current user: public

If you have questions about the server, please let us know.

Query: gi|13507746|ref|NP_109695.1| DNA polymerase III subunit delta` MPN007 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst MFNPTHALLIIQRRGSYLQPVLTEYLTRVVCEQQTGCQTCPSCLEILHGTYNNFYSFDQANPFKREHALHLSEVLNRQSESNQKQLYLIKNLETLTATAMNSLLRLIEEHPVNTYGVFTTKNENMILPTILSRVQKVVLKKATQLPFQVDSKDQAILKSFFSVDEQLQALDNGSFTRLKTIITTLTNKKNTASTVHEAWVLFKQLNQTETAQVLNFMVDYTKDLTKKDRLLNMVQNLVFNPPKAALFANLINWLast
1 -57.200sp|P35250|RFC2_HUMAN Replication factor C subunit 2 OS=Homo sapiens GN=RFC2 PE=1 SV=3  ali follow..  10  67.GNVPN-IIIAGPPGTGKTTSILCLARALLGP----------------ALKDAMLELNASNDRGIDVVRNKIKMFKVTLPKGRHKIIILDEADSMTDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLRYTKLTDAQILTRLMNVIEKERVPYTDDGLEAIAQGDMRQALNNLQSTFSGFGF-INSENVFKVCDEPHPLLVKEMIQHCVN-----ANIDEAYKILAHLWHLGYSPEDIIGNI.. 299
2 -55.800sp|P35249|RFC4_HUMAN Replication factor C subunit 4 OS=Homo sapiens GN=RFC4 PE=1 SV=2  ali follow..  13  69.ADLPN-LLFYGPPGTGKTSTILAAARELFGPE---------------LFRLRVLELNASDERGIQVVREKVKNFAQLTVSGPFKIVILDEADSMTSAAQAALRRTMEKESKTTRFCLICNYVSRIIEPLTSRCSKFRFKPLSDKIQQQRLLDIAKKENVKISDEGIAYLSEGDLRKAITFLQSATRLGGKEITEKVITDIAGVIPAEKIDGVFAACQS-----GSFDKLEAVVKDLIDEGHAATQLVNQL.. 310
3 -55.700sp|P40937|RFC5_HUMAN Replication factor C subunit 5 OS=Homo sapiens GN=RFC5 PE=1 SV=1  ali follow..  13  51.DRLPHLLLY-GPPGTGKTSTILACAKQLYKDK---------------EFGSMVLELNASDDRGIDIIRGPILSFASTRTKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTRFCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISEDGMKALSSGDMRRALNILQST-NMAFGKVTEETVYTCTGHPLKSDIANILDWMLN-----QDFTTAYRNITELTLKGLALHDILTEI.. 284
4 -51.300sp|P40938|RFC3_HUMAN Replication factor C subunit 3 OS=Homo sapiens GN=RFC3 PE=1 SV=2  ali follow..  11  33.GDFPH-LLVYGPSGAGKKTRIMCILRELYGVGTTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSTNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAI------QQTPQRLLEVRGRLYELLTHCIPPEIIMKGL.. 295
5 -41.900sp|Q96S55|WRIP1_HUMAN ATPase WRNIP1 OS=Homo sapiens GN=WRNIP1 PE=1 SV=2  ali   10  109.NEIPS-LILWGPPGCGKTTLAHIIASNSKKHSIR-------------------FVTLSATNAKTNDVRDVIKQAQNEKSFKRKTILFIDEIHRFNKSQQDTFLPHVECGTITLIGATTENPSFQVNAALLSRCRVIVLEKLPVEAMVTILMRAINSLGIHVLDDTLAYLSDGDARAGLNGLQLA.................................................................... 300
6 -41.800sp|Q9Y230|RUVB2_HUMAN RuvB-like 2 OS=Homo sapiens GN=RUVBL2 PE=1 SV=3  ali follow..  10  70....GRAVLIAGQPGTGKTAIAMGMAQALGPDTPTAIAGSEIFSLEMSKTEALTQAFRRSIGVRIKEETEIIEGREEGKAEIIPGVLFIDEVHMLDIESFSFLNRALESDMAPVLIMATYQSPHGIPIDLLDRLLIVSTTPYSEKDTKQILRIRCEEEDVEMSEDAYTVLTETSLRYAIQLITAASLVCRKRKG--------TEVQVDDIKRVYSLFLDESRSTQYMKEYQDLFNELKGETMDTS........ 463
7 -41.000sp|Q96S55|WRIP1_HUMAN ATPase WRNIP1 OS=Homo sapiens GN=WRNIP1 PE=1 SV=2  ali   11  1...............................................................KTNDVRDVIKQAQNEKFFKRKTILFIDEIHRFNKSQQDTFLPHVECGTITLIGATTENPSFQVNAALLSRCRVIVLEKLPVEAMVTILMRAINSLGMFIEDKAVDTLSDGDARAGLNGLQLAVLARLSSRKMFCKKSGQSYSPSRVLITE........................................ 178
8 -24.200sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens GN=CHTF18 PE=1 SV=1  ali   69......VALLCGPPGLGKTTLAHVIARHA-----------------------SVVEMNASDDRSPERIEAATQMESVLGAGGKPNCLVIDEIDGAPVAAINVLLSILNGLLMRPIICICNDQFAPSLRQLKQQAFLLHFPPTLPSRLVQRLQEVSLRQGMRADPGVLAALCEKTDNDIRACINQFLYSRGQRELSVRDVQATRVGLKDQRRGLFSVWQEVFQLPRAQ.......................... 300
9 -24.000sp|P35251|RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens GN=RFC1 PE=1 SV=4  ali   46......AALLSGPPGVGKTTTASLVCQELG----------------------SYVELNASDTRSKSSLKAIVAESLNNTSVSTKHALIMDEVDGMAGNEDRGGIQELIGLIKHTIICMCNDRNHPKIRSLVHYCFDLRFQRPRVEQIKGAMMSIAFKEGLKIPPPAMNEIILGANQDIRQVLHSMWCARSKALTYDQAKADSHRAKKDIKMGPFDVARKVFAAGEETAH........................ 264
10 -16.600sp|Q9NVI7|ATD3A_HUMAN ATPase family AAA domain-containing protein 3A OS=Homo sapiens GN=ATAD3A PE=1 SV=2  ali   91..SLYRNILMYGPPGTGKTLFAKKLAL-------------------HSGMDYAIMTGGDVAPMGREGVTAMHKLFDWANTSRRGLLLFVDEADAFLRATLNAFLYRTGQHSNKFMLVLASNQPEQFDWAINDRINEMVHFDLPGQEERERLVRMYFDKYVLKPATEGKQRLKLAQFDYGRKCSEVARLTEG.............................................................. 272
11 -15.900sp|Q5T9A4|ATD3B_HUMAN ATPase family AAA domain-containing protein 3B OS=Homo sapiens GN=ATAD3B PE=1 SV=1  ali   42.RGLYRHILLYGPPGTGKTLFAKKLALH---------------------SGMDYAIMTGGDVAPMEGVTAMHKLFDWANTSRRGLLLFMDEADAFLRATLNAFLYHMGQHSNKFMLVLASNLPEQFDCAINSRIDVMVHFDLPQQEERERLVRLHFDNCVLKPATEGKRRLK-------------LAQFDYGRKCSEVARLTEGMSGREIAQLAVSWQATAYASKDGVLTEAMMDACVQD............. 260
12 -15.600sp|Q96QE3|ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens GN=ATAD5 PE=1 SV=4  ali   13..TSPRKVPPPSPKSSGPKRALPPKTKVSPKPKNNEEIGMLLENNKGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEAIKTFMATTKRP------VILTTSDPTFSLMFDGCFEEIKFSTPSLLNVASYLQMICLTENFRTDVKDFVTLLTANTCDIRKSILYL.................................................................... 200
13 -15.600sp|Q5T2N8|ATD3C_HUMAN ATPase family AAA domain-containing protein 3C OS=Homo sapiens GN=ATAD3C PE=1 SV=2  ali follow..  168..GLYRHILLYGPPGTGKTLFAKKLALHSG---------------------MDYAIMTGGDVAPMEGVTAMHKLFDWANTSRRGLLLFVDEADAFLRATLNAFLYRTGQHSNKFMLILASCHPEQFDWAINACIDVMVHFDLPGQEERARLVRMYLNEYVLKPATEGKRRLKLAQFDYGRKCLEIARLTEG-------------MSCRKIAQLAVSWQATAYASKDGVLTEAMMDACVQD............. 385
14 -15.000sp|Q9Y265|RUVB1_HUMAN RuvB-like 1 OS=Homo sapiens GN=RUVBL1 PE=1 SV=1  ali follow..  10  61..MAGRAVLLAGPPGTGKTALALAIAQELGSKVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDIKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGEIGTKTTLRYSVQLLTPANLLAKINGK----DSIEKEHVEEISELFYDAKSSAK............................ 445
15 -14.600sp|Q9H078|CLPB_HUMAN(removed signalp:1-23) Caseinolytic peptidase B protein homolog OS=Homo sapiens GN=CLPB PE=1 SV=1  ali   11  203......VFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFI--SPPGYVGHEEGGQLTKKLKQCP----NAVVLFDEVDKAHPDVLTIMLQLFDE................................................................................................................................................ 300
16 -14.500sp|O14657|TOR1B_HUMAN(removed signalp:1-24) Torsin-1B OS=Homo sapiens GN=TOR1B PE=1 SV=2  ali follow..  80......TLSLHGWAGTGKNFVSQIVAENL----------------HPKGLKSNFVHLFVSTLHFPHEQKQLQKWIRGNVSACANSVFIFDEMDKLHPGIIDAIKPFLDY--RKAIFIFLSNAGGD---LITKTALDFWRAGRKREDIQLKDLEPVLSVGVFNNKHSGLWHSG-----DKNLIDYFI---------------FLPLEYRHVKMCVRAEMRARGSAIDEDIVTRVAEEMTFFPRDEKIYSD.... 299
17 -14.500sp|P36776|LONM_HUMAN(removed signalp:1-16) Lon protease homolog, mitochondrial OS=Homo sapiens GN=LONP1 PE=1 SV=2  ali   53.......LCFYGPPGVGKTSIARSIARALN----------REYFRFSVGGMTDVAEIKGHRRTYVGAM-KIIQCLKKTKTEN--PLILIDEVDKIGRDPSSALLELLDPEQSKVLFICTANVTDTIPEPLRDRMEMINVSGYVAQEKLAIAERYLVPQARALCG-----LDESKAKLSSDVLTLLIKQYCRESGVRNLQKQVEKVLRKSAYKIVS...................................... 263
18 -14.500sp|Q9NXH8|CI167_HUMAN Torsin family protein C9orf167 OS=Homo sapiens GN=C9orf167 PE=1 SV=2  ali follow..  10  189......LLALHGPSGVGKSHVGRLLARHF----------------RSVLEDSALVLQRAAQDCREELARRVADVVARAEAEEKTPLLVLDDVELMPRPLLDELHGFLQP--HNAIYVLLSGAGGAEVTRFV-----LQNASRALPLRPDGFRSAEAAAAQAEEDLRASLLAVLSREHPLWQAAAIV---------------FLLLDKRDVVSCFRDEMAGEGFFPDQARAENLAAQLSFYRVAGREFAV.... 410
19 -14.400sp|Q15645|TRP13_HUMAN Thyroid receptor-interacting protein 13 OS=Homo sapiens GN=TRIP13 PE=1 SV=2  ali follow..  10  170..TWNRVVLLHGPPGTGKTSLCKALAQKL------------TIRLSSRYRYGQLIEINSHSSESGKLVTKMFQKIQLIDDKDALVFVLIDEVESLTAAVVNAVLTQIDKRHSNVVILTTSNITEKIDVAFVDRADIKQYIGPPSAAAIFKIYLSCLEE............................................................................................... 337
20 -14.200sp|O75943|RAD17_HUMAN Cell cycle checkpoint protein RAD17 OS=Homo sapiens GN=RAD17 PE=1 SV=2  ali   130....GSILLITGPPGCGKTTTLKILSKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATLRTDKKIILVEDLPNQFYRDHEVLRKYVRIGRCPLIFIISDSLSGDNNQRLLCSISNISFNPVAPTIMMKFLN..................................................................................................... 300
21 -14.200sp|Q86WA8|LONP2_HUMAN Lon protease homolog 2, peroxisomal OS=Homo sapiens GN=LONP2 PE=2 SV=1  ali   10  71.......LCFVGPPGVGKTSVGRSVAKTLG----------REFHRIALGGVCDQSDIRGHRRTYVGSM-RIINGLKTVGVNN--PVFLLDEVDKLGKDPAAALLEVLDPEQSQVLFIATANTTATIPAALLDRMEIIQVPGYTQEEKIEIAHRHLIPKQLEQHG-----LTPQQIQIPQVTTLDIITRYTREAGVRSLDRKLGAICRAVAVKVAE...................................... 281
22 -13.800sp|Q13415|ORC1_HUMAN Origin recognition complex subunit 1 OS=Homo sapiens GN=ORC1L PE=1 SV=2  ali   10  74.DHTGGCMYISGVPGTGKTATVHEVIRCLQQAAQAN-----NGMKLTEPHQV-LQKLTGQKATANHAAELLAKQFCTRGSPQETTVLLVDELDLLWTHKQDIMYNLFDWPKEARLVVLAIANTMDLPERIMMN-TRMCFQPYTYSQLQQILRSRLKHLKA-FEDDAIQLVASGDARRCLDICRRATEICEFS............................................................. 286
23 -13.800sp|O43933|PEX1_HUMAN Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1  ali   12  142....NGALLLTGGKGSGKSTLAKAICKEA---------------FDKLDAHVERVDCKALRGKRLENIQKTLEVAFSEAVWMQPSVVLLDDLDLIAAHALNDMIKEFISMGSLVALIATSQSQQSLHPLLVSAQGVHIFQCVQHIQPPNQEQRCEIL................................................................................................ 299
24 -13.700sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   94..KLKKPILLEGSPGVGKTSLVGALAKASG----------NTLVRINLSEQTDITDLFGAEGGKGGEFAWRDGPLLAALKAG--HWVVLDELNLASQSVLEGLNACFDH-QHEKTKIFGCQNPKGLPRSFLNRFTQVFVDPLTVIDMEFIASTLFPAIEKNIVKKMVAFNNQ................................................................................. 276
25 -13.700sp|Q9H497|TOR3A_HUMAN(removed signalp:1-25) Torsin-3A OS=Homo sapiens GN=TOR3A PE=1 SV=1  ali follow..  10  137......ALSFHGWSGTGKNFVARMLVENL----------------YRDGLMSDCVRMFIATFHFPHPKYQLMSQIRETQQLCHQTLFIFDEAEKLHPGLLEVLGPHLERRAPWTIFLFLSNLRGD---IINEVVLKLLKAGWSREEITMEHLEPHLQAEIVETIDNGFGHSRLVKENLIDYFIPFLPLEYRHVRL--ARDAFLSQELLYKEETLDEIAQ.................................. 343
26 -13.600sp|Q8N2E6|TOR2X_HUMAN(removed signalp:1-26) Prosalusin OS=Homo sapiens GN=TOR2A PE=1 SV=1  ali follow..  62......VLSLHGWTGTGKSYVSSLLAHYLFQGGLR-----------SPRVHHFSPVLHFPHPSHIERYKDLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGS--RKAIFIFIRW.................................................................................................................................... 173
27 -13.400sp|Q5JU69|TOR2A_HUMAN(removed signalp:1-26) Torsin-2A OS=Homo sapiens GN=TOR2A PE=2 SV=1  ali follow..  10  62......VLSLHGWTGTGKSYVSSLLAHYLF-QGGLRSPRVHHFSPVLHFPHPSHIERYKK---------DLKSWVQGNLTACGRSLFLFDEMDKMPPGLMEVLRPFLGS--RKAIFIFISNTGGKQINQVA----------LEAWRSRRDREEILLQELEPVISRAVLDNPHHGFSNSGIMEERLL----------DAVVPFLPLQRHHVRHCVLNELAQLGLEPRDEVVQAVLDSTTFFPEDEQLFSS.... 281
28 -13.300sp|Q96QE3|ATAD5_HUMAN ATPase family AAA domain-containing protein 5 OS=Homo sapiens GN=ATAD5 PE=1 SV=4  ali   10  72.SRLCNTVLITGPTGVGKTAAVYACAQEL-----------------------KIFEVNASSQRSGRQILS-SHQVDKQGVNSQKPCFFNSYYIGKSPKKISSPKKVVTSPRKVPPPSPKSSGPKR-PKTLANYFKVSPKPKNNEEIGMLLENNKGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNAIKTFMATTKR.............................. 280
29 -13.200sp|P46459|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens GN=NSF PE=1 SV=3  ali   88......SVLLEGPPHSGKTALAAKIAEESNFP-----------IKICSPDKM----IGFSETAKCQAMKKIFDDAYKSQLS----CVVVDDIERLSNLVLQALLVLLKPPQGRKLLIIGTTSRKDVLQEM---------EMLNAFSTTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLLMLIEMSLQMDPEYRVRKFLALLREEGASPLDFD......................... 294
30 -13.200sp|Q9H078|CLPB_HUMAN(removed signalp:1-23) Caseinolytic peptidase B protein homolog OS=Homo sapiens GN=CLPB PE=1 SV=1  ali   10  53......VFLFLGSSGIGKTELAKQTAKYMHKDAKKGFIRLDMSEFQERHEVAKFI--SPPGYVGHEEGGQLTKKLKQCP----NAVVLFDEVDKAHPDVLTIMLQLFDE--KDAIFIMTSN.................................................................................................................................... 173
31 -13.200sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2  ali   11..TGTSSVLLRGPPGCGKTTVVAAACSHLG---------------------LHLLKVPCSSAESSGAVETKLQAIFSRARRCRPAVLLLTAVDLLGMAVLRHLLLNEDNSCPPLMVVATTSRAQDLPADVQTAFPHELEVPALSEGQRLSILRALTAHLPLGQEVNLAQLARRCAGFVVGDLYALLTHS................................................................ 192
32 -13.200sp|Q99973|TEP1_HUMAN Telomerase protein component 1 OS=Homo sapiens GN=TEP1 PE=1 SV=2  ali   108.LPHGRLSLVTGQSGQGKTAFLASLVSALQAPDGAKVASLRLCTYLRGQLKEPGALPSTYRSLVWELQQRLLPKSAESLHPGQTQVLIIDGADRLVDQNGQLISDWIPKKPRCVHLVLSVSSDAGLGETLEQS-HVLALGPLEASARARLVREELALYGKRLEESPFNNQ................................................................................... 299
33 -13.100sp|O14656|TOR1A_HUMAN(removed signalp:1-20) Torsin-1A OS=Homo sapiens GN=TOR1A PE=1 SV=1  ali follow..  77......TLSLHGWTGTGKNFVSKIIAENI----------------YEGGLNSDYVHLFVATLH-TLYKDQLQLWIRGNVSACARSIFIFDEMDKMHAGLIDAIKPFLDY--QKAMFIFLSNAGAERITDVA-----LDFWRSGKQREDIKLKDIEHALSVSVFNNKNSGFWHSSLID-RNLIDYFV---------------FLPLEYKHLKMCIRVEMQSRGYEIDEDIVSRVAEEMTFFPKEERVFSD.... 296
34 -13.000sp|P46459|NSF_HUMAN Vesicle-fusing ATPase OS=Homo sapiens GN=NSF PE=1 SV=3  ali   12  101..KHVKGILLYGPPGCGKTLLARQIGKMLNAR-----------PKVVNGPEILNKYVGESEANIRKLFADAEEEQRRLGANSGLHIIIFDEIDAIHDTVVNQLLSKIDEQLNNILVIGMTNRPDLIDEALL-RPGRLEVKEKGRLQILHIHTARMRGHQLLSADVDIKELAVET-AELEGLVRAAQS.................................................................. 300
35 -12.900sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens GN=CHTF18 PE=1 SV=1  ali   218.....KVALLCGPPGLGKTTLAHVIARHA-----------------------SVVEMNASDDRSRTRIEAATQMESVLGAGGKPNCLVIDEIDGAPVAAINVLLS.................................................................................................................................................... 300
36 -12.800sp|Q13608|PEX6_HUMAN Peroxisome assembly factor 2 OS=Homo sapiens GN=PEX6 PE=1 SV=2  ali   165......SVLLRGPPGCGKTTVVAAACSHLG---------------------LHLLKVPCSSAESSGAVETKLQAIFSRARRCRPAVLLLTAVDLLGRDVLRHLLLNEDNSCPPLMVVATTSRAQDLPADVQTA........................................................................................................................ 286
37 -12.800sp|A3KMH1|K0564_HUMAN Uncharacterized protein KIAA0564 OS=Homo sapiens GN=KIAA0564 PE=1 SV=2  ali   22..LLGEHLLLVGNQGVGKNKIVDRFLHLLN----------RPREYIQLHRDTTVQTLTLQPSVKDGLIVYEDSPLVKAVKLG--HILVVDEADKAPTNVTCILKTLVENVIHPDFRMIVLANRNDFFGTLGDIFSCHAVDNPKPHSELEMLRQYGPNVPEPILQKLVAAFGE-STREVVNIVKHLQKFPTEGLSVVRNVFDFDSYNNDMREILINTLHKYGIPIGAKPTSVQLAKELTLPEQTFMGY...... 300
38 -12.700sp|Q8IVF4|DYH10_HUMAN Dynein heavy chain 10, axonemal OS=Homo sapiens GN=DNAH10 PE=1 SV=4  ali   11  5...TRHTTMVVGPTRGGKSVVINTLCQAQTKLGLTTKLYILNPKAVSVIELYG--ILDPTTRDWTDGVSNIFREINKPTDKKERKYILFDDVDALWVENMNSVMRLL-RLQAHCALLFEVGDLQYASPATVSRCGMVYVDP-KNLKYRPYWKKWVNQIPNKVEQYNLNSLFEKYVPYLMDVIVEGIVDGRQAEKLKTIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLECYFLEALY................ 247
39 -12.600sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   28.....YPVLIQGETSVGKTSLIQWLAAATG----------NHCVRINNHEHTDIQEYIGCYTSDSSGKLVFKEGVLIDAMRKG-YWIILDELNLAPTDVLEALNRLLDDNRELLV-LFATQNPKVLSRAFRNRFVELHFDELPSSELETILHKRSYCSKLVKVMLDLQSYRRSTLRDLFRWAERYRLAEPTEKEYDWLQHLA--------NDGYMLLAGRVRKQEEIDVIQEVLEKHFKKKLCPQSLFS.... 288
40 -12.500sp|Q9BSD7|CA057_HUMAN Nucleoside-triphosphatase C1orf57 OS=Homo sapiens GN=C1orf57 PE=1 SV=1  ali follow..  1...MARHVFLTGPPGVGKTTLIHKASEVLKSSGVPVDGYTEEVRQGGRRIGFDVVTLSGTRGPSFEQLALPVLRNADCSSGPGQRVCVIDEIELFSQLFIQAVRQTLSTPGTIILGTIPVPKGKALVEEIRNRVKVFNVTKENRNHLLPDIVTCVQS................................................................................................ 187
41 -12.400sp|Q8TE73|DYH5_HUMAN Dynein heavy chain 5, axonemal OS=Homo sapiens GN=DNAH5 PE=1 SV=3  ali   11  4...VRHGMMTLGPSGAGKTTCIHTLMRAMTDCGKPHREMRMNPKAITAPQMFG--RLDVATNDWTDGIFSTLWRKTLRAKKGEHIWIILDPVDAIWIENLNSVLKTL-PMAPNCKIIFEPHNIDNASPATVSRNGMVFMSSSIL----SPILEGFLKKRSPQEAEILRQLYTESFPDLYRFCIQNLEYKMEVLEAFVITQSINMLQ............................................... 213
42 -12.300sp|Q6P2S7|GNN_HUMAN Tetratricopeptide repeat protein GNN OS=Homo sapiens GN=GNN PE=2 SV=3  ali   37.......LLLSREHGCGKSTLIANWVNYFKKKHPSML---YFITELQYRNYGTQLETDILNEDSDGLVFSFLVEVFIASISLKPCILVLDGIEELIGIYGISGFSWLPHSSPHCKFIMSTVSSSLSYKSLCAR----------------------------PDVRTVELISTGDEETKLNIFRKHLSIPMMDPFEQSTQALRKKPDLSPL--KLTILANELKEYRINHNEFQCMKEYLEAVSVQELWELVLK. 274
43 -12.100sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   25.......VLLEGPIGCGKTSLVEYLAAVTGRTKPPQLLKVQLGDQTDSKMLLGMYRCTDVPGEFVWQPGTLTQAATMG------HWILLEDIDYAPLDVVSVLIPLLENKVAPGFQFFATRRLNSHATLLDKYWTKIHLDNLDKRELNEVLQS.................................................................................................... 187
44 -12.000sp|A3KMH1|K0564_HUMAN Uncharacterized protein KIAA0564 OS=Homo sapiens GN=KIAA0564 PE=1 SV=2  ali   12  101..LLGQDVFLIGPPGPLRRSIAMQYLELTK----------REVEYIALSRDTTETDLKQRREIRAGTAFYIDQCAVRAATEG--RTLILEGLEKAERNVLPVLNNLLENRVSENFRVIALGLPNPLDPPLRSRFQARDIYYLPFKDQLKLLYSIGANVSAEKVSQLLSFATT................................................................................. 299
45 -11.900sp|Q9UFH2|DYH17_HUMAN Dynein heavy chain 17, axonemal OS=Homo sapiens GN=DNAH17 PE=2 SV=2  ali   6...VRHSVFIVGNAGSGKSQVLKSLNKTYQNLKRKPVAVDLDPKAVTCDELFG--IINPVTREWKDGLFSTIMRDLANITHDGPKWIILDDIDPMWIESLNTVMKVL-PLNRTMRLVFEISHLRTATPATVSRAGILYINP-ADLGWNPVVSSWIERRKVQSEKANLMILFDKYLPTCLDKLRFGFKKITPVPEITVIQTILYLLE............................................... 216
46 -11.900sp|Q5T9A4|ATD3B_HUMAN ATPase family AAA domain-containing protein 3B OS=Homo sapiens GN=ATAD3B PE=1 SV=1  ali   192.RGLYRHILLYGPPGTGKTLFAKKLALH---------------------SGMDYAIMTGGDVAPMEGVTAMHKLFDWANTSRRGLLLFMDEADAFLRATLNAFLYHMGQHSNKFMLV........................................................................................................................................ 300
47 -11.800sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1  ali   1.......VLLHGPPGCGKTLLAHAIAGELD---------------------LPILKVAAPEGESEQKLRELFEQAVSNA------IIFIDEIDAIERRIVAQLLTCMDAATARVLVIGATNRPDSLDPALRGRFDREICLGIPDEASRERILQTLCRKLRLPQAFDFCHLAHLT-ADLMALCREA.................................................................... 181
48 -11.700sp|Q8NEY1|NAV1_HUMAN Neuron navigator 1 OS=Homo sapiens GN=NAV1 PE=1 SV=2  ali   10  202.....RRLVLSGPSGTGKTYLTNRLAEYLVERSGR------------EVTEGIVSTFNMHQQSC-KDLQLYLSNLRETGIGDVPLVILLDDLSEAGSELVNGALTCKYH................................................................................................................................................ 299
49 -11.700sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4  ali   10  86..KPPRGILLYGPPGTGKTLIARAVANETGAF-------------FFLINGPEI--MSKLAGESESNLRKAFEEAE----KNAPAIIFIDELDAIERRIVSQLLTLMDKQRAHVIVMAATNRPNSIDPALRGRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANET-ADLAALCSEA.................................................................... 268
50 -11.700sp|Q96JB1|DYH8_HUMAN Dynein heavy chain 8, axonemal OS=Homo sapiens GN=DNAH8 PE=1 SV=2  ali   12  20...VRHGLMTLGPSGSGKTTVITILMKAQTECGRPHREMRMNPKAITAPQMFG--RLDTATNDWTDGIFSTLWRKTLKAKKGENIFLILDPVDAIWIENLNSVLKTL-PMAPSCKLLFEVHNIENASPATVSRMGMVYISSSAL----RPILQAWLKKRTAQEAAVFLTLYEKVFEDTYTYMKLNLNPKMQLLECNYIVQSLNLLE............................................... 229
51 -11.600sp|Q99741|CDC6_HUMAN Cell division control protein 6 homolog OS=Homo sapiens GN=CDC6 PE=1 SV=1  ali follow..  10  192.GKKAGSLYLSGAPGTGKTACLSRILQDLKKELKGFKTIMLNCMSLRTAQAV-AQEICQEEVSRPAGKDMMRKLEHMTAEKGPMIVLVLDEMDQLDSKGQDVLYTLFEWPSNSHLVLIGIANTLDLTDRILPRLQLLNFPPYTRNQIVTILQDRLVSRDQVLDNAAVQFCARGDVRKALDVCEIVESDVKSQTILKPLSECKSPSEPLIPKRVLIHISQVISEVDGNRMTLSQEGAQDSFPLQQKILVCSL.. 468
52 -11.600sp|Q8IVL1|NAV2_HUMAN Neuron navigator 2 OS=Homo sapiens GN=NAV2 PE=1 SV=3  ali   10  201.....RRIILSGPSGTGKTYLANRLSEYIVLREGR------------ELTDGVIATFNVDHKSS-KELRQYLSNLSENNAVDMPLVIILDNLHHVSGEIFNGLLNCKY-----------------------HKC....................................................................................................................... 300
53 -11.500sp|Q8NCM8|DYHC2_HUMAN Cytoplasmic dynein 2 heavy chain 1 OS=Homo sapiens GN=DYNC2H1 PE=1 SV=4  ali   11  20..CQRMGVVIVGPSGAGKSTLWRMLRAALCKTGKVVKQYTMNPKAMPRYQLLG--HIDMDTREWSDGVLTNSARQVVREPQDVSSWIICDDIDPEWIESLNSVLRLLTMPGPNVNFVFETHDLSCASPATISRMGMIFLSDEET----NSLIKSWLRNQPAEYRNNLENWIGDYFEKALQWVLKQNDYVVETSLVGTVMNGLSHLH............................................... 230
54 -11.500sp|Q149M9|NWD1_HUMAN NACHT and WD repeat domain-containing protein 1 OS=Homo sapiens GN=NWD1 PE=2 SV=3  ali   31.SKQHTPLVLFGPPGIGKTALMCKLAEQMPRLLGHKTQMSSDARGLLKSICFQVCLAYGLPLPPAQVLDAHTRVVQFSCRNFESLVLLLDAMDDLDSVRHARRVPWLPLNPPRVHLILSACSGALGVLDTLQRVLLWEVKPLSGNQGQQMIQLLLAAARRTLSPVHTDLLWASLPECGNPGRLRLAFEEARKWASFTVPVPL-----TTAEEATHQLCTRLEQTHGQLLVAHVLGYIVSSRHGLSE....... 295
55 -11.400sp|Q9BVQ7|SPA5L_HUMAN Spermatogenesis-associated protein 5-like protein 1 OS=Homo sapiens GN=SPATA5L1 PE=1 SV=2  ali   10  82..AVPRGVLLAGPPGVGKTQLVRAVAREAGAE-------------LLAVSAPAL--QGSRPGETEENVRRVFQRARELASRGP--LLFLDEMDALCSRVVAQVLTLLDSGDREVVVVGATNRPDALDPALRGRFDREVVIGTPTLKQRKEILQVITSKMPISSHVDLGLLAEMT-ADLTALCREA.................................................................... 265
56 -11.300sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1  ali   10  163..VTPAGVLLAGPPGCGKTLLAKAVANESGLN-------------FISVKGPEL--LNMYVGESERAVRQVFQRAKNSA------VIFFDEVDALSVRVVNQLLTEMDEARQQVFIMAATNRPDIIDPAIL-RPGRLD................................................................................................................... 291
57 -11.300sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1  ali   10  8..QPPRGCLFYGPPGTGKTLVARALANECS----------------QGDKRVAFFMRKGADCLSKESERQLRLLFDQA-YQMRPSIIFFDEIDGLASSIVSTLLALMDDSRGEIVVIGATNRLDSIDPALR-RPGRFDTRDWNPKPLDTFLEELAENCVGYCGADIKSICAEAALCALRRRYPQIYTTSEK.............................................................. 214
58 -11.200sp|Q9ULI1|K1239_HUMAN Leucine-rich repeat and WD repeat-containing protein KIAA1239 OS=Homo sapiens GN=KIAA1239 PE=2 SV=3  ali   15  109....INPLIIYGGPCTGKTLLLAEVAKKAY-TTDMSSDLRTLLLSVCEQLAVNYRCLVQSYPKKIHDLCDLFINLLNESSLQRPLVIIFDALEQLSENDDARKLWWLPAHPRFVRIVLSTLP-QKLRCLIHEEDNYIELIPRDRKMCSQVLKHQLLRVKRKVTSGQQIYV................................................................................... 300
59 -11.200sp|Q8WZ74|CTTB2_HUMAN Cortactin-binding protein 2 OS=Homo sapiens GN=CTTNBP2 PE=1 SV=1  ali   11  70....YHNVIFHGPEGSLQDYIVHQLALCLKHRQMA------------AGFSCEIVRAEVDAGFSKEQLLDACLIPVKQSPSKKKIIIILENLEKSSSELLRDFLAPLENRSTESCFLMGTIAKACLQGSDLLVQQHFRWVQLRDGEPMQGLLQRFLRRKVVNKFKGQAPSPCDPVCKIVDWALSVWRQLNSCLA........................................................... 273
60 -11.100sp|O43933|PEX1_HUMAN Peroxisome biogenesis factor 1 OS=Homo sapiens GN=PEX1 PE=1 SV=1  ali   13  122..RQRTGILLYGPPGTGKTLLAGVIARESR---------------------MNFISVKGPESKYIGASEQAVRDIFIRAQAAKPCILFFDEFESITDRVVNQLLTQLDEGLQGVYVLAATSRPDLIDPALLGRLDKCVYCPPPDQVSRLEILNVLSDSLPLADDVDLQHVAS................................................................................. 287
61 -11.100sp|Q9NYC9|DYH9_HUMAN Dynein heavy chain 9, axonemal OS=Homo sapiens GN=DNAH9 PE=1 SV=3  ali   43...VRHSVFVVGGAGTGKSQVLRSLHKTYQIMKRRPVWTDLNPKAVTNDELFG--IINPATGEWKDGLFSSIMRELANITHDGPKWILLDDIDPMWIESLNTVMKVL-PLNPTMKLLFEISHLRTATPATVSRAGILYINP-ADLGWNPPVSSWIEKREIQTERANLTILFDKYLPTCLDTLRTRFKKIIPIPEQSMVQMVCHLLE............................................... 253
62 -11.100sp|O43929|ORC4_HUMAN Origin recognition complex subunit 4 OS=Homo sapiens GN=ORC4L PE=1 SV=2  ali follow..  13  57.HGESNSVLIIGPRGSGKTMLINHALKELMEIEEVS-NDKIALKEITRQLNLENVVGDKVFGSFAENLSFLLEALKKGDRTSSCPIFILDEFDLFAHHKNQTLLYNLQSAQTPIAVIGLTCRLELLEKRVKSRFQIHLMNSFGFPQYVKIFKEQLSLPA-LSEDRSVQEVLQKNLRSLHMLL-NRVTASHPFMTAVDLMEASQLCSMDSKANIVHGL.................................... 321
63 -11.100sp|Q6PL18|ATAD2_HUMAN ATPase family AAA domain-containing protein 2 OS=Homo sapiens GN=ATAD2 PE=1 SV=1  ali   11  160....PRGCLFYGPPGTGKTLVARALANECS----------------QGDKRVAFFMRKGADSKWVGESERQLRLLFDQAYQMRPSIIFFDEIDGLASSIVSTLLALMDDSRGEIVVIGATNRLDSIDPALR-RPGRFD................................................................................................................... 291
64 -11.100sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   31..EFGEPVLLVGDTGCGKTTICQVFAALAN----------QKLYSVSCHLHMETSDF--GGLRPVRQKPNDKEEIDLVQAMKEDGFFLLDEISLADDSVLERLNSVLEVEKSLVL-ILATMNPKELSPALRNRFTEIWCPQSTSREDLIQI...................................................................................................... 207
65 -11.100sp|Q9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B OS=Homo sapiens GN=ATAD2B PE=1 SV=3  ali   11  134....PRGCLFYGPPGTGKTLVARALANECS----------------QGDKKVAFFMRKGADCLSVGESERQLRLLFDQAYLMRPSIIFFDEIDGLASSIVSTLLALMDDNRGEIVVIGATNRLDSIDPALR-RPGRFD................................................................................................................... 265
66 -11.000sp|Q9UQ90|SPG7_HUMAN(removed signalp:1-16) Paraplegin OS=Homo sapiens GN=SPG7 PE=1 SV=2  ali   12  23.AKVPKGALLLGPPGCGKT----LLAKAVATEAQVP--------AMAGPEFVEVIG-----GLGAARVRSLFKEARARA------IVYIDEIDAVEEQTLNQLLVEMD-GTTDHVIVLASTNRADILDGALMRPGRLDRHQERREIFEQHLKSLKLTQSSTFYSQRLAELTPGSGADIANICNEAA................................................................... 213
67 -11.000sp|Q9Y276|BCS1_HUMAN Mitochondrial chaperone BCS1 OS=Homo sapiens GN=BCS1L PE=1 SV=1  ali follow..  13  224.....RGYLLYGPPGCGKSSFITALAGELE---------------------HSICLLSLTDSSLSDD--RLNHLLSVAPQQS---LVLLEDVDAAGRLTFSGLLNALD-STEARIVFMTTNHVDRLDPALI-RPGRVDLK----------------------------YVGYCSHWQLTQMFQRFYPGQAPSLAENFAEHVLRATNQISPAQVQGYFMLYKNDPVGAIHNAE..................... 415
68 -10.900sp|Q9NU22|MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2  ali   14LLRLMQHVHKSAVNKDGKDSETGLLIKEKW---------------EAFGLRLNHAQQQMKMTENTLLFAFVEGTLAQAVKKG--EWILLDEINLAAPEILECLSGLLEGSSGSLVLLFACMNPRNLPPGIRNRFTELYVEELESKEDLQVLIVDYLKGLSVNKNTVQGIIN--ALRKESGTKLVDGTGHRPHYSLRTLCRALRFAASNPCGNIQRSLYE-QLDRASHPIVQKLICQHIVPGNVKSLLKQPIP. 278
69 -10.900sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4  ali   12  70....AWGVLLVGGPGSGKTALCTELLWPSSCKAQDSDTLCVG-DKLRDPAVQSLLQPGECERNPAEAFKRVLLPLLGMKPPQQSLYLLVDSVDEGSTSLSGTVAALLAG-PPWLLLLCSARKQSKAVTKMFTGFRKISLDDLRKAYIVKDVQQYILHR------DQEEALRQHLTKETAEMLNQLHIKSS............................................................... 300
70 -10.800sp|P55072|TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4  ali   13  59..TPSKGVLFYGPPGCGKTLLAKAIANECQ---------------------ANFISIKGPETMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKAVINQILTEMDSTKKNVFIIGATNRPDIIDPAILGRLDQLIYIPLPDEKSRVAILKANLRKSPVAKDVDLEFLAKMT-ADLTEICQRA.................................................................... 244
71 -10.800sp|P35251|RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens GN=RFC1 PE=1 SV=4  ali   195.....KAALLSGPPGVGKTTTASLVCQEL-----------------------SYVELNASDTRSKSSLKAIVAESGAASSVSTKHALIMDEVDGMAIQELIGLIKHTKIP............................................................................................................................................... 297
72 -10.700sp|Q96TA2|YMEL1_HUMAN ATP-dependent zinc metalloprotease YME1L1 OS=Homo sapiens GN=YME1L1 PE=1 SV=2  ali   69.GKLPKGILLVGPPGTGKT----LLARAVAGEADVP--------YASGSEFDEMFV-----GVGASRIRNLFREAKANA------VIFIDELDSVSRQTINQLLAEMDKPNEGVIIIGATNFPEALDNALIGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDQSVDPEIIARGTVGFSGAELENLVNQAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNKTITAYHE................. 300
73 -10.700sp|O15381|NVL_HUMAN Nuclear valosin-containing protein-like OS=Homo sapiens GN=NVL PE=1 SV=1  ali   146..VPPRGVLLHGPPGCGKTLLAHAIAGELDLP-------------ILKVAAPEI--VSGVSGESEQKLRELFEQAVSNA------IIFIDEIDAIERRIVAQLLTCMDAATARVLVIGATNRPDSLDPALR-RAGRFD................................................................................................................... 277
74 -10.600sp|Q7Z494|NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens GN=NPHP3 PE=1 SV=1  ali   10  70.PAPIPPLLVSGGPGSGKSLLLSKWIQLQQKNSPNT----KRLTLKLMQHSWSVSALTLDPAKLLEEFPRWLEKL--SARHQGSIIIVIDSIDQVQQVE-KHMKWLIDPLPVNVRVIVSVNVETCP--PAWRLWPTLHLDPLSPKDAKSIIIAECHSVDIKLSKEQEKKLERHCRSATTCFGKMIARAGRAGNLDKILHQCFQCQDTLSLYRL........................................ 300
75 -10.500sp|Q9Y4W6|AFG32_HUMAN AFG3-like protein 2 OS=Homo sapiens GN=AFG3L2 PE=1 SV=2  ali   38.AKIPKGAILTGPPGTGKT----LLAKATAGEANVP--------TVSGSEFLEMFV-----GVGPARVRDLFALARKNA------ILFIDEIDAVQENTLNQLLVEMDNTTTNVVILAGTNRPDILDPALLGRFDRQIFIGPPDIKGRASIFKVHLRPLKLDSTLEKDKLARKLASLTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVI................................... 253

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24