETCHGTGA---VGSPQTCPTCHGTGTIQQQ----AGKMKFNVPCTRCGGTGKL-RTVCKTCGGEGRVRRTETIDVRIPAGVANGARVRVPGKGNSGGAPPGDLYLRVVAKPHEFVERRGNDLYTKIPVTVSEATLGAKIEVPTIDGRSLVRIPPGTNSGKTLRLKEKGVPSARNG--ARGDQYVEIQVVVPPPTDERVRNLMKELESVAPGDPR-----KDLF.. 383
238 0.000e+00UniRef50_A0A287PFI7 Uncharacterized protein n=9 Tax=Poaceae TaxID=4479 RepID=A0A287PFI7_HORVV  ali  31  102.....RDHYATLNVRRDATLKEVKSAYRTLARKYHPDMNK------SPGAEEKFKEISAAYEVLSDKEKRSLYDRFGETGLHADYGGGDGVDPYELFNAFFGSSNKFFGD------SMGPGRFHYSSNVKDNRGLDIHCDLLLPFEESILGVKREINISRHETCGACHGSGAKSSNS-ITECTQCRGQGRSMKSQRTPFGIVSQISSCLNCGGSGKIITEHCTSCYGSGKVQVERSIKVDIPGGIEDGSAIRLTGGGDKKRGVSGDLYIFVRVEEKQGIHREGLNLCSDVTIDYTDAILGTTVKVETIEGLKDLYIPPGTQPGEKLKFAQLGVPDIKR-PNHRGDHNFVVKVKIPRNISDQARSLVEDLAALKG............... 462
239 0.000e+00UniRef50_A0A2V9C649 Molecular chaperone DnaJ n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9C649_9BACT  ali  26  88..........................WFEAALKWHPDRNPENKT----EAEAKFRECTEAYSVLSDPQKKQVYDTYGHAGLSSVGAGQGF--DQTIFQD-FHDIFGDFFGFEDLFXX---XXXXXXXXXXAQRGADLRYDMTLNFEEAAAGVATKIKLPRQEFCEACNGTGAKKGT-GVVTCTACGGRGQVGYTQ----GFFTITRTCPTCQGAGQIVKERCMECRGQGRMEREKTIELRIPPGVDTGTRLRVAGEGEPGPNGGPDLYVVLEVKEHPFFERRGADLYCTIPISITQATLGTELSVPGLNGEEKLKIPEGTQGGAVFRVKGKGLPDPHGGG--RGDLYYHLRVLTPTKLTREQRKLIEQLGKPAERGSSIFDKVKDIF.. 440
240 0.000e+00UniRef50_A0A024GQK4 Uncharacterized protein n=4 Tax=Albugo candida TaxID=65357 RepID=A0A024GQK4_9STRA  ali  29  518.PVDNNKFYEILGVSKTATATEIKKSYRKLALKNHPDKGGDP---------ELFKHMTVAYEVLSDPEKRELYDQYGEEGLQNGAGGA---DASDLFSQFF--------------------KGGSRRRTGPQKGEDLTHPLKVSLEDLYNGKTVKLAVNRDVLCSRCDGRGGAEGAE--KTCDTCQGRGMRVQLRQIGPGMVQQQSVCSDCRGQGKTIRDRCKTCKGKKVTKERKVLEVNIEKGMRHGQRITFSGEADQAPGVPGDIIFVIQEKEHSIFQRKGGNLIMEKKISLVESLCGFEAIVEHLDGRLHIKTNPGIKPNQFKSIQGEGMPT-HGNPFIKGQLVIMFKIQFPESMTEKQLSTLRSVLPPAPSVPHIAD........ 871
241 0.000e+00UniRef50_Q4S8F7 Chromosome undetermined SCAF14706, whole genome shotgun sequence (Fragment) n=1 Tax=Tetraodon nigroviridis TaxID=99883 RepID=Q4S8F7_T  ali  25  5.VVDTK-LYDILGVSPSVSENELKKAYRKLAKEYHPDKNPN--------AGDKFKEISFAYEVLSNPEKKELYDRYGEQGLREGGGCGPGMD--DIFSHIFGGGLFGFMG----------GHGSRSRNGGRRKGEDMLHPLKVSLEDLYNGKTTKLQLSKNVLCSTCNGQGGKTGA--VQKCAACRGRGMRVMIRQLAPGMVQQQSVCTDCNGEGEVIKDRCKKCEGKKVVKEVKILEVHVDKGMKHGQKITFGGEADQAPGEPGDIVLVLQEKDHPTFKRDGNDLFIDHKIGLVEALCGCQFLIKHLDGRIVVKYPAGIEPGSVRMVRGEGMPQYRNPFD-KGDLYVKFDVQFPQNISPEKLMELEDILPSRPDPP............ 383
242 0.000e+00UniRef50_B2KEA3 Chaperone protein DnaJ n=2 Tax=Elusimicrobium TaxID=423604 RepID=B2KEA3_ELUMP  ali  33  1MAKQKEDYYKILEVTRNATSVEIKSSYRRMAMKYHPDRNPGN-----KEAEERFKEVNEAFSILSDPQKKQVYDNYGHDGLNNXXXXXXXXDINDIFSSVFGDMFGGS------------FGGGKARRNSPQRGSDLKMDVNITLEEAFSGLDFPLNYSHMDNCSECQGSGAEKG-SKLKTCSTCGGSGVVQFNQ----GFFSMRQTCPDCGGQGSITEHPCKKCSGSGKEKVKKTITVKIPAGIRSGMTLRVSGDIGSKGGGYGDLYIEVTVKKHKIFERNEDDLILEMPVSFATAAMGGKIKVPILKEELGLTIEKGTQYGTIYTIKDQGMPKI--AKRGFGDLKVIAIIEVPKKLSKKQELLEEFEKEDSESKKSFLEKV...... 368
243 0.000e+00UniRef50_A0A2H9ME79 Chaperone protein DnaJ n=1 Tax=Caldiserica bacterium CG02_land_8_20_14_3_00_36_38 TaxID=1973932 RepID=A0A2H9ME79_9BACT  ali  31  2...SDRNYYKILGVSKDATPEEIKKKYRELVMKYHPNLNKNN-----PEAPRKMAEINEAYQVLSDSDRRAQYDRFGTVGEGVGTPGGAGGFNFGDFGAGGFDFGGGFDLGDLLRNFGFGGFREETEEREVSHGADLEYSLTISFKEAVLGTTKEISFNGKGVCPVCHGSGVEPGAGYI-TCPTCKGSGVVRKVQRTVFGQFVVQSTCSTCHGTGKIPKEKCHNCGGLGAVNSTRKIEVKIPAGVENGMRVRIRGQGNAGGGITGDLYVLIRVIADNRFVREGDNLFYNAHISVPDAVLGTTISVPLIEGEEKLKVPAGTQSGIEIPIRAKG--AYNVGSRRRGNLIVKIFVDIPSRLSREEINYFEKLRELESEKKS........... 372
244 0.000e+00UniRef50_A0A0K9QZP4 Uncharacterized protein (Fragment) n=5 Tax=Chenopodiaceae TaxID=1804623 RepID=A0A0K9QZP4_SPIOL  ali  29  58.AAAKADYYTSLNIDRNATLDQIKSSYRNLARKYHPDKNPG--------SEDKFKEISAAYEILSNKEKRALYDRFGEAGLHGESVGPSFVDPFQVFDSIFGEA-----------DNFFGGQGMGVNFERRNRGRDIWSDLNLTFEESVFGGKQEVEVPCLETCGVCGGTGAKS-TNCIKSCTDCGGRGRVMKSQRTPFGVVSQVSTCLSCAGDGKVVTDDCAKCGGLGSIRSKRSFDVVIPPGVDDGATMQLRGEGDSKRGIRGDLYLVLRIKGKDGVWREGLNLFSRIRISYTEAILGTMIKVETVEGSKELYIPSGIQPGDVVKLPSMGVPKPN-ERSGRGDHVFIVDIQIPKRISDRERELVEELASLQAPSS............ 421
245 0.000e+00UniRef50_A0A1V6GV20 Chaperone protein DnaJ n=1 Tax=Thermotogae bacterium ADurb.Bin062 TaxID=1852923 RepID=A0A1V6GV20_9BACT  ali  32  2...AKKDYYEVLGVTKEATQDDVKKAYRRLAKKWHPDLHKDD----RAQAEKMFKELTEAYEVLSDAEKRAMYDRYGFVGDQTPPTATTGRESGSVFNDFFGG-----QPMGDIFDMFFGSQGHATRVRSVRMGEDLQITVQVALKDVMRGFDEEIEYERYTACESCKGNGSKDGNS-FRTCSQCGGRGAIIQETRTLIGNISSSRTCPKCRGTGKVIEESCPVCKGNGRLAERKKIRIKIPAGAEDQMRLRIAGAGNAGIGGGGDLYVMIRVQPHRNIKRQGKDLYSEVGVSYLQAILGGTIEVETLEGSVSYKLDAGTQPNETIRLRGKGLPDLRSGLL--GDHYVTVKVTIPKRLNKKERKLLEEIAALKNE.............. 370
246 0.000e+00UniRef50_A0A2I0B4I6 Chaperone protein dnaJ 1, mitochondrial n=5 Tax=Mesangiospermae TaxID=1437183 RepID=A0A2I0B4I6_9ASPA  ali  29  71MAKC-RDFYEVLNLTRNASIQEIKSSYRNLARKYHPDMNKGSGG------EEKFKEISAAYEVLSDEEKRSLYDRYGEAGLQGANAGPLGVDPFEVFNAFFGQSNGLFGEDIDPGEFNFSPQMRQGMRH------DIRYDLFLSLEESIFGVLRKMDITCKEICNSCNGTGAKSSKSIKSC-SECGGRGGIMRTERTAFGEVSQISTCFKCGGSGRSITDRCRICNGKGNVEVTRSVNINIPPGVSDGSTIQIPGEGDKKRGLVGDLYLVIHINEKRGIRREGLNLYTDISIDYTEAILGTTVKVETVQGCQDLCVPSGTQPGAVLNLANMGVPNIN-KPSVKGDHHFIVRVQIPKDISDEERSLVEKLASIRKTFQG........... 439
247 0.000e+00UniRef50_A0A2G4I6L1 Chaperone protein DnaJ n=35 Tax=Actinobacteria TaxID=201174 RepID=A0A2G4I6L1_9ACTN  ali  32  1MAQ---DFYQLLGVSRGVSQEELKRAYRKLARELHPDANPNNA-----EAEEKFKLVSRAYEVLSDEETRARYDQFGEAGISGGGRGGGGGDPF-------GGAGGFGSIFDAFFGGDSPFGGSTRQQSGQQRGPDLETQIKIDFVDAIFGCHTSVSIRSAVSCEDCGGSGATAGT-KATTCADCGGSGQVRRMRQSILGQMVTTTPCGRCRGMGEVIASPCNKCRGEGRVTKDQTHEIEIPAGIAAGQTMRVTSRGGVGGGAAGDLYVHIDVAPHAMYQREENDLVTNVQVSIAQAALGVDLVLATLDGDETLTVTPGVQHGHEYVLKGRGVPFLNNRGRTRGDLRARIEVVVPKKLSSKERDLLQQLAKERGEDSSLKSKIKSAF.. 382
248 0.000e+00UniRef50_A0A2G6KHB2 Chaperone protein DnaJ n=2 Tax=candidate division KSB3 bacterium TaxID=2044937 RepID=A0A2G6KHB2_9BACT  ali  28  12..AKTTNYYKILGVSEQSDEASIKRAYRQLALKYHPDRNPGDQF-----AEDKFKQVTEAYRILSDAQKRADYNRIRHESTFNTSYRSRNTNFEDVFDTF------------DNFSSGKSKASSRKKYQQPIRGADLKYEVTIPFEQAVLGTTTVIEVNRLDQCQRCRGTGIEP-RTYPMLCPTCLGKGRVRQSH----GFLGFTQVCPDCNGSGRVYQKECSQCRGDSRVLQKQKISVRIPANIHDGTSLKVAGEGEGGRGPSGDLFIHVHVQEHEFFSREDHDIWCEVPLSMTQAALGGIIEVPTLEGKVRIKIPAGTQCDRVFRLSKKGAPS--SKKDQRGDLFVKVKIEIPTNISQRQRQLLEEFARLNGETISPAQKIIAWFKS 389
249 0.000e+00UniRef50_A0A0L6UL82 Uncharacterized protein n=1 Tax=Puccinia sorghi TaxID=27349 RepID=A0A0L6UL82_9BASI  ali  32  96.AFASKDPYSILGVKKDAAASEIKKAYYSLAKKYHPDINK------EAGAKERYQSIQEAYDTLSDEKKRAAYDQFG------PMSQQPGFDPNNPFGDMFGG-GDPGDVFSSLFGAFGGRSGARGANQQVFVGDDLEATINIPFEEMAKGTSRSIDTTPIVNCPPCHGEGIKQG-AKPQTCRTCNGTGTMTFVVQSG---FTMASTCQSCGGSGKKVDDKCGSCGGIGKVRDRKQVNVKIPAGVEDGMRIKLAGQGNAKGGRPGDLYVKVNVAPSKIFRRQGSNLYTEVKIPFHAALLGGTARVPTLEKEVEVQIPRGTQPGEELVLKGRGIKHL--YKEWLGDLIVKFNVTIPRSLNDDQRIALEAY.................... 463
250 0.000e+00UniRef50_A0A167MN49 Uncharacterized protein n=28 Tax=Eukaryota TaxID=2759 RepID=A0A167MN49_PHYB8  ali  30  1MAVEAK-YYEILEVEVDAEDHEIKKAYRKLAMKYHPDKNPEEG--------DRFKEISHAYEILSDPEKRAQYDRYGEDGPGGGAGGFGEGGLDDLFANLFGGGGGGGGAHFD-FXXXXXXXXXXXXPPRSRKGESMKYPLQVTLEDLYNGKRTKLALEKNVICSNCSGKGGKTGA--VKKCGGCQGRGFQVAMRQIGMGMIQQMQPCGDCNATGEIAKDRCKKCKGKKVTVEKKYLEVFVEKGMSDGQKIVMKGEGDQEPGEPGDVILVVNLKQHPIFERKSNDIICNLTITLTEALCGFEKVITHLDGRIRVFHPAGIKPGMVKRIPHEGMPIYKR-PDDRGDLYVKFDVEFPKDKTPENLKLLESILPARP............... 368
251 0.000e+00UniRef50_A8PW86 Uncharacterized protein n=1 Tax=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) TaxID=425265 RepID=A8PW86_MALGO  ali  26  206..STPKDPYATLGVKRDASAKDIKSAYYQLAKKFHPDTSK------EPGAKEKFVEIQAAYDILSDDQKRASFDQFGSA--DGPNMGFDPXXXXXXXXXXXXHPGSAESIFESLFGGAFGGGRTARTGGGETRGEDIEASVNITFEEACKGTSRTISINPIDRCGTCTGSGLKE-NAKRSTCQVCRGTGTRTFVIQ---GGFQMASTCPACSGTGSSIADECSSCSGAGRVKSKRSIMINIPAGVDDGYRIRQDGAGDVGPGPPGSLYVRIHVMPSRTWRRQGTNLFYPAQIPFYTAVLGGRVRVPTLEGDVSVRVPSGTQPGDEMILRGRGVPRLGGRKSNHGDLMVQFDITIPRSLSKRQKELLQQFADEYEGR............. 575
252 0.000e+00UniRef50_A0A2G4H681 Chaperone protein DnaJ n=2 Tax=Thermoleophilia bacterium TaxID=2026888 RepID=A0A2G4H681_9ACTN  ali  27  1MSTPA-DYYETLGVPRDASDDEIKKAFRNLARQHHPDVNPDN-----PEAAETFRVVAEAYEVLSVTETRAQYDRFGHAGISGAGAGGGAGNLDDILGMFFGDGMFG----------------GRGARRGPQAGPDAATAISLTLREAAVGVQRDLEVEIVAPCDRCSGSGAEPPTRPI-PCPTCGGLGQVRQISNTPLGQIVREMPCPACRGRGATVETPCSDCRGQGKQPERRTVSVGIPAGVDTGQRVRVVGQGHAGGAPAGDLYVAIQIEDDPAIVREGLDLHVLVDLTVTQAMLGATVHVPTLEGMETIVLQSGTQPGDRRTLRGKGMPQI-GNENRRGDLHVLFAVHIPKKLEPTVRLLVEELDKSIPEESGFFNRVRRGF.. 372
253 0.000e+00UniRef50_A0A0Q9ZBX3 Chaperone protein DnaJ n=18 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A0Q9ZBX3_9FLAO  ali  27  2....KEDYYDILGISKGASTAEIKKAYRKMAIKYHPDKNPGDS-----EAEEKFKKSAEAYEVLSNEDKRARYDRFGHQAFEGGAGGGGGMDMDDIFSQF----GDIXXXXXXXXXXXXXXXXXXXXXQRRAKGSNLRIRVSLTLEEIANGAEKKIKVKRKVQ---------APGTTYKTCTTC-KGTGQVTRVTNTILGRMQTASPCTACSGSGQIIDKRPPEADAHGLVQKEETVSIKIPSGVEDGMQLKVSGKGNPGNGVPGDLLVAIEEKEHPSLQREGDNLHYDLYISLSEAVLGSSREIDTVTGKVRIKVEEGVQSGKILRLRGKGIGNLNGYG--KGDLLVHVNVWTPKNLNKEQRDFFEKMAEPEKSDKSFFEKVKDMF.. 375
254 0.000e+00UniRef50_A0A1S8BI81 DnaJ-like protein 1, mitochondrial (Fragment) n=116 Tax=leotiomyceta TaxID=716546 RepID=A0A1S8BI81_9PEZI  ali  27  9...ATKDPYSVLGVDKNASTSEIKKAYYGLAKKYHPDTNKD------AGAKDKFAEAQSAYELLSDAEKKKAYDTYGSAAFDGGASGFXXXXXXXXXXXXNAGGFGADFNFEDLFGAFAGAGAKRGGRSRGSRGEDIEVQTNISFMDAAKGTTKEIFITPLVQCSTCKASGLKKGTKK-TSCQVCHGTGQRVVSM----GGFHMATACEACGGAGVSVPSKCSTCDGEGAVRERKTVTVDIPGGVEDGMRLRVSGEGDASGGQNGDLYVFIRVAADPKFQRSGSDVLYTATVPLTTAVLGGEIRIPTLDGDVKVKVPTGTGTGDKITLGGMGMKKLNSRKGMKGDLRVEFKVAMPKYLSANQRTILEMLADEMGDQN............ 402
255 0.000e+00UniRef50_A0A2M8D1Q9 Chaperone protein DnaJ n=1 Tax=Acidobacteria bacterium CG_4_9_14_3_um_filter_49_7 TaxID=1973888 RepID=A0A2M8D1Q9_9BACT  ali  27  2...SNKDYYAVLGLPKGASAAEVKKAYRKLARKYHPDVNPGDA-----DAEKRFKEISEANSVLSDPKLKEQYDTYGFVGDRAGGPGPDFNGFGGDFSEIFDMFNRGAGGF---------QSSGAPRSHAPRRGQDIQYSMKLSFEDAVNGVTSRIRVSRSKPCTTCDGKGHVP-IARPTVCSRCNGTGRET----AGGGLFHVQRPCSMCGGSGQIQEAQCNSCGGSGRNPISETINVRIPAGVDNGSKIRIAGKGEAGGGPAGDLFIITNIEPHPFFRRVGDNIYLTLPVTVSEAALGCKIKVPTVSGITTVRIPPGTQCGQKIRIRGKGIKSLRTG--TPGNMFLEITLQTPDTRNTRVRELLRELSEFENPD............. 362
256 0.000e+00UniRef50_A0A2P6TDP8 Flagellar outer dynein arm heavy chain beta n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TDP8_CHLSO  ali  28  62.VRADRDFYQILGVSRDADKKTIKSAYRQLARKFHPDVNK------EADAEERFKDISAAYEVLSDDEKRGMYDRFGEQGLKGGFXXXDFSNPFDIFET-------XXXXXXXXXXXXXXXXXAARSRNRPVQGDDQRYDLRLEFTEAIFGCSKEIEVSRLEDCSTCSGSGVKAGTTSSTCTTC-KGAGQVVQAVRTPLGMFQQVATCPTCSGTGEQFT-PCGTCQGDGRVRGSKRISLRVPPGVDEGSRLRVRGEGDAGRGEPGDLYVFISVKPHPELRREGVTIHSDVEISYVDAILGTTVKVTTLGSEVDLKIPAGTQPGTTLVMSKRGVPKLGSN--ARGDHLVHVKVKIPKTISGEERKLMEQLRELQGAKP............ 435
257 0.000e+00UniRef50_A0A2H5VNW6 Chaperone protein DnaJ n=6 Tax=Bacteria TaxID=2 RepID=A0A2H5VNW6_9BACT  ali  29  2...TRRDYYEILGVTRRATRAEITRAYKKLARKYHPELNPGD-----EEARRRFEEIAEAYEVLSDPKKRALYDRYGWRRDEMPEAREKKTT--DII--FEGFDFSAEESFGDFLEELFG-SSEQKRAKGPQRGADLEVPVALSFEQALRGTTIVVTVARRQTCPRCEGRGEIEG--PVGTCFRCGGTGRRPTTR----GPLRLSMRCQQCEGTGRSAP-ICPVCHGETRIPVKESVEVKIPAGVDTGSRVRVEGKGEAGGGPPGDLYIVPNVQAHPFFVRKGDNIYCTVPITITEAILGAKIEVPTLWGKATLRIPPGTQSGQIFRLREQGAPSLRG--DVRGDQYVEVKVVIPRLIDQRSRELMREFERLNPENPR........... 359
258 0.000e+00UniRef50_A0A1Q6RL66 Chaperone protein DnaJ n=1 Tax=Firmicutes bacterium CAG:552_39_19 TaxID=1897035 RepID=A0A1Q6RL66_9FIRM  ali  29  2...EKKSYYDILGVGKDASNDEIKSAFKKLALKYHPDHNPGD-----EAAAEKFKEINEAYQTLSDPQKRAAYD-------NPASSAG--------FGGFSGENFTGFGGFGSVFDDLFSFFGGGGGGSQKARGRDVNVKVTLTFEEAAFGAQKEVSVSRIEPCKECKGTGAKNGTE-YTQCSNCGGTGRVRYVQNTPYGQMASERVCPKCGGAGKIIKETCPKCGGRAFVRVNTKLKLTFPPLMENGQLVTVRGEGDVKGGEAGDLLIAVTVLPHKLFTRKGSDLYMTYPITVVQAMLGDKVKIPAIKGDVMLTIPEGTQSGDTVKIRSAGV-DTGRRLVSKGDMYVKLVVDIPKNLTKEQKEKVKAMGESIKETQ--YDSVRGF... 362
259 0.000e+00UniRef50_A0A1G2KRH2 Chaperone protein DnaJ n=1 Tax=Candidatus Sungbacteria bacterium RIFCSPHIGHO2_02_FULL_49_12 TaxID=1802271 RepID=A0A1G2KRH2_9BACT  ali  32  2....KKDYYEILGVPRSSSLEEIKRAYRKLAHQYHPDKKAGN--------EEKFKEANEAYQVLGNEGKRAQYDQFGQT-FDASAEPGGGFGWNDIFSDFGFNSRFGEFDLGDIFEGLFGASGAHRDTKR-KRGKDIVIDITIPFEESILGGKETIEYKRTVRCARCSGTGGEPGTNIVK-CATCGGKGSIQKSTRTILGSMTRVETCPRCRGAGDIPEKFCGFCGGKGLELKKESIELIIPKGTKTDDVLRLSGKGEIADGAPGDLFVRLRVLPHKTFKRQGDDLIMAVSIKISQAILGGHMTLEAIDGTVDLKIPEGTQSGDILRLRGRGVSESRGYG--RGDLLVEVTVEVPRKLPKHLKELIEQLKQE................. 367
260 0.000e+00UniRef50_A0A0G0S3D8 Chaperone protein DnaJ n=18 Tax=root TaxID=1 RepID=A0A0G0S3D8_9BACT  ali  33  1MAAS---YYDLLGISKGATDDEIKKAYRKMAHKYHPDKSGGD--------EAKFKEVNQAYQVLSDKSKRQQYDQFGQTFDGNAQGFGGFDFSGFDFGGQNGGFEFGNEGYEDIFSNIF--GGSSRGGRRRAQGADIRVDMEITFVEMVSGVEKEVRLYKKVVCDHCDGEGAEPG-SGMKTCPTCKGQGRVQTLRKSLFGSFSQVTECPECHGNGKIFEKKCSKCGGDGRVKEEEVIKIKIPAGIMDGQAISMSGYGEAGGSRAGDLLVQIHVLAHKKFKRKGNDILSTEFVPFSIATLGGKIEVATITGSLILKIPAGTPSGEVFRIREEGVPDL--SGRGTGSQLVTVVVKVPKSLSREQKKLLEQLSD.................. 369
261 0.000e+00UniRef50_A0A2E1MFK9 Chaperone protein DnaJ n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E1MFK9_9BACT  ali  31  2.....RDYYEILGVQKGSSPKEIKNAYRKMAFKYHPDKNQGNEL-----AEKKFKEAAEAYDVLSNDDKRSRYDQFGHAGIKGNGAGHPGFDLNDIFSNF-----------GDIFENMGGGGGFGDFFNSSSSGTDLKLTLPVTLEDIFSGKVKTVRVQKYILCDDCNGNGCAKGY-GLNQCSVCNGTGEVRKVQQSFLGQVVNVQPCYNCNGKGQVISNPCKNCKGDGRVRKHSSIEIEIPPGVVTGSYLTKRGAGNAGGSPSGNLIVIFDEVDHPLYLRDENDIIIDAYIDYSTAVFGGKIEVPTLSGKIKLKIPKGIKGGQLLRVRNKGLPELNSHRV--GDFLVRININIPKNFNSKVKQIIEELKQEEPEFKKF.......... 367
262 0.000e+00UniRef50_A0A0W4ZNQ4 Chaperone DnaJ n=3 Tax=Pneumocystis TaxID=4753 RepID=A0A0W4ZNQ4_PNEJ7  ali  28  66...AMKDPYATLNLTKDATTADIKKAYFKLAKQYHPDTNKD------KGAQEKFLEIQQAYEILSDPKKRSKYDQYGTSAFEGEKFSTSGSSDFEDFGGFSNMKGFPFDDLFGAFG-FGGKSSTRSNVNEILVGDDVEVQTSISFMEAAKGGTKSIYINLMATCKTCSGTGLKSGQ-KRSACQRCGGTGTRVH---IMHGGFQVASTCEYCKGAGITIGSECWSCSGNGIIREKKAIKLDIPAGIEDGMRIRLAGEGNAPQAKNGDLYVRIRVMPHAIFRRKGSDIFHTVTIPMTTAALGGTIKVPTLDNDVELKVPSGTATGDVIVMNGKGIERLHSNG-MKGDIKYDFKVTIPKILSPYERTLLEQLAASMGD.............. 434
263 0.000e+00UniRef50_Q8GWW8 Chaperone protein dnaJ GFA2, mitochondrial n=196 Tax=Spermatophyta TaxID=58024 RepID=GFA2_ARATH  ali  33  90MSA--KDYYSVLGVSKNAQEGEIKKAYYGLAKKLHPDMNKDD-----PEAETKFQEVSKAYEILKDKEKRDLYDQVGHEAFEQNASGGFPFNPFDIFGSFNGDIFNMY--------------------RQDIGGQDVKVLLDLSFMEAVQGCSKTVTFQTEMACNTCGGQGVPPGT-KREKCKACNGSGMTSLRR----GMLSIQTTCQKCGGAGQTFSSICKSCRGARVVRGQKSVKVTIDPGVDNSDTLKVAGGADPEGDQPGDLYVTLKVREDPVFRREGSDIHVDAVLSVTQAILGGTIQVPTLTGDVVVKVRPGTQPGHKVVLRNKGIRARKST--KFGDQYVHFNVSIPANITQRQRELLEEFSKAEQGE............. 445
264 0.000e+00UniRef50_Q1IT18 Chaperone protein DnaJ n=53 Tax=Bacteria TaxID=2 RepID=Q1IT18_KORVE  ali  30  1MATQTKDYYGALGVKKNASAEEIRKAFRKLARKYHPDVNPGD-----KKAEDKFKEISEANEVLSDPKKRKIYDQLGFGGYDPRAAQGGQDIPFDFSGFDFSQEAGGGGGFRDIFSSLFGGGRGHEERPRPQAGTDLEYQVNVPFWDAIRGTTVKLNIQRREVCSNCHGEGEIGGT---HTCPQCHGKGKIE----TGGGPMKFNVTCPTCHGTGK-ARTQCPVCHGEGAITRNEPLEFKIKAGTRDGQRIRLAGRGNAGGGASGDLYIIVKAGEHPVFRREGDDVYVTVPVSAVEAALGTKIEVPTIDGRALLKIPPGTNSGQKLRLREKGVPNAAD-GTKRGDEIVEVKLIVPKVSDERSKEILRELQKLNPEDPR........... 394
265 0.000e+00UniRef50_A0A1F9QH29 Chaperone protein DnaJ n=11 Tax=Bacteria TaxID=2 RepID=A0A1F9QH29_9DELT  ali  34  2..TEKRDYYEILGVARDVSKADLKKAYRKLAIQYHPDKNPDXXXXXXXX------------------NKRQIYDQFGHRGLEGAG-HSGPSGFEDIFSSF-----------GDIFEDFFGFXXXXXXXXXXXXXSDLRYNMTIEFMEAAFGTEKTISIPKLSTCPDCRGTGCEEGTHS-ETCSQCHGSGQFIQSQ----GFFKVKTTCPYCKGQGTIISNPCRKCRGAGRVEITRKVQVKIPAGVDVGSKLRLSGEGEASPGSPGDLYVVINVRPHKFFQRDNTNIICAIDISFIQAILGDEITIPTLVGEKKLTIPKSTQYGDVFKLKGEGIASLRTG--QRGDQIIKVIIKTPTKVSQKQVELLRQFDEL--DSNKISNKLKNLFK. 364
266 0.000e+00UniRef50_A0A124G0E7 Chaperone protein DnaJ n=1 Tax=candidate division TA06 bacterium 34_109 TaxID=1635277 RepID=A0A124G0E7_9BACT  ali  29  2....EKDYYKILNVDRNATPDEIKKAYRALAKKYHPDLNKDNKEEAEKKFKE----ISEAYEVLIDPEKRKIYDAYGYEGVSGQFSQGGFSDISDIFKEFFGGSGFGSSIFDNLFGGSFSHRGDERYYEEERKGKDIKINLRLTLEEIFSGTTKTLKYSRYEKCKKCDGKGG----TDIKVCPDCKGTGQRKYKRQTVFGTVVQVATCPTCSGEGKVVGNKCKDCFGEGIVKVEHSVKVDIPAGVYDNSYMRLQGEGNAHGGKFGDLIIVFQEVPHKKFIREEGNLKTEVYIKYPTAVLGGEVTIEIIDNKKKLKIPSGTESGKVFIVKGKGLPDPN-NPRKVGNLLVKVNIEIPKNIDVKAKNLLKELERI................. 372
267 0.000e+00UniRef50_M5E6N4 Similar to S.cerevisiae protein MDJ1 (Co-chaperone that stimulates HSP70 protein Ssc1p ATPase activity) n=3 Tax=Basidiomycota TaxID=5  ali  27  73..AAQKDPYATLGVKRDASAKDIKNAYYQLAKKYHPDTSK------EPGAKERFVEIQSAYDILSDEQKRASYDQFGSADGPGGFDPAAGASPFGGFS---------PGSAESIFESLFGGAFGGARGTAETRGEDIDASVNISFEEACKGTSRTVTIHPIENCGTCSGSGLK-ANAKRSTCHVCRGTGTRTFVIQ---GGFQMASTCPACNGTGSSIADECTSCSGAGRVKSSRTISVNIPAGVDDGYRIRQDGAGDVGTGPAGSLFVRINVAPSRIWRRQGTNLFYPATIPFYTAVLGGRVRVPTLDGEVDVRVPAGTQVGDEMVLRGRGVPRLRKNYDVNGDLMVQFDITIPRSLSKRQKELLQQFADEYEGKAS........... 444
268 0.000e+00UniRef50_A0A1C7NQG8 DnaJ 1, mitochondrial n=4 Tax=Mucorales TaxID=4827 RepID=A0A1C7NQG8_9FUNG  ali  32  44.....QDPYKILGISRSSSQNDIKKAYYKLAKQYHPDTNKD------KKAREKFVQIQEAYEMLSDEEKRKQYDQFGHSGGAKGFYSSSGFDPNDIFSQFFGGGFGDAGFGSAAGGDPF----------RTTSGEDIQVPLTIDFMEAVKGVTKTITVQSVTHCPTCQGSGLRAGHAK-SSCHLCHGTGFQAIQM----GGFHMQSTCQACGGLGQSIPPQCPTCQSAGKVRENKQVQVTIPAGVDNHSRIRVPGAGDAGNGPHGDLFVSLNIKPSPVFRRQDADIFCDAKIPFYKAMLGGKVRIPTIDGDVELRIPPGSQPQDSIALRGRGIQRLKG--SSRGDQIVQLKIELPRSLQDKQRDIIKKYAALVDEKPS........... 401
269 0.000e+00UniRef50_A0A1S8W968 Chaperone DnaJ n=3 Tax=Batrachochytrium salamandrivorans TaxID=1357716 RepID=A0A1S8W968_9FUNG  ali  28  91.SMSKRNPYDVIGVSKTASANEIKKAYYQLAKKYHPDTNKDSS------AKEKFVEIQHAYEILSDEQKRSQFDQYGTADDSPNGSXXXXXXXXXXXAGGFGSAESSSGGFGDFFDQVFQKFSGAG---GARHGEDVFTSTKITFMEAVAGTEKPLSFVSARSCKPCTGSGVKPGHKK-STCTTCRGSGKIV----IPNGNFHMVANCPNCDATGTSIPHKCTSCNGAGLIRERQSISVKIPAGVEDGMKIRLSGQGDAGQGPHGDLIVSINVSSHPIFKRDGPDILMKTTIPLHIAILGGTIRIPTIEGDVDLTIPSGTQPNERKVLRSRGAPDLSYGSSRRGDQWVTLVVEVPKSLTVEQKRLMMEAFGDKKAQSTFED........ 473
270 0.000e+00UniRef50_A0A2H6FTW7 Chaperone protein DnaJ n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H6FTW7_9BACT  ali  30  1MATSTKDYYEMLGVNKGTSQDDIKKAFRRLARKCHPDLNPGD-----KSAEQKFKDINEAYEVLGDPKKRADYDQFGKTPFEAGKGFADTARFREGFAT---GSGFDFGGTEDIFSDLFSGFG---QEEVSLRGNDLRTSLGITLEEAYRGVTKPIILTREAPCKTCGGSGAES----TRSCTTCKGAGVLQQKR----GFFSMRQTCPACKGRGKTVTKACGACRGNGSTVVTEKIKVKIPAGADTGSRVKLRGMGGAGARPSGDMYIDLTVRPHPTFKRDGRDVYVEVPVTVGEATIGGKISVPTLDGNVSMTLPPGTDSGKKFRLKGRGIPNIRTVRTGRGNEFVVIKIIVPKTVSAKTKEALQEVEKAYKDKKAASSK....... 366
271 0.000e+00UniRef50_UPI000830BE2C molecular chaperone DnaJ n=1 Tax=Methanofollis ethanolicus TaxID=488124 RepID=UPI000830BE2C  ali  30  1MSAGS--YYDVLGVARDAGEQEIKKAYRNLARKYHPDVCK------EPDAEEKFKDINEAYSVLSDPEKRAQYDNIGHEAFKNASKGSYTGG-----GGYGGGFQADFSGFGDIFDTFFXXXXXXXXXXXX---ADLLYRLSISLKDAVFGTDREIEVMHTESCPECDGSGSKN--KKFRVCPKCGGSGQIRQVSQSLFGQFVRMSACPDCGGRGKIPEEPCKRCKGSGHARVKRKVSVRIPPGAYSGLRLRMEGYGEAGGAPVGDLYVEIIVEESQDFVRNGENLETTVKVTPAMAAVGSKVEVKTIDGRVELKIPAGIQHGTALRIPGEGV----RHRGRPGDLLVRVKIVVPKSLSDEEKELYQKLLEIEPEKKGFFKDFVDKMR. 373
272 0.000e+00UniRef50_R7KEG7 Chaperone protein DnaJ n=48 Tax=Bacteria TaxID=2 RepID=R7KEG7_9CLOT  ali  33  2..ATKRDYYEVLGVSKSASQDEIKSAFRRLAKKYHPDISK------EENAEEKFKEVQEAYSVLSDENKRKQYDQFGHAAFQGGAAGGNPYG-----GFSSGGFGFDASDLGDIFEDLXXXXXXXRTSSRKQRGSDMLLRMNLTFEEAVFGCEKDIDVDVIDECDNCHGKGGF----DEKTCSRCHGSGTVTVEQRTILGSFVTKSTCPDCKGKGKTFAKTCSDCRGTGTVKVRKTITVHVPAGIDNGERLRLAGKGHASGGESGDLYLEFSIKEHDYFKRDGNDIYLEVPITIVEATLGCKKEIPTIYGNITVSVPAGTDSGTKQRVRGKGI---KDDRRRTGDMYIIYRVQTPKKLSRDQKKLFDSLA................... 359
273 0.000e+00UniRef50_A0A2J0HPS1 Chaperone protein DnaJ n=17 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2J0HPS1_9BACT  ali  33  3.....KNYYDILGVNKGASDDEIKKAYRKLAHQYHPDKSGGN--------EAKFKEINEAYQVLSDKSKRSQYDQFGQTFFSAQGGPASGWDFNDIFSR--SGFSNQSSGFEDIFSDIFGAGSSQSGRRRRNQSQNIQVDLEISFREMVAGVEKEIKLYKGVACRRCGGSGGDPRFGQ-ETCSQCRGTGQVKKTTRSFFGVFSQVSECPRCEGFGRIFKKKCSQCGGDGRIKEESRIRIPVPAGIEDGQTLVLEGQGEAGGAAAGDLYIIVRVEKDKKFSRQGQDILSSEKIPFSIATLGGKVEVETLAEKLILKIPSGTQSGEVFRLKNSGI--YSSSKRVRGNQLIKIIVEIPKRVS.............................. 364
274 0.000e+00UniRef50_Q9RUG2 Chaperone protein DnaJ n=42 Tax=Deinococci TaxID=188787 RepID=DNAJ_DEIRA  ali  30  2......DYYELLGVSRTASADEIKSAYRKLALKLHPDRNK------EEGAAEKFAQVSEAYSVLSDTEKRAHYDRFGSAPGGMGGMGGVGFDPMDIFEQLFGGAAGMGGRGRRGPARG----------------DDLETEVRITLEQARAGEEVEVTVDRLTECEHCHGTRTEPGGKPPVTCSTCNGSGAVRGQARTIFGVVETQQVCPTCKGDGKMVVDPCTVCHGRGRTLKSEPVKVKLPKGIDEGYRIRVAGQGNEGPGGNGDLYVHIEMEPHPELHRQDENLIFPARIGFATAALGGRIQVPTLDGPQEVEVKPGTQHGELHRLRGQGMPRLQGAGT--GDLIVDYEIVVPKHLNAEAKDALQAYARAVGDEEGLFGKIGKLF.. 373
275 0.000e+00UniRef50_A0A2D5UB23 Chaperone protein DnaJ n=1 Tax=Nitrospinae bacterium TaxID=2026769 RepID=A0A2D5UB23_9BACT  ali  34  3.VNGKRDYYEILGVDNGAGDADIKKAYRHLAMKYHPDRNSGD-----PEAEEMFKEASEAYQVLSDAEKRTRYDRFGHEGLSGMGS-QGFSNFDDIFSSF-----------GDIFTDFFXXXXXXXXXXXPQRGRDMAYQMEMTLEEAALGVERELGFERTSQCAYCGGTGAKSADS-IRQCSACKGSGQVAFRQ----GFITYSTTCSTCGGAGSGIAEHCLECQGEGRRTENRKVKIKIPPGIDEGGRLRLREEGEGGLKPAGDLFVMVSLLPHDYFHRDGSDVLTQLSVTFPQAALGAVFEVRTLYGSSRLKVPRGVQGGDLLRLSGEGFPVP--GRRGKGDHMVQIIVETPKKLSSKQEKLFRELDSLEGPKKSGWDG....... 365
276 0.000e+00UniRef50_A0A0D3CJ61 Uncharacterized protein n=31 Tax=Mesangiospermae TaxID=1437183 RepID=A0A0D3CJ61_BRAOL  ali  29  46..AAGKDHYKTLNVGRNATLKEIKSAYRALARKYHPDMNKN------PGAEDKFKQISAAYEVLSDEEKRSAYDRFGEAGLDANFNASQGVDPFDLYSAFFGGGSDGFFGMGDSGGMGFDFMNKRSLD------LDIRYDMRLSFEESVFGVKREIDVSYLATCDGCGGTGAKS-SKDVKQCSNCGGKGRVMDTQRTPFGIMSQVSNCSKCGGDGRIITDKCRMCNGNGRLRSSKKMDLVVPPGVSDRATMRMRGEGDKRSGRAGDLFIVLQVAEKRGIRREGLNLYSKITIDFTDAILGTVTKVETVEGTMDLRIPPGTQPGDTVKLYRKGVPDTDR-PSVRGDHCFEVKVLIPKNLSERERKLVEEFSSESREKPSLWQKMKSFIR. 443
277 0.000e+00UniRef50_A0A2N1J9T9 Uncharacterized protein n=1 Tax=Malassezia vespertilionis TaxID=2020962 RepID=A0A2N1J9T9_9BASI  ali  27  181.....KDPYGTLGVSRDASTKDIKHAYYQLAKKYHPDTSK------EPSAKERFVSIQNAYDILSDEKKRATFDQFGSA--DGPAPGSGGYNPFAGGSSPFSGFSGFGGNAESIFESGFGGRAAQPGFTPDARGDDIDATVNLTFEEAAKGTSKNVVINPIEICGTCHGDGLKQ-NAKRTTCQVCHGTGTRTFVIQ---GGFQMASTCPACHGQGTVVADECASCHGSGRVRKKRTVNVRIPAGVDDGYRIRQDGAGDSGEGSPGALYVRIHVAPSRIWRRQGNNLFYPAHIPFYTAVLGGKVRVPTLDGEVDVRVPAGTQVGEEMVLRGRGIPRLRRGSDTNGDLMVQFDVTIPRSLSKRQKELLQAFANEYEGK............. 565
278 0.000e+00UniRef50_A0A2I0NE05 Chaperone protein DnaJ n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A2I0NE05_9SPIR  ali  33  2....KKDYYELLGVGRSANEQEIKKAYRTQAMKYHPDRNPGN-----KESEEKFKEVSEAYEVLSDAKKRKMYDQFGHAAFQQGGGAPGGGGGGRGYNFNFTDIFEDFEDIFDGMFGGRGGSRRKSSGPRVQKGRDLLVELVISLEDAFAGITKTIKVNRNEECGTCHGKGTEK-ENDVVTCPKCNGRGETVVNQ----GLFTIRQTCSRCGGAGVVIQNPCKTCGGKGTVQKNREIKINIPAGVESGTRLKMTGEGEAGGGPRGDLYVDTHVQPHSLFERRGADLYTKARIPFAVMTLGGEISVQNIDGTVKLKIPEGTDSGQIFKAKGLGMPSV-GYFARKGELYVIVDVEVP.................................. 347
279 0.000e+00UniRef50_A0A2G0V6T6 Chaperone protein DnaJ n=1 Tax=Candidatus Tremblaya phenacola TaxID=1010676 RepID=A0A2G0V6T6_9PROT  ali  31  2...SERDYYEVLGLDRKSSDEEIKKSYRKLAMKYHPDRNADSS------SEACFKEVKRAYEVLSDRRKRALYDQYGHSLGEQSAAG-----------DMGHGFGGFTGTVEDIFADFFGGSSSNRRKKRVNRGTDVFAKAELSLEEAIRGHEVKVHLSRHILCNACNGAGTKAGT-KPKTCTSCAGLGVNHISQ----GFFSIQQPCTSCHGVGTVITNPCVSCKGSGRIKERKRLSVKIPSGIESGMKVRVSGHGDVSSGIYGDLFVEVNVKQHQLYERNGSDLHCHVPIKFTVAALGGDISIPTLLGSVTFNIPEGTQNNRIFRVKDKGAKSIRSNMN--GSLYVHVLIEVPIKLSEYQRSILMEFLKHSPMQKSWLEKLK..... 367
280 0.000e+00UniRef50_A0A0B3B2S8 Molecular chaperone DnaJ n=1 Tax=Archaeon GW2011_AR21 TaxID=1579379 RepID=A0A0B3B2S8_ARCG8  ali  31  3...EKRDYYETLGLGRNATPEQVKQAYKELAKKYHPDINK------EPGAEEKFKEVLEAYTILSDSQKRSAYDNYGFESPE-----FAGFDIND-FIRRGGAHFDFSDLFGDLGFDPFEQSFKVERKQASQRGADLKTELEIELEEAATGTEKTIEIAKTEKCSECEGTGSRD--KELSKCSACNGRGMVERTQRTVFGIFSTRTTCPKCQGSGIAIKNPCRKCNGSGQMRVKKRISVKIPAGIDSGNHLRLKGEGNTGGGMHGDLYVVVLVKPHKIFKRGASDLFLEMPISFTEAALGSELEVPTISGKKMLKVPAGTQTDTIFKLKGLGVKEINSSRI--GDLYVKAIVKTPASLSKKQKELFEELSRLDGEREGFFSGFKRKF.. 375
281 0.000e+00UniRef50_UPI000DAC4E26 molecular chaperone DnaJ n=1 Tax=Bradymonas sediminis TaxID=1548548 RepID=UPI000DAC4E26  ali  31  4......DYYQMLGVARDATHAQIKRAYRALALQCHPDRN-----CECPEAETRFKQAAEAYEVLSDRTRRALYDQYGRAGVKMKGPSPA--DINDIFSEF-----------GDIFGDIFGFGSCSGQSKSGARGEDLRFDLSLSFEEAAFGTSKVIEIPRREECDACEGSGAEPGTTSV-ICPSCKGLGQIQHRQ----GLFTLSSSCAACEGSGERVHEACAACTGAGFIADVREVTVKIPAGVGTDTKLRLRGEGKAGFGPAGDLFVVLHVEPSAHFERQGANLVYQAEISFIDAALGCQIEVPTLDEPVTVTFPPGTQYGDRQTLKNLGIAQIGS--DRRGDLIISARLKTPDTLNDKQRRLLEEFVKAGSEHAG........... 352
282 0.000e+00UniRef50_I0GJ82 Chaperone protein DnaJ n=1 Tax=Caldisericum exile (strain DSM 21853 / NBRC 104410 / AZM16c01) TaxID=511051 RepID=I0GJ82_CALEA  ali  32  2...ANKDYYEILGVSRNASQEEIKKKYRELVMKYHPDLHKDD-----PEAAKKMAEINEAYEVLSDPEKRAQYDKFGTVGPNVGGFERGYGPSYDFSGDIFSDIGEILRDFGFG-----GFGFGTGARERVERGEDIEVEVTIPFKDAVLGTEKEIPIRKKETCPVCKGTGAEPGT-GYTICPTCNGTGFATKRQRTPFGEFVVQTTCPTCHGTGKIIKEKCHNCGGTGVVEKLSKVTVTIPAGIEDGTVIRIRGEGNAHGGIVGDLYVRVKVEKDPRFIKEGNKIYYVAHISVPEAVLGTEIKVPLIEGEEVVKIPPGTQHGTEIKLRRKGVRRPY-------DYVIKIVIDIPTTLTSEEAFYYEKLKEIYETKNR........... 362
283 0.000e+00UniRef50_A0A1G2MAD9 Chaperone protein DnaJ n=9 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1G2MAD9_9BACT  ali  32  3.....KNYYELLGIQKTASKDDIKKAFRTMAHKYHPDKKGGD--------EAKFKEVNEAYSVLSDDKKRAEYDAYGRVFSGGGGGGFEGFDFSDFASGKGFGQGGVEFDLGDIFSDFFGGRSPGGRQ---ARGRDISIDVELSFAESVFGTDRRILLSKTSLCEVCKGSGAKAGTA-METCKTCNGKGKIHEARRSIFGSVQTTRVCPECQGQGKVPKEKCPHCHGAGVTKRQEEIAVRIPAGIEDGEVIRLGGAGEAKGGSPGDLYVKVHAARHPHFRKEGNNLLMDFSIKLSSALLGDEYKIETLDGPITVKIPEGIHHGEILRVKGKGVPIERG---RRGDLMIKIAIDLPSKLSREAKKLVEEMKK.................. 363
284 0.000e+00UniRef50_A0A0G1IBX6 Chaperone protein DnaJ n=18 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1IBX6_9BACT  ali  30  3......DYYEILGVARNATKDEIKKAYRKLAHKHHPDKTKGDD--------KKFKELNEAYEILYDDKKRAEYDTYGKTFAGGAGGYGQGSGDFDFGDFASRGGQGFEFDFGDIFENFFTGGQGG-RRAKAKRGADIAVDLSISFEDSIFGTERKILLSKISYCSVCKGSGAEP-NSEMEKCPACQGAGRVHESRRSIFGAVSSFRECAKCSGKGTIPVKKCSACSGHGVSKKSEEITVKVPPGIRDGEAISLPGMGEAAGGTAGDLYVKFTVGKHPVFRRDGLNLIMDLDVKMSEALLGVEKDIATLDGLIKLKVPAGISSGEILAVRGKGVPQGHGGARGRGDLLIKTMIRTPRKISKKAKELIDELKKE................. 361
285 0.000e+00UniRef50_A0A0G0JP21 Chaperone protein DnaJ n=22 Tax=root TaxID=1 RepID=A0A0G0JP21_9BACT  ali  31  5.....KDFYETLGVQKSATEQEIKRAYRKMAMKWHPDKHKGD-----KGAEEKFKEINQAYEVVSDPKKRQTYDQYGMPGYNPNSGGADGFSQGGFGGGGFDFSGFSGEGFSDIFETFFGGGSRRGRSKGPRRGSDIEATISITFEEAAFGTEKELEITKIGKCDVCNGNGAEPGT-PIITCDECNGAGEVRTVRNTILGQIATSKACDKCQGEGKTPKSPCKKCNGAGRMRVVEHVKIRIPAGVDNGTTIKLSEKGEAGGGNFGDLYVTMRVSQSKKFAREGFDINTEKKIGIAQAVLGSEVDIETLYGLIKLKIPAGTQSGKVFRLKEYGVKKLNDN--ERGDHFVTVIVDVPNKLSKRERELYNELAKETGGDKGWF......... 387
286 0.000e+00UniRef50_A0A1F4NTW5 Chaperone protein DnaJ n=2 Tax=candidate division Kazan-3B-28 TaxID=1798534 RepID=A0A1F4NTW5_9BACT  ali  36  4.....KDYYKILGVSRGASPDEIKQAYRRLALRYHPDKTKGD-----KEGEQKFKEVNEAYRVLSDPARRKQYDQFGQTFEGAAGGGFAGFRPEDFAR--FTQDFGDLGGFEDLFDAFFGGMRGGRRRSAEQRGRDIEINLQITFDEAAFGTTKRISVPRAVACEYCKGTGASDGE--LVSCDKCGGRGEIRVSQRTILGTFAQVQLCNVCKGTGKKPARPCRHCRGEGRHSLTEKVEVKIPAGVGSGQTIKLSGGGEAGGSRAGDLYVVIQVLESPDFKRKGADLYRQETLSYPVAVLGGEIKVKALEGVLKLKVPSGTKSGEVFRLAGKGLPRLDRSGN--GDLFIEVEIDVPRRLTLKQKR......................... 355
287 0.000e+00UniRef50_Q5SLW9 Chaperone protein DnaJ 1 n=38 Tax=Thermaceae TaxID=188786 RepID=DNAJ1_THET8  ali  31  2.....KDYYAILGVSREASQEEIKKAYRRLALKYHPDRNPGD-----KEAEERFKEINEAYAVLSDPKKRAAYDRGHLEAPE--------YRPEDLFDLFFQEVFGV------------------RGHRRPPRGEDLEAEVEVELQDLLHGAEKEVRYTRLVPCEACGGEGGR-----RTPCPTCRGQGVVESYRQSFFGTVVTRTACPHCKGRGYLLAETCPACRGRGRVPREERVRVQVPPGMDEGHLLRVPGYGNLGPGGPGDLYLRIRVRPHPHLERQGPDLVYRLRLGLAQAALGARVEVPGLEGPIPLDIPPGTGHGEVFALEGGGLPLPGGRGRGT--LRVVVELAVPKKLSPKAQKLLRAYAEEVGEEEGFWERLKGFFR. 349
288 0.000e+00UniRef50_A0A1F5AGF9 Chaperone protein DnaJ n=1 Tax=Candidatus Aminicenantes bacterium RBG_13_59_9 TaxID=1797268 RepID=A0A1F5AGF9_9BACT  ali  28  3.....KDYYATLGLDRKAGLSDIKKAYRKLARKFHPDLNPGD-----KAAEAKFKEIQEAYSVLSDPKKKAQFDQFGFTGEFPPGAGPRGYQQEGGF-QGFNFSGQGTSSFDDLFQNIFGGG-VRRSRLESERGEDQNYTMKVGFEDALHGLQTKIKLNRLVDCADCRGRGMKN-QAGERPCPVCRGTGQATQQV----GTMRFAATCPACGGSGFSQGTPCGSCAGRGARAGSETITVRIPAGVDAGSRVRIPGKGHAGGGPAGDLFITIEVEPHPLFRREGADLFVKVPISVPEAALGADIEVPTLDGRATIKLPPGTRSGQKFRLKGRGVSRPGSRDS--GDEFVEVTIVPPSVSNPRVRELMKELAKLAGPGPR........... 363
289 0.000e+00UniRef50_A0A0C9W1W7 Unplaced genomic scaffold SPHSTscaffold_36, whole genome shotgun sequence n=11 Tax=Agaricomycotina TaxID=5302 RepID=A0A0C9W1W7_9H  ali  28  75.SSTPKNPYEVLGVKKDSSPAEIKKAYYQLAKQYHPDTNK------EKGAHERFVEIQSAYDLLSDKEKRAQYDRFGAAGFSDAFAGGGGGFGFSDFANAFGGGGVGGGAANDVFEALFGTSSKRGRGRTAERGDDIAVSLDVSFLDACKGTRKQVTITPIINCNSCSGSGLKSG-AKRSTCSSCQGTGTRTFVIQSG---FQMASTCPTCQGSGTTVPSACGSCSGIGKVKTRKTETIDIPAGIEDGMAVRLPRAGDAGAGNPGDLLVRINVAPSKVFRRQGVNIYHDARIPMHTAILGGKARVPTLDGELDVRVPPGAQQGEECILRGRGISS--AVDGSKGDMFVSFTIQMPRSLSSRQRQLIQEYADDVDGKSS........... 456
290 0.000e+00UniRef50_P31689 DnaJ homolog subfamily A member 1 n=530 Tax=Opisthokonta TaxID=33154 RepID=DNJA1_HUMAN  ali  28  1MVKETT-YYDVLGVKPNATQEELKKAYRKLALKYHPDKNPNEG--------EKFKQISQAYEVLSDAKKRELYDKGGEQAIKEGGAGGGFGSPMDIFDMFFGGGG---------------------RMQRERRGKNVVHQLSVTLEDLYNGATRKLALQKNVICDKCEGRGGKKGA--VECCPNCRGTGMQIRIHQIGPGMVQQQSVCMECQGHGERIKDRCKSCNGRKIVREKKILEVHIDKGMKDGQKITFHGEGDQEPGEPGDIIIVLDQKDHAVFTRRGEDLFMCMDIQLVEALCGFQKPISTLDNRIVITSHPGVKHGDIKCVLNEGMPIYRRPY-EKGRLIIEFKVNFPENLSPDKLSLLEKLLPERKEVE............ 353
291 0.000e+00UniRef50_A0A2H0L5S9 Chaperone protein DnaJ n=1 Tax=Candidatus Peregrinibacteria bacterium CG11_big_fil_rev_8_21_14_0_20_41_10 TaxID=1974792 RepID=A0A  ali  28  2......NPYELLGVEKSASPDEIKKAYRKMAQKYHPDRNPDN-----PESEKKFKEVSAAYEVLSDPQKRQQYDTFGST--AGNGGGGFGGAGGFDFSQY-----SSGEGFADIFESF-FGGGGGRQKQRTNNGRDMEVQIEVEFLDAAFGSNQKIGYQRQAKCKTCTGSGAEPG-SKVVNCSRCSGTGQIKEQRHTILGQVMTTRACNECEGRGQRPEKVCHTCHGQGRNSVREDLTIKIPKGVSHGATMRLSGKGDAGNGSDGDLYISIRVKSHPRFKREGDDVYSDLKIHVLQAVLGDEVEVETIHGKKVLKLNAGTTEHKVYRLKGEGVPHMEDAGQ--GDHYFRIQIQMPDKLTKKEKDLYIQLADESPQKKGIF......... 366
292 0.000e+00UniRef50_A0A2R6W6G4 Uncharacterized protein n=2 Tax=Marchantia polymorpha TaxID=3197 RepID=A0A2R6W6G4_MARPO  ali  30  92...SKRDFYEVLGVSRGASGPEIKKAYYALAKKYHPDMNKGDDK-----AEEKFQEIQHAYEVLKDDEKRSVYDQVGPEAYDAADGGGRGP------SGFEGFDGFGGFDVNEVLNSFFGVQQDGRRST-------VKVDLDLSFKEAVLGCTKEVSFQTRARCRPCNGTGI-PAGAKVRACQGCGGAGKIRYKQ----GWIALESTCEMCGGTGKFTKEKCSSCRGSGTVKAGKQVVVTVPPGVENGMSLKIQGEGGAGPARSGDLYVQLRVAEDPIFRREGADIHLNTSISFTQAILGGEVQVPTLTGDVSLKVRPGTQPNQKLVLRGKGIKMLNSKH--YGDQYVHFTVVIPVNLSLEQRRLIEEFAREESGESDKVD........ 446
293 0.000e+00UniRef50_A0A2H0PM35 Chaperone protein DnaJ n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_45_16 TaxID=1973974 RepID=A0A2H0PM35_9  ali  34  2..ATKRDYYEVLGLERTADEVVIKKAYRKLALEYHPDRNQG------EEAAEKFREAQEAYDILSDNEKRSLYDQFGHAGLKGRFSTSGFGQGEDIFE-----------GFQTIFEDFFGGGRRQRQSQRGR---DLRYRMKIGFWEAVQGVKKTIEIERAQSCSICEGSGCEKGY-KAETCPTCDGRGQVAVRQ----GFFSIAQTCPHCEGEGRIIKKPCKTCKGRGLEQKTSELEVNIPAGVDTGIRLRLQNEGEAAPGGLGDLYVEIEVESDPNFERDGADLYTRVYIPFSTAVMGGTIDVPSLQGNKSIKISKHLKTPHVEILKNEGVQDLRS--DRRGNLYVELQIHTPEELSERGQEILKELEQELISEAS--DKTKN.... 357
294 0.000e+00UniRef50_A0A1G1X203 Chaperone protein DnaJ n=5 Tax=unclassified Bacteria TaxID=2323 RepID=A0A1G1X203_9BACT  ali  31  1MPA---DYYETLGVSRSATQDEIKKAYRKLAHKHHPDKGGGD--------EEKFKEINNAYEVLRDAKKRSQYDQYGHGFGSGPGPAGGHGGFGGFDSGGFTINMDDLGGMGDIFESVFGGSNRGRSARRSRG-SDIESNIEISFRESATGVTKTVQQRVYDTCSKCHGNGAEPGT-PITTCTTCNGAGSTAQNFQTPLGTFAQRVACQACRGEGKIAKTPCTTCHGEGREKMNRTLDISIPAGIADGQTIRVTGKGEAKGGTAGDLYVNVHVQTDRNLARDRDNVRSQVAISFIDAALGAEKLVEMLSGAKTIRIPAGTQPNAEFRFEREGFPHLQS--SGKGDHIVTVKVEIPKKLSKKQRELLEQFREA-PKKKGIF......... 367
295 0.000e+00UniRef50_A0A2D6CZ61 Chaperone protein DnaJ n=1 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2D6CZ61_9BACT  ali  27  4.....RDLYEVLDIERGASDEEIKRAYRRMAVKYHPDKNQGDS-----QAEDAFKEVGEAYRVLADENLRARYDRYGHEGVSSQMGGGPGHDFMDLFSQVFGD-------FGDLFGMGGAGGRARRG-------NDLRYDVEVSLEEAYVGKTLSVDIPKMEPCGTCSGDGIRPGTS-PTTCAQCAGRGKVVFQQ----GFFSVQQNCPRCRGRGELITDPCIECSGEGRLQRAKKVSVTIPKGISDGDVLRVNGHGDAGGAPPGNLLVGVRVTQHDFYERKGPDLFLQWSVSMVAAALGTKARIPMLEGEEDVVVPPGTQPGHVITLRGKGMPRLQRHG--HGNLRILVMVETPTDLSPKEKELFRELAKLRGQKRGFFSDLKDLI.. 382
296 0.000e+00UniRef50_L0DDD5 Chaperone protein DnaJ n=3 Tax=Bacteria TaxID=2 RepID=L0DDD5_SINAD  ali  29  3MATTKRDYYVVLEIKREASQDEIKKAYRQLALKNHPDKNPGXXXXXXXXA------------------KRQRYDRYGHAGLEGAGVH-DFRNAEDIMSAF-----------GDIFGGGLFGDLFGQRRRGPRAGQDLLFKLEIDLVEAARGTTKPIDVNRQEYCGDCKGSGAKKGTVAVS-CNYCAGQGQVVQSR----GFFQVATTCPACGGEGMRITDPCPNCRGAGRVNAVAHLKVDVPPGVESGMWLQLRGQGEPGGAPRGNLRIQILVRKHPFFERNRNDLVCQVPINFPQAALGADIEVPTLDGPDRLHVPKGTQSGDVLRLKGRGMPDI--SGRGRGDELVEVVVETPRHLTPRQEELLRELAEIEPKRKSFFEKLRDYF.. 372
297 0.000e+00UniRef50_A0A2H9LFT4 Molecular chaperone DnaJ n=1 Tax=Candidatus Diapherotrites archaeon CG08_land_8_20_14_0_20_30_16 TaxID=1974403 RepID=A0A2H9LFT4_9  ali  29  21.....KDYYKILGLNKNASETEIKDAYIKSVKKYHPDLNPG-----SKEHEDKFKEVNEAYETLKDPQKRKQYESFGSEYAQGNYSQAGQFDFEDIFKN-FGGFGFNSDDFFD----------SGSQKQRRTRAADLQYTLQISLEDAFNGTNKKIEIPTQENCPQCKGSGY---LGNTKTCNQCGGQGQVKRVIRSPFGSMVTVTVCDKCGGKGKSYDKKCDVCRGQGIVKGKKTLDVKIPRGVSPGTILRLQNEGFQDGKYKGDLYLKILFESHPKFSLEHYDLYSKEHTDLITAILGGEIKVDTLEGKANLKVPQGTQSHTVLRMKGMGMPELNS--SKRGDQYVKVIIDTPTNLTKDQIEALRIIFGKDKDVPKFLKKMRNLF.. 393
298 0.000e+00UniRef50_UPI0003FEBF1E molecular chaperone DnaJ n=1 Tax=Anaerobiospirillum succiniciproducens TaxID=13335 RepID=UPI0003FEBF1E  ali  29  2..ATKRDYYEVLGVKKGATDDEIKRSFKRLAMKYHPDRNK------EADAGEKFREINEAYQVLSDPAKRQAYDAGGFSAVDGSRAXXXXXXXXXXXXXXXPEFADIFSSIFGEGGFGGMGGQRQRRQSGPSRGRDLRIVVNLTLEEAVQGLTKEIKIETLTTCPDCNGEGTKDPKSR-KACPYCHGSGVTVSQQ----GPFAIQRTCEHCKGEGYVVTDPCKRCHGEGRIKMPHTVKINIPGGLDTGQHVVVSGAGESGGGPNGDLLAVIQVAEHKLFKRDGDNLYCEVPISFTTAALGGKVTVPTLDGKLAITVEPGTQTGTTFRLAGKGIKATYSN-RPRGHLYCTVVVETPVNLNDYQKDLLHKLEQSRPKSEDFMDNMKSFFK. 401
299 0.000e+00UniRef50_A0A2M7UQE5 Chaperone protein DnaJ n=1 Tax=Candidatus Peregrinibacteria bacterium CG_4_10_14_0_2_um_filter_38_24 TaxID=1974774 RepID=A0A2M7UQ  ali  29  89...AEKNLYEILGVPKAATDAEIKSAYRKSALKYHPDKHKGD-----KDSEQKFKEINVAYEVLSDKQKRQQYDTFGSTNPRGGFGGGGGGQAGFDFNGMNFDFGGSAGGFADIFESFFGGRSKRSRKSGPIRGSDIEANIRISFEDAVFGCEKELEITKSDVCKQCNGKGAEPGSS-IVTCTACGGTGEIKSVRNTILGQMATSNICDECNGEGRRPEKVCSVCHGTTRVRVKDRVKIKIPAGVDNGSTLKLAGKGEGGNGPSGDLYILLVVEQSRKFIRDGLDIHSETEIHLLQAVLGGEITVDTIHGEKTIKIPAGTGDSKVFKISGAGIKKENGQS---GDHYTKIKVKIPDKLSKKERELYLSLADEAG............... 458
300 0.000e+00UniRef50_A0A0S8A240 Chaperone protein DnaJ n=3 Tax=root TaxID=1 RepID=A0A0S8A240_9GAMM  ali  29  2....EKDYYELLGVPRDADTKKIKDAYHRLAMKYHPDRNP------SPDAAEKFKEISKAYAILSDPKKRANYDAGGFEGVK-------HYSQEDLFRDLGSIFGDMGLGAGSIFDRFF-----HEQPRGPVRGQDLYINVQVPLEVIAKGGKEKIRYSRPVACSTCHGHGTKSGKAPA-VCPSCQGSGRKVITRDQSGGRYQQLVTCPDCNGRGTVAEAPCEVCRGSGRQEKFEALNINIPAGIDDGTVLRVPNHGDQPGGANGDLHVHVYSAPDKRFQRRGADLWRIEYISVEDAVLGSEIKVPTLDGRVKVKIPPGTQPDEVLRLRNKGLPKFRG--SGYGDLHLRIQVQIPDNLTGKERELYEALRALHKAK............. 362
301 0.000e+00UniRef50_C4T7Z2 DnaJ-like protein n=67 Tax=Eukaryota TaxID=2759 RepID=C4T7Z2_TOBAC  ali  31  77.ATSMKDFYEVLGVNRNATASEIKKAYYGLAKRLHPDMNKDD-----PDAEKKFQEVQKAYEVLKDDKAREQYDQLGHDAFNSMNNGGGGGAGFDPFRSPFEDMFRNADIFGNIFNRDMG-------------GEDVKVPIELSFMEAVQGCTKTITFQTDLPCTACGGTGVPPGT-RPETCKRCKGSGVSISQT----GPFTLQTTCPACKGTGKIVSSFCKSCKGNRVLRGPKTVKVDIMPGVDTDETLKVYGSGDPEGNRPGDLYVVIKVREDPVFRREGSDIHVDAVLSVTQAILGGTIQIPTLTGDVVVKVRAGTQPGQKVVLKKKGIKGRNSF--SFGDQFVHFNVSIPTNLTPRQRQLIEEFAKEEQGE............. 431
302 0.000e+00UniRef50_A0A2D6RLX9 Molecular chaperone DnaJ n=2 Tax=cellular organisms TaxID=131567 RepID=A0A2D6RLX9_9ARCH  ali  31  3......DYYDTLGVKKGCSKEEIKKAYKTLAKKYHPDLNKDN-----PQAEQKFKEINEAYSALSDENKRANYDRFGSTGEQFSGYNQRGFEGFD---------------MGDIFNSFFGGGT-----TRKQRGRNLKAELELTFNEAVFGTKKEIKITKYDQCKECNGKGGKDTIS----CPDCGGSGRIKKSYRTPFGTFAQTATCQNCQGSGESVKHICKDCQGTGKIRATKKVKVKVPKGVDDGTTLRISNEGEYGEAGFGDLYVELFVQPHEIFERKDDDIFLELPISFSQAALGDQIKVPTIREKVKMKIPPGTQSGTIMRLKGEGVENVNGYGN--GDQHVKIQVVTPKKINKTQKDLLKRLAKENKEKKGFFEKL...... 352
303 0.000e+00UniRef50_A0A2H0BRS2 Chaperone protein DnaJ n=1 Tax=Candidatus Uhrbacteria bacterium CG22_combo_CG10-13_8_21_14_all_47_17 TaxID=1975041 RepID=A0A2H0BR  ali  30  8.....KDYYATLGVSKEASEDEIKKAYRRLAHKHHPDKGGD---------AAKFKDASEAYEVLSDKQKRETYDRFGSAAFEQGAPGAXXXXXXXXXXXXXXXXXNDFGDLGDVLGEMFGFGGTRSRRERRG--RDLEVAVELSFKDAAFGTKQEIRLYKQDVCSHCKGTGGEP-DAKMNTCSECQGRGQVTQAQRTMFGTFQSAVTCPSCHGRGKKPDKVCTRCQGNAVERKEETLAVEIPPGMETGSVLKVPGKGEAGGGVQGDLYVKVRVKPDSFFNREGHNVHSQVTIPFSILALGGDIKVPTLDGDETLKVASGTPAGTHITIKGKGIPYLRSKG--RGDHVVQVDADVPKKLSKEQKTLLEKLHD.................. 365
304 0.000e+00UniRef50_A0A2V7WPT6 Molecular chaperone DnaJ n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7WPT6_9BACT  ali  32  2..ATRRDYYEVLGVSRGADAGELKSAYRRLALQYHPDRNPDD-----PAASEKFKEASEAYAVLSDSERRQRYDRFGHSGLGSAGGGFGGFDP------------STFADFTDLFGELFGFSG---PRERPMAGSDLVYRMEITLKDAAFGIDAPIVVSRLERCSDCDGSGAEVGTS-PTTCPACRGRGRQRVSQ----GFLVVTRPCPNCGGEGKIIEKPCRTCRGEGRKRGQRKLEIRIPAGVETGSRLRLAGEGDAGPGPSGDLYVVLTILPHEIFAREGDDLVLALNLPFPTVALGGEVSVPTFDGEHKVAIPAGTQPGNE--VKLRGRGLGRLGKSGRGDLVVRVGVSVPEKPTAKEKELLREYARLIGSGSRVIDSAKKIF.. 366
305 0.000e+00UniRef50_D3FAG4 Chaperone protein DnaJ n=13 Tax=Bacteria TaxID=2 RepID=D3FAG4_CONWI  ali  31  1MAATKPDLYKILGVGKNATDEEIKKSYRKLARQYHPDTNQGDAR-----AEERFKEVSAAYDVLSDPEKRKAYDR-GTGPFAAGGGTTGGFDPN----------AFGGGSFRDIFSDLFXXXXRTGTRPRAQRGRDLETEVSLTFQEAIDGTQASLAVPTSTRCETCHGSGARPGTA-PTVCPVCHGRGVESQGQ----GLFSISTPCSRCSGTGTIIEDPCPTCGGSGARRTIKRLKVNIPAGVRDGSRVRIAGKGEVGGGEPGDLFVVTRVADSPVFKHLGDRVEVEVPLTVPEALLGATVEVPTLRGSKKLRVAPGTKHGTVQRLRGEGAPRL--GGRGRGDIHYRFVIDVPRDLTSDQRRAVDELAKTMNGNPR........... 366
306 0.000e+00UniRef50_O60884 DnaJ homolog subfamily A member 2 n=170 Tax=Bilateria TaxID=33213 RepID=DNJA2_HUMAN  ali  27  4.VADTK-LYDILGVPPGASENELKKAYRKLAKEYHPDKNPN--------AGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMD--DIFSHIFGGGLFGFMG------------NQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGA--VQKCSACRGRGVRIMIRQLAPGMVQQQSVCSDCNGEGEVIKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRIVVKYPPGIEPGCVRVVRGEGMPQYRNPF-EKGDLYIKFDVQFPENINPDKLSELEDLLPSRPEVPNII......... 365
307 0.000e+00UniRef50_A0A2E9U609 Chaperone protein DnaJ n=5 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E9U609_9BACT  ali  28  30.....RDFYQILGVERTASKDEIKRAYRKAALRYHPDRNPDDAA-----AEESFKEAAEAYSVLGDQEKRSNYDRFGEAGLRGGQGFNA-----DIFADFSDIVGDLFGFGGAF------GGMGRSQRSSPGQGTSLRIQLDIDLSEAISGVEKQISVRRHVACEACGQSGSESGTA-PTVCGHCGGSGAVQQRH----GFLAIAHPCAACSGTGRTVSDPCGICRGEGRVEDNSELSVRVPAGIDTGSRLLLRGEGSAGGAVPGDLEVLIAVSEHPVFARRGKDLFTRVAVSFPMAALGGTVDVPTLDEEATLPIPAGVQGGEVFEIRGRGMPPVNGGR--RGSLRVAVQVVTPSRLSSEQRALLEQLHKITEEPESWWDHL...... 393
308 0.000e+00UniRef50_Q8EUM4 Chaperone protein DnaJ n=3 Tax=Mycoplasma TaxID=2093 RepID=DNAJ_MYCPE  ali  41  2..SSKRDYYEVLGVSKDATDDQIKSAFRKKAMQYHPDRNK------EPDAEEKFKEVNQAYEVLSDPDKRANYDRFGHEGVDGQFGGGAGFDPFDIFNQFFFEQSFGGSGFEDIFSNFFGGGRRGASSQ--QREANLVVSIVLTFVESVVGVKKTIEYKIEKDCESCHGSGADNSEGSISTCSNCNGSGVEITQKRTIMGIIQSQNICSRCNGEGKEIHKKCNSCKGRKVHEERVEIDVEIPGGVSNDEHLKVSGKGSVVGGKTGDLYINIQIKPSKIFSRKGNDIYVILKVDPILAIVGGEANIPTPFGIKSIKMKPGTRNGEIITVPSHGVKSTKRFGSN-GDLFAVVEYTSAKRFSSAELKSLSKFAQETNDE............. 375
309 0.000e+00UniRef50_B1XQF6 Chaperone protein DnaJ n=23 Tax=cellular organisms TaxID=131567 RepID=DNAJ_SYNP2  ali  30  4......DFYEILGVSRDCGKDELKRAYRRLARQYHPDVNKD------PGAEEKFKEINRAYEVLSEPETRARYDRFGEAGVSGAGAAGADYGDMGGFADIFETIFSGFGGMGTGATGGGRRRSGPMRGDDLRLDLKLD------FKEAIFGGEKEIRIPHLETCKTCSGSGAKAGTSA-NTCGTCNGTGQVRRATRTPFGSFAQVSVCPTCNGEGQVIAEKCESCGGAGRKQETKKLKITIPAGVDSGTRLRVSREGDAGGGPPGDLYVYLAVNADKEFRRDGTNILSEIEISYLQAILGDTVKVKTVDGTEDLTIPAGLQPNKVLILEGKGVPKL-GNPVSRGDHLITVKVMIPTKVSREEKELLHQLAKLKGTEKGGFEGL...... 370
310 0.000e+00UniRef50_A0A2N9LQ77 Chaperone protein DnaJ n=7 Tax=Acidobacteria TaxID=57723 RepID=A0A2N9LQ77_9BACT  ali  30  1MSPPKHEYYETLGVARKASTDDIRKAYRKLARKYHPDLNPGD-----KSSEERFKNVQEAYDILSDPKKRQMYDQFGFYSENQTSHPGMDFSGFD-FSDFMAGSGAGGGGFRDIFSQFFGGRGEAQQQP-AEKGGDLEYVMHIDFWQAIKGTQARLEITRYEVCDTCHGSGTSGGGE--VTCPQCKGSGNVSQ----MAGAMKFNLTCPRCGGAGKL-RNSCPTCGGEGRMPRTESVDVRIPPGARSGSRLRVPGKGNAGGAPPGDLYITTQVEEHPFFKREGDNIEIQVPIAVWEAALGAKIEVPTIDGRTLLKIPQGTRNGQRFRLREKGV--MNSRTNVRGDQIVEVGIEAPDPRDERTRELLRELSKVQPEDPNIWEKV...... 396
311 0.000e+00UniRef50_A0A1M5RKA6 Chaperone protein DnaJ n=13 Tax=Bacteria TaxID=2 RepID=A0A1M5RKA6_9FIRM  ali  33  2.....KDFYEILGVKRDASFEEIKRSYKKLAKKYHPDLNPDN-----KDAEKSFKEINVAYEILSDEQKRKTYDLYGEDGVNGNYQ-----------DSGFGGFGDIFGDIFDMFGGGFRDSDSTRNSKSPTKGQDIRYDINLDFREAVFGVEKDINIRRQEDCSVCHGTGAEPGTDK-HTCDKCHGSGQVKVQSNSAFGRFVRVVTCDKCNGTGEILDDPCHKCHGSGKEVNNKKINVKIPAGVDDNTIISMKGEGHSGGGPNGDLYIYLSVKEDSVFKRTGNDLHLEIPISYVDAVLGGEIKVPTLTSLVDFEIPKGTQGGTTFKLKNEGVSFVK--KEGKGDLYFTVDIIVPKKV............................... 337
312 0.000e+00UniRef50_A0A2P6V138 Flagellar outer dynein arm heavy chain beta n=1 Tax=Micractinium conductrix TaxID=554055 RepID=A0A2P6V138_9CHLO  ali  28  76.VRAERDFYQILGVARDADKKTIKSSYRQLARKFHPDVNK------EADAEQRFKDISAAYEVLSDDEKRGMYDRFGEAGLKGGFXXXDFSNPFDIFET---XXXXXXXXXXXXXXXXXXXXXXSRMRNRPVAGDDQRYDLRLDFTEAVFGCQKEIEVSRLEECKTCSGSGVKAGST-PTTCDTCKGQGQVTQVTRTPLGMFQQVGICPTCGGSGEQ-STPCGTCQGDGRVRGTKRISLRVPPGVDEGSRLRVRGEGDAGRGEPGDLYVFIGVKAHPELRREGVTIHSDVEISYIDAILGTTVKVTTLGNTVDLKIPAGTQPGTTLVMSKRGVPKL-GIANARGDHLVHVKVKIPKTIGGEERKLMEQLREL................. 452
313 0.000e+00UniRef50_Q54XR6 Uncharacterized protein n=5 Tax=Dictyostelids TaxID=33083 RepID=Q54XR6_DICDI  ali  30  70..SEKRDLYEVLGVSRDASKQDIKKAFYALAKKYHPDTNRDD-----PNAHKTFAEISNAYDVLYDDKKRSVYDTAGHQGATQENMEHQNVNLEDLFGGGFD------------LNDLXXXXXXXXXXXXXXVGADMEVNLHLDFMEAVNGAEKDISFYGGTKCTPCDGSGAKPGT-KPQTCKQCGGTGSQTRS----NGFFHMATNCRACKGTGKVIKEPCSSCKGKGITQGERTVNIKVPAGINNGTTIKLAGEGEPSKGRRGNLFVHITVSEHELFRRQGNDIHLDVPITISQAILGDTVSIPTLSGEVELKVPKGTQPNEKRVLKGKGVRFVNST--EFGSQFVHFIVSIPKNINQKQQELIKEFDQEEKKNNGPLDSL...... 436
314 0.000e+00UniRef50_A0A2E1N1C9 Chaperone protein DnaJ n=13 Tax=Bacteroidetes TaxID=976 RepID=A0A2E1N1C9_9FLAO  ali  32  2....KEDYYKVLGVSKSASASEIKKAYRKMAIKYHPDKNPGN-----KAAEERFKEAAEAYDVLSNPEKKSKYDQFGHQAFQNGGAGFGGMXMDDIFSQFGDXXXXXXXXXX---------XXXXXQGRRVLKGSNLRVKVSLTLDEICNGVEKKIKVKRKVL---------APGVS-FSTCPDCGGSGQVTRVQNTILGRMQTSTTCSRCSGTGQIVDNKPNGADSNGMISKEETVMIPIPAGVVDEMQLKVSGKGNEGNGINGDLLVIISELPHKTLQREGDNLHHELYVSMPDAILGSTKEIETVSGKVRIKIESGMQSGKILRLRGKGVPNINGYGS--GDLLVHVNVWTPKTLDKKQRQFFESMKKPEKSEKSFFDRVKDMF.. 367
315 0.000e+00UniRef50_A0A162A0Y0 Uncharacterized protein n=11 Tax=Pentapetalae TaxID=1437201 RepID=A0A162A0Y0_DAUCA  ali  29  70.AVSARDYYSVLNLKSNATLPEIKAAYRRLARKFHPDMNKG------PGAEDKFKEISAAYEVLSDNERRSLYDRYGEAGLRGDYDGANGSDPFEVFGTFFGDPNGAFGGRDESGGMNFNLSYNG------RQGLDISHDLYLSFEESIYGAEIETEVSCYEMCENCGGTGAK-YSSSMKSCTNCGGRGGVVKTQKTPFGIMSQVSTCSKCEGNGNMITDPCQNCGGRGKIQTKRTIKVVIPPGITDGVTMQLRGEGNVKRGVVGDLLLVLHVNKKKGISRDGLHLYSNVNVDYTEAILGTIVKVETVDGLRDLQIPSGVQFGDTVKLPHMGVPDIN-KPSKRGDHHFIVKVQIPKHISVEERTLVEKLASIKASSTKYSSSFPENFRS 451
316 0.000e+00UniRef50_A0A1F9LCQ6 Chaperone protein DnaJ n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9LCQ6_9DELT  ali  32  3....RRDYYEILGVGRNASDKDIKSSYRRLAMEFHPDRNP------SPEAEEKFKEASEAYEVLSDANKRAIYDRAGHDGLRNGFSGFSGVGVDDIFSSF-----------GDIFGDLFGFSGGRTRRGGPARGSDLRYDMTIDFKAAVFGLEKDVELDQLLRCEDCHGSGAEPG-SQVVRCATCQGRGQVMH----GSGLFLISTTCPECQGQGMRQSSPCKHCRGDGRAVGKRSVSVKIPAGFEDGMSLRYAGQGEPGPRGGGDLYIAVRIRPHKTLKREGEHLITEVKIDMVQAALGDTLTVEGVDGDEEVKIPAGCQPNEVVILRKKGVPHLRG--SGRGDLHVICRVEIPKSLSSTQKDLLLEFAGRSNSD............. 354
317 0.000e+00UniRef50_A0A1F2WKB3 Chaperone protein DnaJ n=3 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A1F2WKB3_9ACTN  ali  27  5.....KDYYKALGVDKKASEKEIKDTYRKLARKYHPDVNPGN-----KEAEEKFKEISEAYEVLSHSDKRKEYDPFGYEGFGSRPGQGGRVEYGDL---------GDLGNIFDLFGGLGGAGAGAGRQRQPRKGADLETDVNISFEDALNGVSIPLTISGRNVCPACGGSGAKPGT-IPKTCPACQGRGSISQSQ----GPFAISRPCPSCAGRGTVIEEPCPSCRGAGAVEMPRTINVKIPAGVKDNATIKFAGRGEAGGGAPGDLYIRVHVAPHEYFKRKDSNILLDLPLTFPEAAMGTEIQVPTINGKVKLKVPAGTSGGRKFRLRGKGAPKPKGKG--HGDMIVTACITVPKKVSGKEKELIKQLREIEKENPRAF......... 375
318 0.000e+00UniRef50_A0A256A7J8 Chaperone protein DnaJ n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A256A7J8_9FLAO  ali  28  2....KKDFYEILGVPRNADEATIKKAYRKKAIEFHPDKNPGN-----KEAEEQFKLAAEAYEVLSDPQKRAKYDQYGHQAFEGGGFGGGNMNMDDIFSQF-------GDIFGSXXXXXXXXXXXXXXXXRRVKGSNLRIKVRLTLEEIANGVEKKIKVKRKVQ---------APGV-RYKTCGTCNGQGQVMRVTNTILGRMQSASTCPTCGGAGQILENRPANADAQGMIVNDETVSIKIPAGVVDGMQLKVSNKGNPGNGIPGDLLVAIEEVEHETLKREGENLHLDLYISFAEAALGVSKDIEAVNGKVRIKLEEGIQSGKILRLKGKGVPNINGYGN--GDLLVHVNVWTPKTLTKEQRIFFEKALTPEKSEKSFFEKVKDMF.. 369
319 0.000e+00UniRef50_A0A1F4DX24 Chaperone protein DnaJ n=2 Tax=Bacteria TaxID=2 RepID=A0A1F4DX24_9PROT  ali  31  1MATAQRDYYDVLGVARDADGKAIKDAFRKLALQYHPDRNK------EPGAGERFREIAAAYAVLSDPKKRAEYDAHGFAGV-------AGFSPQDLFGGIFDDIFGGFSFGGGLFDTFFG-----RRAAGPPRGENIEVELEVPLERVLRGGEEKLRYERPAGCPTCHGSGAKPGTEPRK-CDKCGGTGRQVKSQREKGVMLQQVSTCPACAGRGTFIDQRCPECKGSGQVVREETLTVKIPAGIEEGTALRVAGHGDRPGGIPGDLFVVVRSAADPRFERMGSELWRMESIGVADAVLGTALKVPTLDDPVTVTVPPGTQPDTVLRLRGKGLPDF--GGRRRGDLFVRIKVHVPERPSAEERKLYERLRAL................. 359
320 0.000e+00UniRef50_A0A0G1FEU4 Chaperone protein DnaJ n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1FEU4_9BACT  ali  31  3......DYYQTLGVSKTATQDEIKKAYRKLAHQHHPDKAGGD--------EAKFKEISQAYSVLGNEEKKKQYDQLGHAVFSQSGGNSAGFNWNDFGSGHFQDFTVNFDDIGDVFGDFFGFGRGGRGGARTSKGSDMRMMLDLHFMEAVFGVDKTVVVERHESCSRCHGTSLEPGTE-LRTCYRCAGNGKITANQQTFLGTFQTIQSCPDCRGNGRVAEHPCSVCKGRGIEKKRAEIKVSIPAGIDDGETVRLSGQGEAGGADHGDLYITVRVKKHTLFVREGTTIRSEVVARFTTAVLGGKIDIPTLDGTAVLKIPAGTPSGKVFRLKEKGVPDVHG--RGRGDHLVTFHVEVPTKISKKARKLLDDLKAE................. 364
321 0.000e+00UniRef50_A0EHM5 Uncharacterized protein n=4 Tax=Paramecium tetraurelia TaxID=5888 RepID=A0EHM5_PARTE  ali  32  21..SSKKDLYELLGVPKNASQNDIKNAYYGLAKKYHPDANP------SKDAKEKFAEINNAYETLSDENKRKVYDQAG---------------AQDPFAAYRGKAQDFQFD-ESIFGDFASFFNMGGESERQIKGADIFIQLEISFMDSVNGAQQTIQFEKIGVCSTCNGTKCKPGTAPGR-CTNCGGRGSINYRQ----GAMTIQMACTKCRGTGVSIKNPCTTCKGAGIQKQATSEAVNIPKGIADGQNLRVTGKGNENGGKAGDLIIKVQVKPDSYYKRDGYDLITNAYISVAQAVLGDQVKIKTLNGEQQISIKPGSQDGEKIRLSGLGITKLAPNSNQRGDQVVNLKIQIPTNLNEQQRKLFEELAKLEKSEEGVFEKVKNIF.. 388
322 0.000e+00UniRef50_A0A2H5WKA3 Chaperone protein DnaJ n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5WKA3_9BACT  ali  29  5.....KDYYAILGVPRNATEKEIKAAYRKLARQYHPDVNPGD-----KEAEEKFKEINEAYQVLSDPEKRAAYDRYGEQWQAYQRMREQYGEGFQP-EGGFGGMPFGFESFADFIEQLLRGGGGFRATGFHAPPRDIEQTIEIDLQDAIHGATRTLQLNLEEVCPRCGGLG--ELRDHQQTCPACGGRGRKRF---SLLG---VEMPCDECEGTGRV-SALCPTCGGSGVVRRTRTITVKIPPGVAEGQRLRLAGEGLPGNGQRGDLYLRIKIKPDARFERKGNDLYVDVDVDYLTAILGGEVSVPTPNGTVTMKVPPGTQSGTRFRLAGKGIPL---GQGKRGDLYARARIVVPRSLTPRERELLEQLRQLRQQE............. 358
323 0.000e+00UniRef50_A0A2M7FEI2 Chaperone protein DnaJ n=3 Tax=root TaxID=1 RepID=A0A2M7FEI2_9BACT  ali  32  3.....KDYYQILGISKDASVDDIKKAYRKLAMQHHPDQGGD---------AEKFKEINEAYQVLGDAQKRQQYDQFGSAGPXXXXXXXXXXX---------XSNMGGFSDLGDIFESFFGGGFSQQSQPGPVRGEDEEAVLTVDFMTAVFGGEEQVEIVLLDQCATCKGDGAAPG-AKIVTCSTCSGTGQVRRNQRSIFGNVTTASVCHECHGKGKIPEKYCPDCAGHGRVKKSTKLKVKIPAGIDTGTTLKLQGKGHAGGGPHGDLYVRMNVRASRKFERHGYDIHTSLDIQIPQAVLGDEVEIETVHGVKKLVIPAGIESGKKIRLARSGVPKIGS--SEVGDHIVTVRVLIPKKLSRKEQELFMELASEAKKKKGLFS........ 367
324 0.000e+00UniRef50_K0P5N2 Chaperone protein DnaJ n=2 Tax=Candidatus Cardinium TaxID=273135 RepID=K0P5N2_9BACT  ali  32  2....EKDYYNILGVERNATAEDIKKAYRKIAMQYHPDKNPGN-----KAAEEKFKAATEAYDVLSNPEKKHQYDQFGTSGYQGGSRSYDDDIFEGDLNDLFQD---------SPFGSFFN--SGRRTRRTANRGEDLRIRIKLNLEEVALGTEKKIKVKRYTSCAACGGNGAENGLS-VEKCVPCKGQGVVRKTTQTMLGNMLTEAICSHCTGTGSRIKTYCSDCQGEGRKFIEDLITFKVPKGVKKDMELTLRGKGNARGGTSGSLIVQIDEEENDLLKRKGNNICYTLHVSFIDVTLGCEMEVPTIYGKVRLKIPPGTSSSEVFKLKGKGITDINGYG-KKGDQLVFIQVWIPQELTKEEKEMLLSLQKPNKKEESFFDRIKSFFQ. 376
325 0.000e+00UniRef50_A0A1W9S3E9 Chaperone protein DnaJ n=1 Tax=candidate division Zixibacteria bacterium 4484_95 TaxID=1970781 RepID=A0A1W9S3E9_9BACT  ali  30  3......DYYKILGVSEDATTDEIKKTYRKLAKRYHPDANPND-----KQAETRFKEISEAYNVLSDPKKKQQYDTMRKFGAGYGAGGAAGFSFDDIMSMFGGSRFTGFGSFADIFSSIFSGDFKTGMADAPRKGDDILADIEIPFEDAVNGGKKTIKINIEQPCDRCHGSGVTPG-SKATVCPECKGRGTVTFSH----GSFAVSRPCPRCLGRGQITGNPCRKCSGRGKIFGPKVVKINIPSGIESGKKIRLKGLGNPGGGPPGDLYLKIIVSGHQYFWREGKDIYCRVPISLRQAILGGKIKVRTLTKQVELKIPPGTSSGQRFRLKGLGL----SVNGVRGDQYVEVKVEVPKNLTEQQKQLFEKFAD.................. 375
326 0.000e+00UniRef50_A0A2G4H255 Chaperone protein DnaJ n=6 Tax=Verrucomicrobia TaxID=74201 RepID=A0A2G4H255_9BACT  ali  31  1MADE---YYTLLGVAKSASADELKKAYRKKAMEFHPDRNPGN-----KEAEEKFKKVSRAYEILSDDGKRKLYDQHGEAAFDPNGGGFRGADPRDIFEQXXXXXXXXXXX----------XXXXXXSETQDDAGEDLRVDLKITLEEAAEGVERKIPYRKHVACTKCAGSGAEPG-SKKSRCPTCGGQGQVVRS----NGFFQMRQVCPSCGGQGERIDKPCKPCSGEGRTVADSTVSLRIPPGVDTGTKLRSSSNGSAGGASAGDLYVYIAVTDHELFERDGDDLACSVPVKFSIAALGGKIVVPKLKGKTTLNIPSGTQGGTIFRLRGEGMPPLRG--STAGDLLVRVDIDVPKKMTDKEKEALKAYAAACGDEESWQAKFKEFFR. 380
327 0.000e+00UniRef50_A0A1W9Q8Z1 Chaperone protein DnaJ n=1 Tax=Sorangiineae bacterium NIC37A_2 TaxID=1970199 RepID=A0A1W9Q8Z1_9DELT  ali  30  2..SEKRDFYEVLGVARDASDDDIRRAYRKLALQFHPDRNKGD-----PSAEAKFKEATEAYTVLSDAQKRAQYDRFGHQGM-GAGFDFQGAGVGDIFSHFQDMFSXXXXXXX---------XXXXXXXXTSRRGQDTRVRATLTLAESMTGTKKEVQIRGAAPCEACEGSGARAGT-KPTTCGTCQGSGQVATQR----GFIMFSTTCPACRGQGRVISDPCPECRGERYVEKRRKVLVSFPAGIDGGQRLRVPGQGMPGGAEPGDLYVDVELEPHPEFERDGFDIGTRRRVSFPDAALGGELTVRLPDDEIVVKYPAGTQPGTVLTTRGKGIPQLNG--RGRGDVHVLVEVEVPEKLSRKARKLIEELREELN............... 354
328 0.000e+00UniRef50_A0A1F7G120 Chaperone protein DnaJ n=1 Tax=Candidatus Riflebacteria bacterium RBG_13_59_9 TaxID=1817875 RepID=A0A1F7G120_9BACT  ali  29  1MAQ-MKDLYEVLGIERGSTEKEIKTAYRRLARRYHPDVNPGN-----PEAEQRFKEIQAAYSLLSDKEKRRQYDTYGSSYFSPGVGPXXGMEWEEFVRSFADRGGFGTGPSSDLFEDLIGRPGTTQTRTRPRRGQDVYQSVTVGFLDAANGTNITLGLSREVTCDRCNGSGAEPG-SQLHDCPTCNGTGQLARSAS----FFRQVSACPQCQGQGRVPATGCMRCRGSGTTVKTERVNVRIPPGVDTGSKVRVPGKGGPGRGPYGDLLLNITVRPHPYFQRKDCNVLVEVPITFEEAVLGAEIEVPTLSKRVRMKIPPGTDSDKEFRLRGKGFPQL--SKAGCGDLLVRVRIVTPERVSLRSRELIREFSKEYPANPRL.......... 375
329 0.000e+00UniRef50_B0VH26 Chaperone protein DnaJ n=32 Tax=Bacteria TaxID=2 RepID=B0VH26_CLOAI  ali  32  2...AKRDYYEILGVDRNADEATIKKAYRKLAMQYHPDKNPNXXXXXXXX------------------EKRQIYDQYGHSGLENQFGGTGFSWEEFMHRSDLNDIFG--DGLGSIFETIFGGGFGGRNQRSSNRGEDLQIELSLSLQEIANGVEKTIKIGIKEPCDKCGGSGSAEG--KTETCPNCKGTGQIRQIRQSLFGRMQTVSECPTCNGEGRIIKNKCSKCYGEGRVGTVKEIPINIPPGVEDGQYIRFRGQGNAGGGSRGDLLVLIHQKKDDLFEREGNNIILEYPITVSQAVLGDEIIVPTLTGSVKMKVPPGTQSGRLFRLKGQGIQGHNSY--SRGDQIVRTIVVIPTKLSREEVELLREFKRDLKPGKSFAAKLKSYF.. 384
330 0.000e+00UniRef50_A0A2E5ZH75 Chaperone protein DnaJ n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A2E5ZH75_9ACTN  ali  28  2...AERDHYAVLGVSRDALPDEIKKAYRRLARQHHPDANHGADAV---GAEVEFKAVAAAYEVLSDPERRARYDRFGHDA-SGGGAGDPFGGFGDIFET-------------FFGGSPFGGGGGGRRRAGPTPGEDLETTLEVDFTSAAFGSEEEVSVRTAVACVDCEATGAAPGSGGPEACGGCGGTGQVQRVRQSMLGQMVTATACPTCSGRGQVVPDPCRACRGEGRVVEDRSFTVTVRAGVYEGTTLRLTGRGGPRGGPAGDLYVRVRVRPHPVFERHGPDLLHRLEVPMTQAALGVVLDYETLDGTEELQIPRGTRTGEVFRFRGRGVPHLEG--RGRGDLVIEVVVVTPDDLTDEAERLLRELADERDEDESLISRIRSAFK. 374
331 0.000e+00UniRef50_A0A256XYS2 Molecular chaperone DnaJ n=1 Tax=Candidatus Woesearchaeota archaeon ex4484_78 TaxID=2012531 RepID=A0A256XYS2_9ARCH  ali  33  3.....KDYYKILGVSKNATKEEIKRAYKKLAKKYHPDVNKDS------NAAEKFKEISEAAAVLTDDQKRAQYDQFGSTGPAGRGFDFSGFDFREFASGF---GFDFGDLFEDIFSGF--GFGSRKRKARPRRGQDLITKIKISLEEAYKGTTITLPVQKSETCKACKGKGYE----HFETCKKCGGRGVIQSTRRTPFGIFSTTTTCNECQGTGEIGKNPCKKCHGEGVVFVKKDLEVKVPAGIYSGMKLRLEGEAGEHGGRSGDLYVIVEVKKDKRFTREGNDLHTELPISFATACLGGEVMIDTFEGKEKLRIKPGTQDHAEIIIKGKGMPELNG--RGKGNIIAHISIIIPKKLSKKQAELLREFEGKKKGKGKFL......... 362
332 0.000e+00UniRef50_A0A1F9R542 Chaperone protein DnaJ n=17 Tax=Bacteria TaxID=2 RepID=A0A1F9R542_9BACT  ali  29  4......DYYSLLGLTRNATAAEIKAAYRKLAMKHHPDRNPGN-----KDAEEKFRKINSAYEALSDDKKRKLYDQY----GEAGVNAGAAGGPGGAGFEGFGQGVDVNEVFGDLFENFFGGRGGGGRH-RAAQGSDLKYEAEVTLEDAFRGTQLPLNFSRAEACGTCRGTGAKPGT-GAKRCQQCRGQGRVQFSQ----GFFSMSQTCQSCAGEGQVIENPCKDCRGQGRIRRDAEIKVKIPPGIYDGATLRISGEGEAHGGQSGDLYVHVKVKPDPRFERHEDDLSLTAGVDVATAALGGTADVPTLEGEVKVKIPAGVQGGATFRVREKGMPKLHG--RGRGDLLVHIRVDVPRELNARQRELFEDLRKAFPGDPGVFGRL...... 372
333 0.000e+00UniRef50_A0A2N3F664 Chaperone protein DnaJ n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A2N3F664_9ACTN  ali  27  1MPAGTSDYYQTLGVERTATADEIKKAFRRKARELHPDVNK------AADAEDRFKEINEAYDALSDPAKRQQYDTYGSVGGRAPGGGGGYGGGYVDLNDLFGGGGAGGFDMGDLFSAFFGGVSGGGRGVRLE-GRDMAMSLTVTLEEAATGAEKEIVLDHLAPCDVCDGTGAAEGSS-VATCPDCNGSGQRVQVRRTFIGQMQTVGPCERCSSTGHIVEQPCEECQGSGRVPDRQHVNVNVPAGISDGQQIRLRGMGEAGGATPGDLLVAIRIAPHDFIHREGNELHCKANVSISQAALGAELSVCGLLEDNKVHIPSGTQHGDTVRLKGR-GMPRMGGGGSRGDLIVHVGVQVPKKLSKRQKELLRELGDELGDEKSTLEKLKDWLR. 385
334 0.000e+00UniRef50_A0A2E8I0U1 Chaperone protein DnaJ n=1 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2E8I0U1_9PROT  ali  31  6...EKRDYYEVLSVDRAASAAELKKAYRKQALKFHPDRNQND-----PQAENSFKEAAEAYEVLSDDRKRQXXDTYGHAGLNSQAGGAGFQDVNDIFSSF-----------GSIXEDFXGFSGGARGGRRSARGADLRYXLVLEFEEAVFGVXKXIEFXRETICNPCNGSGAKPGTEK-KKCGDCHGHGXVRRN----XGFFSVSMVCPSXRGQGSVIAVPXGPCRGSGKSHEKKKVSVKVPPGVDSGVRLRVTGEGQVGPGGAGDLFVFLEIXESKXFHRDGADIIVSXPISMTQAALGAXVKVKTXDGXKDVXVLPGTQYGHREIXSGEGVPRLRGMG--RGDFYIEYQVXVPKKLNKDQRVXLEKLAEXSDHDGGFFNRI...... 369
335 0.000e+00UniRef50_A0A1V5XKN0 Chaperone protein DnaJ n=21 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5XKN0_9DELT  ali  31  4....KRDYYEVLGVGREAGPDDIRKAYKQAALKYHPDRNPGD-----KSAEEKFKEATEAFGVLSDADKRHRYDQYGHAGLEGMGGM--DFSGVDIFSHF-----------QDLFSDXXXXXXXXXXXSGPSRGADLRVEQQLSLREAVLGCKREISVRAPVACEVCEGSGAQPG-SRRETCSTCRGTGQVSNAR----GFVMFTTTCPTCHGQGSTISKPCEACHGAGQVEKTRKVLVTFPAGIDSGQRLRVPRQGAAGGGSPGDLYVDVDVLPDERFERDGVDLLTRVRVSFAEAALGTTVKLDLLDDELTIDVAAGTQPGDVLTRRGKGVPRLDGAG--RGALHVLVQVEVPKKVSAKAKSLLRELEKELAQSS............ 356
336 0.000e+00UniRef50_F2NEH0 Chaperone protein DnaJ n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=F2NEH0_DESAR  ali  30  5.....EDYYQVLGIDREADQEEIKRAYRRLALQYHPDRNPGD-----KRAEERFKVAAEAYEVLRDPQKRGLYNQFGRAGLNGMQFGG------------FDNIDSIFANFGDIFDEFFGFHRRPRPQPQSQPGKDLLYQLEIDFKDAVFGLETSIEVDRLSACSQCQGLGIKPGSRQW-TCPVCQGYGAVSRVE----GWLRINTTCPHCSGSGVIEGDPCPDCQGQGLQKQKRKVHLKIPPGVDEGTRLRLRGEGEAGRRPSGDLYLDLKITPHPLFERHGHDITHRAKLSFIEAALGTEIDVPTLTGSSRITVPAGTQTGTRFIIYGEGVPILRGNG--RGNLIVELELQTPTDLTPKQEELLRKFLTARQGKK............ 354
337 0.000e+00UniRef50_A0A261Y2A0 Uncharacterized protein n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261Y2A0_9FUNG  ali  31  403.....RDYYKILDVSRNASSREIKKAYKALSKKYHPDKNPGD-----KEAEQKFVELAEAYEVLNDEEKRRIYDQYGEEGLKQGGGQQGFHNPFDIFAQF--------------------FGGGGHFGHQERKGKDLQLALEVTLEDLYSGTTIEIDVSKQVICDHCRGTGAEDPD-DIETCPTCQGRGVKVIRHQLAPGMIQQQTTCDACGGKGKVIKHQCSVCKGKKVRRGNEQLTLVVEKGMSDGHHVIFERESDEHPDVPGDIIFTLTTLPHERFVREGNNLYTKETITLIEALTGFTKTIPQLDNSTITLYREVTQPGFVQRIPGAGMPHHQ-YSSDKGDLFVEYSVVLPETIPDGLIDAIRQF.................... 744
338 0.000e+00UniRef50_A0A2H0TG40 Chaperone protein DnaJ n=27 Tax=Parcubacteria group TaxID=1794811 RepID=A0A2H0TG40_9BACT  ali  30  2.....KDYYNILGISKTASKEEIKKAYRKLAHEHHPDKNSGTD--------AKFKEINEAYQVLSNEKKRAEYDRYGRVFSDGQQSQGQAGQWGSY--DFGFSGAEPFGDISDIFEDFLGFGGGRSRRTRTKRGRDISIDIDLTFEEAIFGTKRKILLRKNVECVECKGSGNAPG-SKIKKCETCDGSGTVRSQRTTFFGTFSTSVECSKCRGYGQTAEKQCKNCAGSGITRKEEEVSIGIPPGIESGEVLSLVGQGEAQGGVSGDLYIKIRVRPHEVFVREGKNIVMLLEIPLTDALLGGEKVINVLDGEIKIKIPAGVDFGEVLRVRGRGVPIESG---GRGDLLIRIKVRNPKNLSRKARKLIDELKEE................. 355
339 0.000e+00UniRef50_UPI000B9328F8 uncharacterized protein LOC111008684 isoform X1 n=3 Tax=Momordica charantia TaxID=3673 RepID=UPI000B9328F8  ali  29  82..SAATDHYSTLNVSRNATLQEIKNSYKKLARKYHPDVNKN------PGSEERFKEISAAYEVLSDDEKRSLYDQFGEAGLWGEYGGSPRVDPFENFDAFFGGSDGLFGERDGI-----GGINLINKRSGRNQNLDIHYDLHLSLEESVFGAEQEIQFSNFETCENCDGTGAKS-SNCIGTCANCHGRGGVVKTQRTPFGMMSQVSTCSKCGGDGKIITELCRSCGGSGQLQSIRKMKIVIPPGVTDGATMQIQREGDKKRRMTGNLYIMLHVDEKHGIWRDGIHLYSKISIDYTDAILGSIVKVETVEGLKDLQIPAGVQPGDRVRLSCMGVPDINKPY-VRGDHLFIVNVQIPKHISNSERAIIKELASLKASSKN........... 450
340 0.000e+00UniRef50_A0A1F3SN95 Chaperone protein DnaJ n=1 Tax=Bdellovibrionales bacterium GWA2_49_15 TaxID=1797384 RepID=A0A1F3SN95_9PROT  ali  31  2..AAKRDYYEVLGVSRQADAAKIKDAFRELAMRFHPDRNK------VPGAEERFKEIAEAYAVLSDPDKKQKYDTQGFEGV-------SDFRPDDLFGGINFDEVFGVPLFENFFD---------RHRFHRKKGDDLEVVIEVPLAKIMAGGTEKIKVQRREPCESCHGSGAAAGT-QPKICDLCQGSGQIVTGHTKKNMMFQQISICSQCHGRGEVVERPCVQCSGPGFVTKEKELEVTIPPGVEDGMVLKIAGQGREAPGGPGDLLVIVQTKKDEHFQRSGSDLFYSASIPVWDAVLGSKIQIPTLDDDVIVKIPSGTQSQTSLRVKGKGLPRFQRTG--FGDLYVIVEVRIPEQLKAREKELFEELRALNNEKTSWFSRLKN.... 368
341 0.000e+00UniRef50_A0A2A4STH1 Chaperone protein DnaJ n=2 Tax=unclassified Candidatus Peregrinibacteria TaxID=1801912 RepID=A0A2A4STH1_9BACT  ali  31  3......DYYGDLGISKGATEAEIXKAYRKMAQKHHPDVNAGN-----KTSEEKFKKASEAYEVLSDTTKKSRYDQFGQTANGQXXXXXXXXXXXXXXXNDFGGSDFMEDFMSSFFGGGGGGGRSRASRQRNTRGNDLETHIQITFEQSIHGVNKEIQVTKAEACDPCSGQGG----SGKTTCNTCHGSGQVAKAQRTPLGVIQMRQECPDCHGAGKRFANICSICHGEGRTRKNSKIKVKIPAGVYDGANIRLSGQGDAGGGTPGDLYILISVSPSKDFIRKNNDIYSDQHIHILQAIFGDEIEIKTAHNPVKLKIPSGTQSEQVFRIKDHGAPVLQGHG--KGMHYVKIIVDTPKKLSNKEGELYKQLADESGEKKGFFDSL...... 375
342 0.000e+00UniRef50_A0A1G2FG66 Chaperone protein DnaJ n=5 Tax=Bacteria TaxID=2 RepID=A0A1G2FG66_9BACT  ali  29  3....TKNYYEILGVPKNASEIEIKKAYRQLALKYHPDKAPESHKKEYEEKFKE---ISQVYRVLSDKEKRAQYDRFGEKYEEAPFGRGFSEQDFRSFYDVFGGRDIFEDGFSHIFEEIFGFGPTTKTRKVQEYGDDIHLDLEINLEDAFYGIQKEIELKKMIACDKCRGQGGES----FKKCPACQGAGYEQVRTQSFLGILLRQKVCSKCRGRGEWPEKICPACRGEGRTREIKTIKITAPAGIDNEQTLKLSEQGQAGGGEAGDLFITIHIKPHKYFKRQEDDLYYNLSINFTQAALGDKIEIPAIDDPLKLKIPAGLQPGETIRLKGKGIPRL--YGRDRGDMLVRVQVAVPKKLSREQRKLIEELAKEEKS.............. 367
343 0.000e+00UniRef50_A0A060HJC0 Chaperone protein DnaJ n=7 Tax=Archaea TaxID=2157 RepID=A0A060HJC0_9ARCH  ali  28  1MSK-RRDYYEVLGVPKAASKDDIKNAYRKLALQYHPDRNKD------AGAEERFKEISEAYAVLSDDEKRKRYDTYGHVGADEA-FRGSEANFEEVFRDM------GFGGFRDIFEQFFGRGGGFGFGPGRRKGRDLVYDMELSLEDVLRGKKEEVEVPRLDRCSECGGSGAAPGT-KARRCTVCDGRGQVQRVYQNRFFTSVTVEPCRTCQGRGQIIERPCNVCKGSGKMQKMKKLKIEIPPGVEDGMAMQLRGEGEASSGIPGDFVVRLHVKPHQQFEREDGHLLYRLDVKYTDLALGTEVRVPTLDGTEKLKIPQGTQPEGLLRLKGKGLPRY--GASGKGDMVVKLNVKVPTKLSDRQKSLLKELDRALDD.............. 370
344 0.000e+00UniRef50_A0A292IIC0 Chaperone protein DnaJ n=1 Tax=Mycoplasma amphoriforme A39 TaxID=572419 RepID=A0A292IIC0_9MOLU  ali  45  1MPS-KRDYYEILGISKNADQSEIKRAFRKMAMKYHPDRNKD------PNAEELFKEVNEAYEVLNDEEKRKLYDRYGHEGLNASGFHQEGFNPFDIFNSVFGEGFSGFGGFGDVFSSFFGGGASRRASHHEQVEINLLVDLNLSFLESAKGCVRDVTYVRQKTCKICKGTGAGTSPNAIKICGTCHGEGVVVQTKRIPFGTFQTQGICGTCRGEGKTIREKCNNCHGQKMISEEVVHKVQVEPGLFDQDVIVVKGEGHTYMNQVGDLYVRVNIADSRIFERNHNDVIVKALIDPLEAIVGGTVQVATLNGMRQIEVKPGTRNGEQIILSGEGIKTSNQSRNRTGDLIVIITYSSPNHYSKHELKKLQEFVKPNDEVNAYIK........ 386
345 0.000e+00UniRef50_A0A1Y0H1G2 Chaperone protein DnaJ n=2 Tax=unclassified Armatimonadetes TaxID=1042316 RepID=A0A1Y0H1G2_9BACT  ali  29  2...ATPDPYAALGVSRDASPEEIKSAYRKLARQYHPDVNPNN-----PEAEEKFKELSTAYAILSDPEKKAQYDRFGSVDDQGGFQG----NPSDFFQ--------GGAGFGDLFEAFFGGGGPQRASGGRRDGDDLRAEAVVTLIEVLEGVEKKITFRRAARCETCDGMGTAD-KSKPKACETCNGMGAVTQVRQTMIGSIRTQTPCPKCRGEGIQIDNPCGTCRGEGVTPKQEELFVTIPAGIEGGQTLRVQGKGSDGGGLPGDLYVVTHVAEDKRFIREGRMLETEVEITFAQAAIGDSIEIEGLTQTLELTIEPGTQPGDTFRIKGEGLPRLGGG--NRGDLLVEAKITIPKKTSEGESKLLKEYAELRGEPANIFEKI...... 373
346 0.000e+00UniRef50_A0A1W9SBQ2 Chaperone protein DnaJ n=1 Tax=Rickettsiaceae bacterium 4572_127 TaxID=1971637 RepID=A0A1W9SBQ2_9RICK  ali  32  3......DYYQILGVSKTASADEIKKAFRKKAMQNHPDKHKGDAS-----AEKKFKEINEAYDVLKDSQKRSQYDQFGKAGMNGGQSGGGFGGQGGFGNFDFGGNAGGFSDIFENIFSEFAGQQRGGGRARKARGADLVFPVQITLEEAFAGLKKSIRYKRKSSCETCKGTGSKDKKS-PTTCTECNGSGIVRTRQ----GFFVQEHTCPSCHGSGKKIENPCSSCGGFGIKENVRELNITIPKGIETGMRIRISGEGNSAGGATGDLFIETHIEPHVNFEREGPDLFTNVRISFTTAILGGEFELKMLDGKANIKIPKGTQPNSQIRLRKKGMPVVNS--SLHGDLYLNIEVVIPKKVNDAQIKALETFEKADKKK............. 363
347 0.000e+00UniRef50_A0A1F9KAF8 Chaperone protein DnaJ n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9KAF8_9DELT  ali  30  2.....RDCYEVLGVDRDASDREIKKAYHRLAHAHHPDKNPDDTS-----AEERFKEASVAYGILSDPDKRRKYDRFGRAAFSNK--GGPGFDP------------SAFTGFGDVFSELFGDFLGRKPNSPKARGQDRVINLDIDFETAVRGGTRTIDVPRTRKCDICTGTGAAPGST-PQICHACGGSGEIRVQQ----GLLSVSKRCTYCKSKGKIVTHPCKPCDGNGYTQQESRLEVNIPPGSSSSTVLRYPGEGGRNGGSPGDLRVALAVAPHPIFQREDYDLSCEVPVTFSQAALGAQIDIPTLDGSVRMTLPSGTQSGRTFRLRGKGVPRASGGS---GDQHVTILVETPINLTEEQRAALEAL.................... 340
348 0.000e+00UniRef50_A0A2P6FAR0 Chaperone protein DnaJ n=13 Tax=cellular organisms TaxID=131567 RepID=A0A2P6FAR0_9MOLU  ali  34  3....KRDYYDVLGVERNATDEKIKRAFRQLAKKYHPDVSK------EKDAEAKFKEVNQAYEVLSDPNKRRNYDQFGHAGNDPNAFGGFGGDFEDIFS----------GGFGDIFENFFGGGARRGFSNQPIKGENVAARVTVTLKEQMFGKTIKLDLNVDKTCEACDGTGAKDLKKDIHTCTTCDGYGYVNIEQRSLFGVIQSQQPCPDCKGRGKVVASKCPKCKGQGHYRGKEVVEIELPKSIYENQQLRIREKGNYGNGPRGDIYLEITVKPNKYFKRINDNLHLDLPVSYLDALLGAEIKVPTFDGDVHLKLPANTKTNSVFSIPNHGF-FKGPASTKRGDLIVNVLVAIPTKLSVEEKTKLQELKDIS................ 367
349 0.000e+00UniRef50_A0A0G0P5X5 Chaperone protein DnaJ n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A0G0P5X5_9BACT  ali  30  3.....KDYYKTLGVNKSASQAEIKRAYRKLAQEHHPDKGNGND--------AKFKEINEAYSVVGDEAKRKQYDQFGFPGAGGRGPGGGAYNWQDY--SNVNINFEDFGGFGDIFETFFGGNRRSGATSQ-RRGADIEATISIDLIDVLNGTEKEVTLSKWISCDKCKGSGAEPGF-GIKTCPTCKGSGQISKATQTFLGTFAQNQICPECEGAGKIPEKKCTKCAGKGRIRESKKLLVKIPKGVDNGSIIKIVGEGEARGGKAGDLYLHVSIKGDSRFVRQGANLLTQISISFNKAILGTVADVPVVGGSIDLKIPAGTQPGQVIKIIGKGLPYLNT--SKIGDLLVHVNIEIPKKINSTQKKLLEDW----DSKKGWF......... 368
350 0.000e+00UniRef50_A0A0G0VDS8 Chaperone protein DnaJ n=107 Tax=root TaxID=1 RepID=A0A0G0VDS8_9BACT  ali  33  3.....KDYYKILNVDKGASKDEIKKAFRKLAHEHHPDKGGD---------EAKFKEVNEAYQVLSDETKRSQYDQFGSNFDQAGAXXXXX-------XXXXXXXXVNMDDLGDMXXXXXXXXXXXXRQRAQAQGQHIQVDLQLTFKEAIFGTEKEIQITKNSACDRCGGVGAEPGTS-MKTCDACAGSGVWERVQQTILGSIKTRTACESCHGQGEIPNTKCSTCNGSGIEYKKKSLRVEIPSGVESGMKIRVRGQGEAIGGSAGDLYVVLYVKTDPRFERIGENIYTHHKIGFTQAALGDEIEVETLDGRVKLKVPAGTQSGDKLRLRGKGVPRAR----ARGDMIVVIQIVTPRKVSRKEKKLFEEL.................... 346
351 0.000e+00UniRef50_A0A1V6BZ17 Chaperone protein DnaJ n=8 Tax=Spirochaetes TaxID=203691 RepID=A0A1V6BZ17_9SPIR  ali  33  2..ATKRDYYEVLGVEKSASLDEIKKAYRKLAMQYHPDKNPGN-----KEAENKFKEATEAYTVLADSDKRKKYDQFGFAGVEGMNLGG---NPFQGGRYGFDDVFSGFEDIXXXXXXX--XXXXXXXXRRVRRGSDRLYNLEITLEEAALGKKVDLSFDKLETCEVCR-GSGSKSGSGKKRCPECGGSGQVRRSQ----GFFSISTPCSKCNGTGDIIEDPCPTCRGAGVSSKRVLKNIKIPQGIDNGKRIIIKGEGDAGGSPPGDLHIKIRVKQHDYFYREEQNLIMIVPISFTQAALGDEISISSLDNKIKLKIPAGCENGKVLRIKGAGMPYLD-FPDKKGDLFIKVEVEIPKSLNREEKRLLEELRRIKGEERR........... 364