current user: public

If you have questions about the server, please let us know.

Query: gi|13507745|ref|NP_109694.1| thymidylate kinase MPN006 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MKQGVFVAIEGVDGAGKTVLLEAFKQRFPQSFLGFKTLFSREPGGTPLAEKIRALLLHEAMEPLTEAYLFAASRTEHVRQLIQPALQQKQLVIVDRFVWSSYAYQGLIKKVGLDVVKKLNADAVGDSMPDFTFIVDCDFETALNRMAKRGQDNLLDNTVKKQADFNTMRQYYHSLVDNKRVFLLDGQNQTGCLEQFIEQLSQCLTQPTLSLast
1 -67.400sp|P23919|KTHY_HUMAN Thymidylate kinase OS=Homo sapiens GN=DTYMK PE=1 SV=4  ali follow..  23  3ARRGALIVLEGVDRAGKSTQSRKLVEALCAA--GHRAELLRFPERSTEIGKLLSSYLQKDVEDHSVHLLFSANRWEQV-PLIKEKLSQGVTLVVDRYAFSGVAFTGAKENFSLDWCKQPD---VGLPKPDLVLFLQLQLADAAKRGAFGH-----ERYENGA-FQERALRCFHQLMKTLNWKMVDASKSIEAVHEDIRVLSEDAIRT... 201
2 -41.800sp|O00142|KITM_HUMAN Thymidine kinase 2, mitochondrial OS=Homo sapiens GN=TK2 PE=1 SV=4  ali follow..  14  47KEKKSVICVEGNIASGKTTCLEFFSNATDVEVLTEPVSKWRNVRGHNPLGLMYH---ASRWGLTLQTYVQLTMLDRHTRPQVSSVRLMERSIHSARYIFVENLYRGKMPEVDYVVLSEWFDWILRNVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLEYLEAIHHLHEEWLIKGSAAPVLVIEADHHMERMLELFEQNRDRILTP... 258
3 -38.300sp|O95299|NDUAA_HUMAN(removed signalp:1-20) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial OS=Homo sapiens GN=NDUFA10 PE=1 SV=1  ali follow..  14  35.ERSRVITVDGNICTGKGKLAKEIAEKLGFK--HFPEAGIHYPDSTTGDGKPLATDYNGNGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIFSDFVFLGFIRKQCVDHYNEVKSVTICDYPPHLVIYIDVPVPEVQRRIQKKGDPHEMKITSAYLQDIENAYKKTFLPEMSEKCEVLQYSAREAQDSKKVVEDIEYLKFDKGP 262
4 -37.300sp|Q5EBM0|CMPK2_HUMAN UMP-CMP kinase 2, mitochondrial OS=Homo sapiens GN=CMPK2 PE=1 SV=3  ali follow..  18  250.GKFQVVAIEGLDATGKTTVTQSVADSL-------KAVLLKSPPSC--IGQWRKIFDD---EPTIIRRAFYSLGNYIVASEIAKES-AKSPVIVDRYWHSTATYAIAGLQHLPPAHHPVYQWPEDLLKPDLILLLTVSPEERLQRLQGRGMEKTREELEANSVFRQKVEMSYQRMENP-GCHVVDASPSREKVLQTVLSLIQNSFSEP.. 449
5 -30.300sp|P27707|DCK_HUMAN Deoxycytidine kinase OS=Homo sapiens GN=DCK PE=1 SV=1  ali follow..  14  19.TRIKKISIEGNIAAGKSTFVNILKQLCEDWEVVPEPVTMSQKNGGNV---LQMMYEKPERWSFTFQTYACLSRIRAQLASLNGKLKDKPVLFFERSVYSDRYINETEWTIYQDWHDWMNNQFGQSLELDGIIYLQATPETCLHRIYLRGRNEEQG---IPLEYLEKLHYKHESYLQEVPILTLDVNEDFKDKYESLVEKVKEFLST... 259
6 -19.500sp|Q16854|DGUOK_HUMAN Deoxyguanosine kinase, mitochondrial OS=Homo sapiens GN=DGUOK PE=1 SV=2  ali follow..  13  36.RGPRRLSIEGNIAVGKSTFVKLLTKTYPEWHVATEPVTQKACTAQSLGNLLDMMYREPARWSYTFQTFSFLSRLKVQLEPFPEKLARKPVQIFERSVYSDRYINGSLSDIEWHIYQDWHSFLLWEFTLHGFIYLQASPQVCLKRLYQRAREEEKGIELAYLEQLHGQHEAWLEALMNIPVLVLDVNDDFSEEVTKQEDLMREVNT.... 272
7 -19.400sp|P30085|KCY_HUMAN UMP-CMP kinase OS=Homo sapiens GN=CMPK1 PE=1 SV=3  ali follow..  16  2..KPLVVFVLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDE-PDSQYGELIEKYIKEGKIVP-----------VEITISLLKREMDQTMAANAQK---NKFLIDGFPRNQ--DNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSS--GRSDDNRESLEKRIQTYLQSTKPGKVKKIDASKSVDEVFDEVVQIFDK....... 194
8 -18.300sp|P00568|KAD1_HUMAN Adenylate kinase isoenzyme 1 OS=Homo sapiens GN=AK1 PE=1 SV=3  ali follow..  15  5LKKTKIIFVVGGPGSGKGTQCEKIVQKYGYTHLSTGDLLRSESSGSARGKKLSEIMEKGQLVPLETVL-------DMLRDAMVAKVNTSKGFLIDGY----------------REVQQGEEFERRIGQPTLLLYVDAGPETMTQRLLKRGETS--GRVDDNEETIKKRLETYYKATEPGIVRKVNAEGSVDSVFSQVCTHLDAL...... 193
9 -17.900sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   11  64......IIIVGPPKSGKTTVAKKITSEYGLKHLSIGGALLNNHPETELALMLNWHLHKGMTAP-DELAI------QALELSLMESVCNTAGVVIDGY----------------VTKHQMNLLEARSIIPMVIFELSVPSKEIFKRLLLEKEQRLPYPLHNSAQIVAVNNVKYRKNIGEQNWYVIDGFHSKWWVWNEVIKNVQMVNKY... 256
10 -15.100sp|Q9Y6K8|KAD5_HUMAN Adenylate kinase isoenzyme 5 OS=Homo sapiens GN=AK5 PE=1 SV=2  ali follow..  13  379......IFIIGGPGSGKGTQCEKLVEKYGFTHLSTELLREELASESERSKLIRDIMERGDLVPSGIVL-------ELLKEAMVASLGDTRGFLIDGY----------------REVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRLPVDDTTKTIAKRLEAYYRASIPVIAKTQLHKINAEGTPEDVFLQLCTAIDSIF..... 562
11 -14.800sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   12  27LSKPVCFVVFGKPGVGKTTLARYITQAWKCIRVEALPILEEQAAETESGVMLQSMLISGQSIP-----------DELVIKLMLEKLNSPEV------CHFGYIITEIPSLSQDAMTQQIELIKNLNLKPDVIINIKCPDYDLCQRISGQRPEDYLENVENIVKLYKETLEEVMAEHNPQYLIELNGNKPAEELFMIVMDRLKYLNLKRAA 293
12 -14.500sp|P54819|KAD2_HUMAN Adenylate kinase 2, mitochondrial OS=Homo sapiens GN=AK2 PE=1 SV=2  ali follow..  14  13.PKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATDMLRAMVASGSELGKKLKATMDAGKLVS------------EMVVELIEKNLETPL-------CKNGFLLDGFPRTVRQAEMLD-DLMEKRKEKLDSVIEFSIPDSLLIRRITGR-GEPLIRRSDDNEKALKIRLQAYHTQTTPGIHSAIDASQTPDVVFASILAAFSKATCKDLV 236
13 -14.400sp|Q9HA47|UCK1_HUMAN Uridine-cytidine kinase 1 OS=Homo sapiens GN=UCK1 PE=1 SV=1  ali follow..  11  21.QRPFLIGVSGGTASGKSTVCEKIMELLGQNEVEQRVILSQDRFYKVLTAEQKAKALKGQYNFDHPDAFDNDLMHRTLKN-----IVEGKTVEVPTY------FVTHSRLPETTVVYPADVVLFEGIMFHLRLFVDTDSDVRLSRRVLRDVRRGRDLEQILTQYTTFVKPAFEEFCLPTK-VIIPRGVDNMVAINLIVQHIQDILNG... 233
14 -13.800sp|Q9C093|SPEF2_HUMAN Sperm flagellar protein 2 OS=Homo sapiens GN=SPEF2 PE=1 SV=2  ali   10  39FSAGPVSDEVLPETEGETMLSANADKTPKAEEVKSSDSFLKLTTRAQLGAKSEQLLKKGKSIP-DVLLV------DIIVNAINEIPVNQDCIL-DGFLEEALTGCNRNLTEVERKKAQKSTLAIDPATSDFVILLDVSDTSSMSRMNDILRDQIQHRIIGFLDNWPLLEQWFSE--PENILIKINAEIDKESLCEKVKEILTTEIAKK.. 285
15 -13.500sp|Q15126|PMVK_HUMAN Phosphomevalonate kinase OS=Homo sapiens GN=PMVK PE=1 SV=3  ali follow..  11  7.APRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEGFFCRKIVEGISQPIWLVSD-----------------TRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDF-------------WVIENHGVEQRLEEQLENLIEFIRSR... 191
16 -13.300sp|Q16774|KGUA_HUMAN Guanylate kinase OS=Homo sapiens GN=GUK1 PE=1 SV=2  ali follow..  13  1MSGPRPVVLSGPSGAGKSTLLKRLLQEHSGIFGFSVSHTTRNPRPGEENEVMQRDIAAGDFIEHAEF-LYGTSKVA-----VQAVQAMNRICVLD------VDLQGVRN--------------IKATDLRPIYISVQPP--SLHVLEQRLRQRNTETEESLVKRLAAAQADMESSKEPGLFDVVIINDSLDQAYAELKEALSEEIKK... 191
17 -13.200sp|Q96MA6|CI098_HUMAN Putative adenylate kinase-like protein C9orf98 OS=Homo sapiens GN=C9orf98 PE=2 SV=1  ali follow..  13  271......VLLLGPVGSGKSLQAALLAQKYRLVNVCCGQLLKEAADRTTFGELIQPFFEKEMAVPDSLLM-----------------------VLSQRLDQQDCIQKGWVLHGVPRDLDQAHLLNRLGYNPNRVFFLNVPFDSIMERLTLRNPKDAEEQVKLKMDLFYRNSADLEQLY--GSAITLNGDQDPYTVFEYIESGIINPLPKKI. 478
18 -13.200sp|Q9Y3D8|KAD6_HUMAN Adenylate kinase isoenzyme 6 OS=Homo sapiens GN=TAF9 PE=1 SV=1  ali follow..  14  6......ILLTGTPGVGKTTLGKELASKS-----GLKYI--------NVGDLAREEQLYDGYDEEYDCPI---LDEDRVVDELDNQMREGGVIVDYHGCDFFPERW------------------------HIVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLP-SNKPEELENNVDQILKWI...... 163
19 -13.000sp|Q9BZX2|UCK2_HUMAN Uridine-cytidine kinase 2 OS=Homo sapiens GN=UCK2 PE=1 SV=1  ali follow..  11  18.GEPFLIGVSGGTASGKSSVCAKIVQLLGQNEVDYRVILSQDSFYRVLTSEQKAKALKGQFNFDHPDAFDNELILKTLKE-----ITEGKTVQIPVY------FVSHSRKEETVTVYPADVVLFEGILFQMKLFVDTDADTRLSRRVLRDISERGRDLEQILSQYITVKPAFEEFCLPTK-VIIPRGADNLVAINLIVQHIQDILNG... 231
20 -12.800sp|Q9NPI5|NRK2_HUMAN Nicotinamide riboside kinase 2 OS=Homo sapiens GN=ITGB1BP3 PE=1 SV=1  ali follow..  12  3....LIVGIGGMTNGGKTTLTNSLLRALPNCCVIHQDDFFKPQDQIAVGDVLESLDMEAMLDTVQAWLSSPQKFARAHGVSVQPEASDTHILLLEGFL------------YSYKPLVDL----------SRRYFLTVPYEECKWRRSTRNYTVP----DPPGLFDGHVWPMYQKYRQEVEVVYLDGMKSREELFREVLEDIQNSLLNRSQ 196
21 -12.800sp|Q8WVC6|DCAKD_HUMAN Dephospho-CoA kinase domain-containing protein OS=Homo sapiens GN=DCAKD PE=1 SV=1  ali follow..  15  2....FLVGLTGGIASGKSSVIQVFQQLIDVDVMARHVVQPGYPAHRRIVEVFGTEVLLEN-KVLGDLIFNQPDRRQLLNAITHPEIRK-------EMMKETFKYFLRGYRYVILDIPLLFETKKLLKYMKHTVVVYCDRDTQLARLMRRNSLNRKDRINAQLPLTDKARMA----------HVLDNSGEWSVTKRQVILLHTELER.... 198
22 -12.300sp|Q5T6J7|GNTK_HUMAN Probable gluconokinase OS=Homo sapiens GN=C9orf103 PE=2 SV=1  ali follow..  12  1MAAPGALLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEEGKGIPLNDQDRIPWLCNLHDILLRDV--VVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQL-------------------LVVHLSGSFEVISGRLLKREGHFMPPEL------LQSQFETLEPPAAPENFIQISVDKNVSEIIATIMETLKM....... 186
23 -12.300sp|Q9UIJ7|KAD3_HUMAN GTP:AMP phosphotransferase, mitochondrial OS=Homo sapiens GN=AK3 PE=1 SV=4  ali follow..  13  5.ARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSDLLRDNMLRGTEIGVLAKAFIDQGKLIP------------DVMTRLALHELKNLT--------QYSWLLDGFPRTLPQA------EALDRAYQIDTVINLNVPFEVIKQRLTARREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQR.. 219
24 -12.200sp|P27144|KAD4_HUMAN Adenylate kinase isoenzyme 4, mitochondrial OS=Homo sapiens GN=AK4 PE=1 SV=1  ali follow..  13  3.SKLLRAVILGPPGSGKGTVCQRIAQNFGLQHLSSHFLRENIKASTEVGEMAKQYIEKSLLVP------------HVITRLMMSELENRR--------GQHWLLDGFPRTLGQA------EALDKICEVDLVISLNIPFETLKDRLSRRQEDDKPEAVAARLRQYKDVAKPVIELYKSRGVLHQFSGTETNKIWPYVYTLFSNKITP... 216
25 -12.200sp|Q9NWW6|NRK1_HUMAN Nicotinamide riboside kinase 1 OS=Homo sapiens GN=NRK1 PE=1 SV=1  ali follow..  13  2..KTFIIGISGVTNSGKTTLAKNLQKHLPNCSV--ESEIETDKNGFLQYDVLEALNMEKMMSAISCWM---ESARHSVVSTDQESAEEIPILIIEGFL------------FNYKPLDTI----------NRSYFLTIPYEECKRRRSTRVYQPP----DSPGYFDGHVWPMYLKYRQEWEVVYLDGTKSEEDLFLQVYEDLIQELAKQ.. 192
26 -11.200sp|Q00839|HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6  ali   12  45.KDCEVVMMIGLPGAGKTTWVT---KHAAENPGKYNILGTNT-----IMDKMMVAGFKKQMADTGKLNTLLQRAPQCLGKFIEIAARKKRNFILDQ--------TNVSAAAQRRKMCLFAGFQR------KAVVVCPKDEDYKQRTQKK------AEVEGKDLPEHAVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKK 225
27 -11.100sp|Q96EK9|KTI12_HUMAN Protein KTI12 homolog OS=Homo sapiens GN=KTI12 PE=1 SV=1  ali follow..  13  3.....LVVFCGLPYSGKSRRAEELRVALAAEGRAVYVV----------DDAAVLGAEDPAVYGDSAR---EKALRGALRASVERRLSRHDVVILD----SLNYIKGF---------YELYCLARAARTPLCLVYCVRPGGPIAGPQVAGANENPGRNVSVS................................................. 133
28 -11.000sp|Q8IV42|PSTK_HUMAN L-seryl-tRNA(Sec) kinase OS=Homo sapiens GN=PSTK PE=2 SV=2  ali follow..  13  20.....LCVLCGLPAAGKSTFARALAHRLQQEQGWAIGVVAYD--APSQWKLLRQELLKYTCLKDQDLIFSAAFEAQSCYLLTKTAVSRPLFLVLD----DNFYYQSM---------YEVYQLARKYSLGFCQLFLDCPLETCLQRNGQRPQALPPETIHLMGRKLEKPNPE------EHNSLTIPSPACASEASLEVTDLLLTALENPVK 252
29 -10.900sp|Q96M32|KAD7_HUMAN Putative adenylate kinase 7 OS=Homo sapiens GN=AK7 PE=2 SV=3  ali   13  70......ICILGPPAVGKSSIAKELANYYKLHHIQLKDVISEAIAKLEAIVAPNDVGEGEEEVEEEEEEENVEDAQELLDGIKESMEQNAGQLMKEKLKSMPCRNQGYGFPKTYDQAKDLFNQEDELIIPEFVCALDASDEFLKERVINLPESIVAGTHYSQDRFLRALSNYRDINIDDETVF............................ 271
30 -10.600sp|Q8IYQ7|THNS1_HUMAN Threonine synthase-like 1 OS=Homo sapiens GN=THNSL1 PE=1 SV=2  ali   11  58......IILMGPPGAGKTTVGRIIGQKLGCCVIDVDDDILEKTWNMSVSEKLQD---------------VGNEQFLEEEGKAVLNFSASGSVIS----------LTGSNPMHDASMWHLKK--------GIIVYLDVPLLDLICRLKLMKTDRIVNSGTSMKDLLKFRRQYYKKWYD----VFCESGASPEEVADKVLNAIKRYQDVD.. 227
31 -10.100sp|Q9BSD7|CA057_HUMAN Nucleoside-triphosphatase C1orf57 OS=Homo sapiens GN=C1orf57 PE=1 SV=1  ali follow..  12  1MARHVFLT--GPPGVGKTTLIHKASEVLKSSGVPVDGFYTEEQGGRRIGFDVVTLSGTRGPLSRVGL--FEQLALPVLRNADCSSGPGQRVCVIDEIGKMELFSQLFIQAV---------RQTLSTPGTIILGTIPVPKGKPLALVEEIRNRKDVKVFNVTKENRNHLLPDIVTCVQS................................ 187
32 -10.000sp|Q9NWZ5|UCKL1_HUMAN Uridine-cytidine kinase-like 1 OS=Homo sapiens GN=UCKL1 PE=1 SV=2  ali follow..  13  96.KEAFAIGLGGGSASGKTTVARMIIEALDVPWV---VLLSMDSFYKVLTEQQQEQAAHNNFNFDHPDAFDFDLIISTLKK-----LKQGKSVKVPIY------FTTHSRKKDWKTLYGANVIIFEGIM-DMKIFVDTDSDIRLVRRLRRDISERGRDIEGVIKQYNKVKPSFDQYIQPTM-IVVPRGSGNTVAIDLIVQHVHSQLEER.. 303
33 -9.940sp|Q13057|COASY_HUMAN(removed signalp:1-23) Bifunctional coenzyme A synthase OS=Homo sapiens GN=COASY PE=1 SV=4  ali follow..  12  336....YVIGLTGISGSGKSSIAQRLKGLIDSDHLGHRAYAPGGPAYQPVVEAFGTDILHKD-KVLGSRVFGNKKQLKILTDIMWPIIAK-------LAREEMDRAVAEGKRVCVIDAAVLLEAGWQNLV-HEVWTAVIPETEAVRRIVERDEAAAQSRLQSQMSGQQLVEQS----------VVLSTLWEPHITQRQVEKAWALLQKR... 532
34 -9.880sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   94......ICLVGPQGSGKTMCGRQLAEKLNIFHIQFEEVLSENEQAAKQELEELAIQANVKVEEENTKKQLPEVQLTEEEEVIKSSLMENEPLLSEWWLKEPIRSTGFILDGFPRYPEEAQFLGDRGFFPDAAVFIQVDDQDIFDRLLPAQIEKWKLKQ-------------KKKLERKKLIKDMKAKIRVDTIAKRRAE........... 300
35 -9.860sp|O95340|PAPS2_HUMAN Bifunctional 3`-phosphoadenosine 5`-phosphosulfate synthase 2 OS=Homo sapiens GN=PAPSS2 PE=1 SV=2  ali   16  40.FRGCTVWLTGLSGAGKTTISFALEEYLVSHAIPCYSL----------GDNVRHGL-------NRNLGFSPGDREENIRRIVAKLFADAGLVCITSFISPFAKDRENARKI---------------HESAGLPFFEIFVDAPLNICESRDVKGLYKRARAGEIGFTGIDSDYEKPETPE-RVLKTNLSTVSDCVHQVVELLQE....... 212
36 -9.820sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   13  1.............AAKQELEELAIQANVKVEEENTKKQL-PEVQLTEEEEVIKSSLMENEPLP-----------PEILEVILSEWWLK------EPIRSTGFILDGFPR-----YPEEAQFLGDRGFFPDAAVFIQVDDQDIFDRLLPAQIEKWKLKQKKK................................................. 125
37 -9.770sp|Q96M69|LRGUK_HUMAN Leucine-rich repeat and guanylate kinase domain-containing protein OS=Homo sapiens GN=LRGUK PE=1 SV=1  ali   112.APYPMLILAGPEACGKRELAHRLCRQFSTYFRYGACHTTRPPYFGEGDDVFDEMVNMGKFILTFSY-KYGLNR-----DTVEGIARDGLASCIH---------------MEIEGVRSLKY---SYFEPRYILVVPMNKEKYEGYLRRKGLFSRAEAVSRVDLYIKINQN------FPGYFDEVINADDLDVAYQKLSQLIREYL..... 300
38 -9.650sp|Q8N3R9|MPP5_HUMAN MAGUK p55 subfamily member 5 OS=Homo sapiens GN=MPP5 PE=1 SV=3  ali   12  27.NRKRPIILIGPQNCGQNELRQRLMNKEKDRFASAVPHTTRSRRDQEVAQAFEADIAAGKFIEHGEF-LYGTSI-----DSVRQVINSGKICLLS-------------------RTQSLKTLRNSDLKPYIIFIAPPSQERLRALLAKEGKNPKPEELREIIEKTREMEQNN-----GHYFDTAIVNSDLDKAYQELLRLINKLDTE... 215
39 -9.520sp|O43252|PAPS1_HUMAN Bifunctional 3`-phosphoadenosine 5`-phosphosulfate synthase 1 OS=Homo sapiens GN=PAPSS1 PE=1 SV=2  ali   17  50.FRGCTVWLTGLSGAGKTTVSMALEEYLVCHGIPCYTL----------GDNIRQGL-------NKNLGFSPEDREENVRRIVAKLFADAGLVCITSFISPYTQDRNNARQI---------------HEGASLPFFEVFVDAPLHVCEQRDVKGLYKKARAGEIGFTGIDSEYEKPEAPE-LVLKTDSCDVNDCVQQVVELLQE....... 222
40 -9.210sp|Q149M9|NWD1_HUMAN NACHT and WD repeat domain-containing protein 1 OS=Homo sapiens GN=NWD1 PE=2 SV=3  ali   17  187......LVLFGPPGIGKTALMCKLAEQMPRLLGHKTVTVLRLLGTSQMSSDARGLLHTRVVQFFHTLLHTVSCRNFESLVLLLDAM--------DDLDSVRHARR......................................................................................................... 300
41 -9.140sp|Q1KMD3|HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens GN=HNRNPUL2 PE=1 SV=1  ali   14  4.....VILMVGLPGSGKTQWALKYAKENPEKRY---NVLGAE----TVLNQMRMKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFILDQ-------VYNSGQRRKLLLFKTFSRKV---------VVVVPNEEDWKKRLELRKEVEGD---DVPESIMLEMKANFSLPEKCDYMDEVTYGELEKEEAQPIVTKYKE....... 177
42 -9.130sp|Q5TCS8|AKD1_HUMAN Adenylate kinase domain-containing protein 1 OS=Homo sapiens GN=AKD1 PE=1 SV=2  ali   4...................................................................................................................KHQMNLLEARSIIPMVIFELSVPSKEIFKRLLLEKLHNSAQIVAVNNVKYRKNIGEIRQYYQEQNWYVIDGFHSKWWVWNEVIKNVQMVNKY... 106
43 -9.110sp|Q8IVH4|MMAA_HUMAN Methylmalonic aciduria type A protein, mitochondrial OS=Homo sapiens GN=MMAA PE=1 SV=1  ali follow..  11  141.PLAFRVGLSGPPGAGKSTFIEYFGKMLTERGHKLSVLAV-DPGGSLLGDKTR-----TELSRDMNAYIRPSPTRGTLGGVTRTT--NEAILLCEGAGYDIILIETVGVGQSEFAVADMVDMFVLLLPPAG--IIEMADLVAVTKSDGDLIVPARRIQAEYVSALKLLRKRSQVWKPKVIRISARSGEGISEMWDKMKDFQDLMLAS... 352
44 -9.110sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1  ali   11  75LLQNQIVIVSGDAKCGKSAQVQWCAEYCLSIHYQHGGVICTQV-DVNIGHEVGYVIPFENCCTNETILRYCTDDMLQREMMSNPFLGSYGVIILD---------DIHERSIATDVLLGLLKDVLLA-RPELKLIINVPVIEVKNKHPVEVVYLSEAQKDSFESILRLIFEIHHSGEKGDIVVFLACEQDIEKVCETVYQGSNLN...... 299

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24