current user: public

If you have questions about the server, please let us know.

Query: gi|13507753|ref|NP_109702.1| hypothetical protein MPN014 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# Score Template Links and tools%idFirst MELRNTKLEQLFYIYHRNLKYRCPMQYLTKRGFNLQDLLSVGGGLAYLGEKQWLNLSLYNFNNQLVGFLSRKVGFEKKFLYLPINKPPSKSESFLGLKHLPTETNTIYLVEGDFDWLAFRKGGILNCLPLCGLTLSDKQMKFFQQSKIEKVVLCLDNDFAGKVAAANLERILKNAGFQVKVVQLKGKVKDWNELLLLYPKNWAKALRDHLALLast
1 -66.900[L] COG0358 DNA primase (bacterial type)  ali follow..  18  153.RGLSGEIVQKFGIGYIADEWDLVRRNFGQQRSSEDMLVTAVMGRRYDRFRGRVMFPIRDRRGRVIGFGGRITEQGPKYLNSPETPIFHKGKELYGLYEVYREPPQILVVEGYMDVVALAQYGVDYSVASLGTSTTGDHLQLLFRQ-TNHVICCYDGDRAGRDAAWRALENYLKSGNILKFLFLPDG-EDPDSYVRKYGKAFEQQVANATPL 375
2 -29.800[L] COG1658 Small primase-like proteins (Toprim domain)  ali follow..  14  4....................................................................................................KQKINEVIVVEGRDDTANLKRYFDCETYETGGSSIDDRDLERLKRLEKRGIIVFTDPDFQGERIRKI----IMQAVPNAKHAFLNRD-EARPKGKGSLGEALNQALAEVFGG 117
3 -17.600[L] KOG2373 Predicted mitochondrial DNA helicase twinkle  ali follow..  17  148.....................PEACAALGIKGLKEDQLNAIGAQ--WEPQQQLLHFKLRNAAQVEVGEKVLYLGDRREEIFQS-----SSSSGLLIHGAM--NKTKAVLVSNLIDFIVLATQNIETCLPYELKTLPQECLPALERF--KELIFWLHYDASHSWDAARAFALKLDER---RCLLIRPTETEPAPHLALRRLNLRHILAKATPV 329
4 -12.700[S] COG4643 Uncharacterized protein conserved in bacteria  ali follow..  11  628..........................YLKAKGITPQAGIYT------DSDGQKTYIPAIDSDGKQWTMQYIQEDGTKRFAKGGRKE------HPIGGLAAIAAAPVIVIGEGYATVAQVSQAGYGTVAAFDAGNLEGVAKALHKTFPDKPILIAGDDDNPGKTKAQEAARAFFPIFAPGEQADNPKGFTDFNDLATKSAEAVERQVHAAVS. 817
5 -9.100[L] COG0353 Recombinational DNA repair protein (RecF pathway)  ali follow..  15  23................................................KSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGFSGRYFVLMGHLSDRLEQRLASEKISELILATNPTVEGEATANYIAELCAEAG--VEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKI 199
6 -8.190[L] COG3593 Predicted ATP-dependent endonuclease of the OLD family  ali follow..  14  262.......LFEDPDARLHPRMVAIMWELVSY--LPVQRITTTNSVELLSQVNLNAICRLVRTPEKINCFQLRRKDLGKEDFRRLTFHI-NRSLALFS--------RMWILVEGESEVWILEMEGI-RIVEFAQSGLKP--LKYVQAMGIQWYVL-TDGDEAGKKYGEIVEDMLDEEMVRADRITILPKRDIEHFFYANGFADVFIRLAQ.... 461
7 -6.890[R] COG2108 Uncharacterized conserved protein related to pyruvate formate-lyase activating enzyme  ali follow..  11  58...........................................................PWRRKDVVYANERPVRSEKDIIEEAKIQDARGAGITGGDPLARLSRTVEYIR----LKEEFGKKFHIHLYTTGILASEEALEKLYDAGLDEIRFHPDLNSKFFEREIENMKKAFDFGWDVGGPAVPGFEDRIKWFASLLDKLGAKFLN..... 207
8 -6.740[F] COG3363 Archaeal IMP cyclohydrolase  ali follow..  11  2.................................................YLGRILAVGRNSNGSFVAYSSRSFPNRTTSIQEERVAVVPVRNPYIAYNCIRIVGDTAVVSNGHTDTIADKVALGMNLRDAIGLSLLAMDYE--DELNTPRIAAAINGSEAFIGIVTADGLMVVPEETPVYISTYEQTEPAATEFKAGSPEEAAEFILKG... 173
9 -6.480[AR] KOG2191 RNA-binding protein NOVA1/PASILLA and related KH domain proteins  ali follow..  13  53....................................................KVLIP-SYAAGSIIGKGGQTIVQLQKETGATIKLSKLSKSK----DFYPGTTERVCLIQGTVEALNAVHGFIAEKIREMPQNVAKTEPVSILQPQTTQVKIIVPNSTAGLKGGATVKAVMEQSGAWVQLSQKPDGINLQERVVTVSGEP--EQNRKAVEL 239
10 -6.320[O] KOG2014 SMT3/SUMO-activating complex, AOS1/RAD31 component  ali follow..  17  2...........................................................................DGEELTEQETALYDRQIRVWGANAQRRLTKAHILVSG----IKGTVAEFCKNIVLAGVTLMDDRLANMEALNANFLIPPDENVYSGKTVAEICSDSLKDFNPMVRVSVEKGDLSMLGT................... 118

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24