current user: public
If you have questions about the server, please let us know.

Query: gi|13507749|ref|NP_109698.1| hypothetical protein MPN010 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130
# Score Template Links and tools%idFirst MAYSPSLNDIKSILNKYTSKDYELKCENRYDGKLELWLKGVFEEIVKTPGTRYVTHKQLDEKLKNFVTKTEFKEFQTVVMESFAVQNQNIDAQGEQIKELQVEQKAQGKTLQLILEALQGINKRLDNLESKLast
1 -5.460[M] COG4238 Murein lipoprotein  ali follow..  18  28...................................................................................DQLSSDVQTLNAKVDQLSNDVNAMRSDVQAAKDDAARANQRLDNMATK 75
2 -5.190[S] COG3165 Uncharacterized protein conserved in bacteria  ali follow..  9  99............................QGDIQVVQNFVALADLA------EFDPAELLAPYTGDIAAEGISKAMRGGAKFLHHGIKRQQRYVAEAITE-EWRMAPGPLEVAWFAEETAAVERAVDALTKR 194
3 -5.190[R] KOG1899 LAR transmembrane tyrosine phosphatase-interacting protein liprin  ali follow..  22  103......................................................SNETYQERL-----ARLEGDKESLILQ-VSVLTDQVEAQGEKIRDLEVCLEGHQVKLNAAEEMLQQELLSRTSLETQ 173
4 -5.110[J] COG0023 Translation initiation factor 1 (eIF-1/SUI1) and related proteins  ali follow..  19  61....................................................................TKLAAELKKKCGCGGAVKEGIIEIQGDKRDLIKSLLEAKGMKVKLA................. 106
5 -5.080[J] KOG2145 Cytoplasmic tryptophanyl-tRNA synthetase  ali follow..  16  14.......................................................................................NSIATQGELVRSLKAG-NASKDEIDSAVKMLVSLKMSYKAAAGE 56
6 -5.040[N] COG1256 Flagellar hook-associated protein  ali follow..  17  57TGYGVKVTDIKRLTNAALTTQYNNQIAKQSASLYQSGALGQALNLFGTPGKNTPSDDNFFTAWAALAKNPDQATNTTALLSSMSIFTDQLNQLHSGLKELETTIAAD-QDLNSLIKKLGSINKAIGNAGS. 192
7 -4.940[V] KOG1962 B-cell receptor-associated protein and related proteins  ali follow..  15  133.....................................................ASFKQAQSATAAARSLLENKNTEKAKEAGEDTTLIELNKLRERVQELTSDLNREKKDKEAVKSQAESINREYDRLTEE 210
8 -4.850[U] KOG3202 SNARE protein TLG1/Syntaxin 6  ali follow..  15  134................................................................................QLYQQQDVMLDGVYDTIGNIRGQAALMGEELGQQADLLDTLDNSIETTNSK 184
9 -4.820[P] COG5456 Predicted integral membrane protein linked to a cation pump  ali follow..  12  47................................................VENTYVASQQFNRKAEEGRAQAALGWTGKLTIARSEVRYSLSDTTGKPVPLHGVKILFRHPA..................... 108
10 -4.770[S] COG2900 Uncharacterized protein conserved in bacteria  ali follow..  18  15.......................................................................................SRLAFQEITIEELNVTVTAHEMEMAKLRDHLRLLTEKLKASQP. 57
FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.