current user: public

If you have questions about the server, please let us know.

Query: gi|13507742|ref|NP_109691.1| DNA gyrase subunit B MPN003 [Mycoplasma pneumoniae M129], from M.pneumoniae

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650
# E-value Template Links and tools%idFirst MEDNNKTQAYDSSSIKILEGLEAVRKRPGMYIGSTGEEGLHHMIWEIIDNSIDEAMGGFASTVKLTLKDNFVTIVEDDGRGIPVDIHPKTNRSTVETVFTVLHAGGKFDNDSYKVSGGLHGVGASVVNALSSSFKVWVAREHQQYFLAFHNGGEVIGDLVNEGKCDKEHGTKVEFVPDFTVMEKSDYKQTVIASRLQQLAFLNKGIQIDFVDERRQNPQSFSWKYDGGLVQYIHHLNNEKEPLFEDIIFGEKTDTVKSVSRDESYTIKVEVAFQYNKTYNQSIFSFCNNINTTEGGTHVEGFRNALVKIINRFAVENKFLKETDEKITRDDICEGLTAIISIKHPNPQYEGQTKKKLGNTEVRPLVNSIVSEIFERFMLENPQEANAIIRKTLLAQEARRRSQEARELTRRKSPFDSGSLPGKLADCTTRDPSISELYIVEGDSAGGTAKTGRDRYFQAILPLRGKILNVEKSHFEQIFNNVEISALVMAVGCGIKPDFELEKLRYNKIIIMTDADVDGAHIRTLLLTFFFRFMYPLVEQGNIYIAQPPLYKVSYSNKDLYMQTDVQLEEWKQQHPNLKYNLQRYKGLGEMDAIQLWETTMDPKVRTLLKVTVEDASIADKAFSLLMGDEVPPRREFIEQNARNVKNIDILast
1 0.000e+00UniRef50_A0A2N5HMC8 DNA topoisomerase IV subunit B (Fragment) n=1 Tax=Bacillus cucumis TaxID=1740721 RepID=A0A2N5HMC8_9BACI  ali  43  1MTKQKIQNTYDDSSIQILEGLEAVRKRPGMYIGSTDTRGLHHLVYEIVDNSVDEALAGFGNEIDVTIHKDGSVSVRDYGRGMPTGKH-ESGKPTAEVIMTVLHAGGKFGQGGYKTSGGLHGVGASVVNALSEWLEVTIHREGKKFHQRFEHGGKPTT-TLEEIGKTRETGTMIHFKPDTTIFSTIKYQYDTLAERLRESAFLLKGLKITLKEESTDKQDIF--HYESGIEAFVAYLNEEKEVLHDV-----------AYLEGEVDGIEVEFAFQFSDGYAETILSFVNNVRTKDGGTHETGAKAAMTRVVNEYARKAGLLKEKDKNLDGSDIREGIAAIVSVRIPELQFEGQTKGKLGTSEARTVTDAVVSQKMLYFLEE.............................................................................................................................................................................................................................................................................. 367
2 0.000e+00UniRef50_A0A078LAP7 DNA topoisomerase (ATP-hydrolyzing) n=10 Tax=Bacteria TaxID=2 RepID=A0A078LAP7_9CHLA  ali  32  2......SKKYDESTVKTLDALAHIRLRSGMYIGSNPDDGIYIMLKEVIDNSVDEFIMKNGKKIIVHLEESSKVSVRDFGRGIPLGK--------VVECVSQINTGAKYNDDVFQFSVGLNGVGTKAVNALSSHFLVRSHRDGQYVEALFSQG---KLLEEKKGKTKEPNGTYMEFTPDPEIFKKFYFQKEFILKRLWHYAYLNTGLEIEFNDE--------IIASKNGLLDLLNEEVKEDRLYEPLHY----------------RGAQLEFAFLHTQSYGETYFSFVNGQYTSDGGTHLSAYREGILKGVNEYAKKNFQG---------VDVREGIVGTILIKVKDPIFESQTKNKLGNNEIRAPIVQEVKEAVVNLLLKNKETANLLVERIVFXXXXXXXXXXXXXXXXXXXXXISFKIPKYHYQDNSKFGEKTMIFLTEGDSASASIVASRDPLTQAVFSLRGKPLNVFGMKLDQLYKNEEMYNLMSALNI----EDDIAKLRYQKVVLATDADVDGMHIRNLLITFFLTYFEGLVLNGHLHILETPLFKVRNKEKTYYCYSEEERDIAIKKLK-KGVEITRFKGLGEISPNEFKQFIG--EDIRLIPVTINNFSDIKHTLQFYMGKNTPERKQFIMKN......... 596
3 0.000e+00UniRef50_A0A0U5J9C5 DNA topoisomerase (ATP-hydrolyzing) n=6 Tax=Bacteria TaxID=2 RepID=A0A0U5J9C5_9BACT  ali  32  2......AKHYDESTVKTLDALAHIRLRSGMYIGSNPDDGIYIMLKEVIDNSVDEFIMKHGKKIIVQVDEEGLVCVRDFGRGIPLGK--------VVECVSQINTGAKYNDDVFQFSVGLNGVGTKAVNALSSYFVVKSYRDGEYVEAHFSQGHLKEEKKGKTSEA---NGTYVEFIPDPEIFKKYRFQNEYIAKRIWHYAYLNAGLIIEF--------NGEGIRSENGLLDLLNAEVTDDRLYEPLHY----------------RGKLLEFAFLHTQSYGESYFSFVNGQYTSDGGTHLSAFREGMLKGVNEFTKKNFQG---------VDVREGIVGTILVRVKDPIFESQTKNKLGNNELRAPVVQEVKEAVVTLLHKHPDIANRLIERIAFXXXXXXXXXXXXXXXXXXXXXISFKIPKYHYQDASPHSEGTMIFLTEGDSASASIVATRDPLTQAVFSLRGKPLNVFGMKLDQLYKNEEMFNLMNALNI----EDDIAQLRYNKVILATDADVDGMHIRNLLITFFLTYFEGLVLNGHLYILETPLFKVRNKEQTLYCYSEEEKNKAVNKLK-KQVEVTRFKGLGEISPSEFKQFI--SKNIRLIPVTINSFSDIKPTLQFYMGKNTPERKQFIMQNLINEDGL.. 603
4 0.000e+00UniRef50_A0A293NE36 DNA topoisomerase (ATP-hydrolyzing) n=4 Tax=Bacteria TaxID=2 RepID=A0A293NE36_9GAMM  ali  20  5...........AQQYQRKTDKQHVLDNPDTYIGSVYVPGLYKLFDEGVVNCRDHVIRMNQSHIDIDVDESGMITMTNDGNGIDVAKHPTEDLWIPEMIFGHLRTSTNYDKTQKKIVGGKNGFGFKLVLIWSKWGRIETVDHGLKYVQEFHDNLEKIDPPKITKAGATKPYTKVSFIPDYARFGVPKLSHDMTALLKKRVYDIAAKKIKVNYNGVQVPVKNFQQYLDLYIGS-----------------------KDDSKRVYEHPDNRWEYAVALAPKHEFTQVSFVNGICTFKGGKHVDYILGQILRKLCAYIEKK-----KKITVNQATIKEQLILFVRCDIENPSFDSQTKDFMNTPSAKFGSQCTVSDSFIEKIAKMGVMDMACQLTETKEA----GKTKKKMDGSKSKNIRGIPNFVDANFAGTDKSKDCTLILAEGLSAMSGIVSGLDRNVIGIYPLKGKVLNVRGATRD-ISENRELADLIKILGLEIGKEYKTMELRYSKIMIMSDQDLDGSHIKGLCINLFHSMWPSLVQDGFLSFMNTPILRATKGKEVLRFYNEGEHLKWKQSFPPKGWTLKYFKGLGTSTSTEFKEYFANKKVVDFQYKGVESDNTVDMVFNK---KRTEDRKGWLENYDKH-AYLD. 660
5 0.000e+00UniRef50_A0A1S5R451 Uncharacterized protein n=1 Tax=Pseudomonas phage pf16 TaxID=1815630 RepID=A0A1S5R451_9VIRU  ali  23  1......MTDFDLSQYKRLSEVEHVLARPGMWVGSTYTPALLKLFDEIISNSVDEHIRGSVKNIWVDIHPMAGEIIIEDDGGIPVKLHPEYGIYIPEMIFSEFRTGSNFGDEE-RTTAGLNGLGSKLTSVFSSEFRVETCDGTNQFIQVFKDNLSKRGEPVIR--PYDRKGTKISFIPDYSNCEMDEGTIAKIERRVYDIAGCNPKI-KVHFNGTTLKLNKFDDYVAMFSDSFVVDTQDK-----------------------------FEVALAACPESEFRQVSFVNGVDTFNGGTHITYVADQVAAKVREFIKKKHKVDVKPNIIKQQ-----MFLFIKCTINAPMFTSQTKEFLSTEVRNYGASYSPSDKFIKKVLESDVVQKVLDWVEGEKRRAELAELRNNKTTQTTNFLKRITKFDDA---TSKDRKLCSVFFTEGDSAKNTIMSARNAVLHGAFPMRGKLLNVRDIDVKKLASSEEFQNIMAIIGLKIGVKVESDDLRFGKIVQLTDADADGSHIAGLFFNMIHQFWPELFALGAIYRMNTPLIIATAGNKTFEFFNFKDYTAWAEANPKHKHKF--YKGLGGYDTKDFKR-FLADEDKYLVQITIEDADALDVAFDKKMAD---QRKLWLQE.......... 616
6 0.000e+00UniRef50_F0WWU7 DNA topoisomerase 2 n=7 Tax=Oomycetes TaxID=4762 RepID=F0WWU7_9STRA  ali  21  27.............................MYLESIYVPALYKIFDEIIVNALDNKKRDKMKALDVVIDTTNWIMIYNDGRGIPVQIHPTEQIYIPELVFGNLLTGSNFDDHSTRFTGGRHGYGAKLTNIFSNTFIVETGDTGMKYKQIWRNNMRELEEPHIEPSAGVKDYTRISFSPDLKLFQLESLSTDILRLLKKRVYDVAGCVDKVSLNGSVIPISGFESYIRGFE------------------FHQKLSTTKGNSNCVTSRVNKHWHIGVLPSEVGFTQVSFVNGISTLRGGTHVLHVVEQITRRVADHIVKKY----SEINATPAQVKPYLAVYINCMIENPTFDSQMKECLTSRPSSFGTLCNLPERFFKAVIRDTGIVEHTVQGIRSKQ---RSALMKKVSTARSKSIFNVPKLEDANLAGGSQSHECSLILTEGDSAKALAVAGLGRDRFGVFPLRGKLLNVRDATVNQLSKNSEFMNLCTILGLQMGESYDTIKLRYGHVIVMTDQDYDGSHIKGLLFNIFHTFWPNLLRSSFIQVFVTPIIKATSKRKVLSFYSLPEYLDWRKSLAGKNYYIKYYKGLGTSTSAEAREYFLNKHLIQMKWQSEEDGQLLEMVFSK---SRACDRKNWLLQNYDSSSFL.. 646
7 0.000e+00UniRef50_U6M9G8 DNA topoisomerase 2 n=4 Tax=Eimeriorina TaxID=423054 RepID=U6M9G8_EIMMA  ali  24  52............QRYQKKSQLEHILLRPDSYIGSTFPPGLYKIVDEILVNAADVKAREKMNAIKVTVDQQGFIKVWNDGEGIPVAIHKEHNVYVAELIFGQLLTSDNYDDSEARVTGGRNGFGAKLTNIFSSHFEVECADSKRKLKIKWTDNMGKQDPPVVTPFNGAGDFVSVKFKPDLQRFGMHRLDDDLVSLVRKRCFDLAGTSTAVYWNGTRLPVRSFVDYVDLYKRKSKKKGSDGETSDDSDVYEGERENGSEPKEDDDKENHRWEVVISQTDGSSFSQVSFVNSICTTKGGHHVTHVIEPLLAAL---VKKANAKNKGGMEIKPPHVKQHLWVFVKCLIENPAFDSQTKETLTTTVSRFGSKCTLSERTINAVAKSPILEGVLLWAQTKAQVELRRQMQVGKTKG-RERLTGISKLEDANEAGGRYAQECTLILTEGDSAKTSCLAGLSREKYGVFPLRGKLLNVREASFKQLKENREIQNILRILGLQINDKQDTRGLRYGSLMIMTDQDYDGSHIKGLLINMLHHYWPQLLQCNHFTEFVTPIVKVSKGSVEKAFFTLVEYDMWRKQAGNAGWKIKYYK................................................................ 711
8 0.000e+00UniRef50_A0A2R5FZY3 DNA topoisomerase 2 n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5FZY3_9STRA  ali  24  12.....SSDAKVNDLYERKTPEEHVLLRPGMYVGSVDSPGLVKLFDEILVNAADNRSAGKMNAIDISLDRSQRITVRNNGAGIPVVMHEKEKVYIPELVLGNLLTGSNFDDTVERFTGGRHGYGAKLTNILSNSFRVETLDAERNFEMEWHDHMKPTELSAKEVEARGGGYTEISFVPDLKVFKMARMDKGTLQRRVRDIAGLLAPSIQVTWNGVQIKVASFEEFASQFYVG------------------ATKTHARQNGALFEKGKWRVVVLQSP-LDNDPLMQSFVNRMATPRGGQHVDHILKQLEPALLEAATKK-LPKSNETKITRKMVQQKLALFVDCRLPNPSFDTQVKDKLTSKVTAQNGCELPASFLTSVVKKTGIVESIVAE----AQARDNAVLTRAPRRTSRKSLLSIPKLEDANWAGTSRSSEATLILTEGDSAKALAVAGLGRDGYGVFPLRGKPLNVRDATARTVVKNEEIKNLCTILGLDFKKKYASQKLRYGRVMLMTDQDFDGSHIKGLLINLFHFFWPELLKPGFLCEFVTPLIKVSSNSKKLSFFTMQDYENWLASSGPRAHSVKYYKGLGTSTSSEAREYFGNKHVLDFKSNSPTEAELIDMAFNK---KRASDRRDWI............ 676
9 0.000e+00UniRef50_R7QHX8 DNA topoisomerase 2 n=1 Tax=Chondrus crispus TaxID=2769 RepID=R7QHX8_CHOCR  ali  23  1...........................................................MNTIKVEIDTENQISVWNNGAGIPVEIHQKEKIYVPELIFGNLLTSSNYDDDEKKVVGGRNGFGAKLANIFSNEFTVETADRGKKYKQVFRKNMSEKDKPSIKSNGKKEAYTKISFSPDLTRFGMTHLDDDIVSLMKKRVYDIAGSNLKVYLNGKKIPVKSFKDYVALYNDK-----------------------GGPSTVMYERISDRWEVAITAS-EGQLTQLSFVNSIWTIKGGTHVTHVADQIVSKVAEHIAK----KNKGTKVKPFQIKSQLSLYINCLIENPSFDSQTKETLTTKPSKFGSKWSLSADLTKKVMNSEI-----IENVLAFAKFKESKELAKTDGGKRVRLTGITKFYDANRAGTREGSKCTLVLTEGDSAMATAFSGLSRDYYGVYPLRGKMLNVREAKHKQIMDNKEINNLKKILGLQHNKKYCMKSLRYGHVLIMADQDHDGSHIKGLIINFFDHFWPGLLQDGFLQELITPIVQCTKGQKKKVFFTIPEYETFCESSESAGWEGKYFKGLGTSTSADAKSYFSDLHLHEFKHTGVNDTDMIELAFSK---QRVNDRKDWIASYAP....... 562
10 0.000e+00UniRef50_Q9LCK1 DNA gyrase subunit B (Fragment) n=1167 Tax=root TaxID=1 RepID=GYRB_CYTHU  ali  45  1............................................................................................................DKDSYKVSGGLHGVGVSCVNALSTDMKVTVYSHGKVHQQEYKKGIPQYDVKEI--GESDLHGTKVQFLPDDTIFTSSEYKYETIANRLRELSFLNKGIRITLQDHRQVKSEIEMFHSEGGLREFVDYLDSTREKLIPTP----------LYMESDKGPIPVEVAMLYNTSYSENVFSYVNNINTIEGGTHVAGFRRALTRTLKSYADKSGMLEKLKMEVTGDDFREGLTAVISVKVQEPQFEGQTKTKLGNSDVMGAVDQVVGEMLNTYLEENPKEAKIIVQKVILAAQARNAARKAREMVQRKNVLSGSGLPGKLADCSESDPEKCELYLVEGDSAGGSAKQGRDRKYHAILPLRGKILNVEKAQEHRIYENDEIKNMITALGVSFGTEENLTKLRYHKVIIMTDADIDGSHIRTLILTFFFRYMRALIDGGHVYIAQPPLYLVKRGKEEKYCWTEEQREAAVKELAKDGKE..................................................................... 470
11 0.000e+00UniRef50_A0A2E4WZW4 DNA topoisomerase (ATP-hydrolyzing) n=4 Tax=Bacteria TaxID=2 RepID=A0A2E4WZW4_9DELT  ali  20  6MATTEDSL---SKKYQKKTDKQHVLDNPDTYTGSTYVPGLYKLFDEGIVNCRDHQVRMPVSYIDVSITDDGIITMTNDGNGIDVEKHPEYDIWIPEMIFGHLRTSTNYDKNEKKIVGGKNGFGFKLVLIWSEWGEVETIDHGLKYVQKFSDNLNVIEKPSITKCK-KKPFTRVTFKPDYKRLGINGLSTDMMSLFKRDIAAVTDKKVKVKYNGETVSVSHFQQYVDLYIGSKSD-----------------------TKRIYEQANERWEYAVCMAPKEEFTQVSFVNGIFTGKGGKHVDYLLNQLVRKLTAYIKTK-----KKVDVKSSTIKEQLMLFVRCDIENPTFDSQTKDYMNTPSSSFGTTCDITEKFVEKVAKMGVMDNACALTEVK-----ENKEAKKTDGAKTKSVRGIPKLIDANFAGTNKSNECTIIFCEGDSAKAGIVSGLDRNVIGVYPMRGKLFNVRGETQKRILENKEITEIKQILGIESSKKYTTEKLRYGKVLFMTDQDLDGSHIKGLGINLFDAEWQSLLDPGFIGFMNTPILKARKGPQELVFYNDGEWESWCAANDPKGWKVKYYKGLGTSTSKEFKEYFAQKKIVSFSSSGQESRDAIDMVFNK---KRANDRKTWLEAYDRNL-YLD. 661
12 0.000e+00UniRef50_A0A2I0Q690 DNA topoisomerase IV subunit B (Fragment) n=1 Tax=Euryarchaeota archaeon HGW-Euryarchaeota-1 TaxID=2013767 RepID=A0A2I0Q690_9EURY  ali  43  1..........................................................................................................................GLSVVNALSDLMVADVFRDGFHWQQTYSRGLPTS--LVKKLEPSEKHGTKITFKPDFSIFSIEDYNGEKITEILREKAYLNSCVKIVFADKKSNKTAVFE--NKGGLVEYLKDITKNKTFIIEKPFFLKSQTEKIF----------VDIAFTYTTGYGDNILSYVNNIRTSEGGTHVTGFLMGLGRAISKYFKAKQT--KGFDAVETEDIRAGLVAIISVNFAEPQFEGQTKAKMGVPWVRGEVDKIINDAVYTFLDENPEISKRLFAKLKQTADGRIAAEKAKDLVRRKGELDIISLPGKLADCSERDPEKTELFIVEGDSAGGSSKMGRDRKTQAVLPLRGKILNVEKAGLERMLNSEVITPIIAALGTNIDDKFDINKLRYGKIIIMADADVDGSHIQTLLLTLFFRHFKPLIEQGHIYSAVPPLYKVYKGNKEAYAYSDEERDKLLQEIG-SDANVQRYKGLGEMNPDQLGETTLNRDTRTLKRIIIEDAERADKLFTILMGSDVEPR................ 502
13 0.000e+00UniRef50_UPI000473B353 DNA topoisomerase type IIA subunit B n=1 Tax=Bacillus flexus TaxID=86664 RepID=UPI000473B353  ali  28  2......SNEYGNDSIRSLSDRDAVRMRVATYAGGNDKAGAFTTVREVVANSIDEFKTHHGDEITIQHLTDGSIKVADKGRGCPVDWNESEGKYNYQLIFESLNAGGKFSQSNYNFSTGLNGIGNSLVVLSSKFANIEVIRDGHKYNLEYLKGINEGGLHKEKLDSETPTGTTIHWKPDLEVFLENDFPEEWFVDYLKQQAIVNKGLKLIFINQK---GEQQEFYYEDGIVDYLKESAEGKE--FTAIQYLETEAVGRDREDKEDYKSKYEIAFCFNNEIT-KLESYHNSSYLKNGGAPHDAIKTAFVFAVDKLIKDKGKYNKNEKKINFSDVEDSLMIVSNTYSSETSYQNQTKFAITNRFIQEHMSKYLKEQLEIYFIENPIDADKIVERTLINKRSREKALKTRNDQLSQTVKNSLTRPEKFLPCRSKDNSEVELIIIEGDSAMNSVKNSRNSKIQCVMPIKGKSLNVVKSNLDSILKNKEIRGIFQILNCGMEYKFNIDDMSVNKIIIFSDEDEDGMHIRSLIIAIMRILAPQIIEKGHLYVLESPLYKIENGKDLHLVYSEREKNELVRNL-TGKVNVQRFKGLGGLNSSMLSKTAMHPENRRLTQIKMDDAVKSTKTLEMFMDKEVEERKEFIQTHGDK...... 644
14 0.000e+00UniRef50_Q94BZ7-2 Isoform 2 of DNA gyrase subunit B, mitochondrial n=12 Tax=Pentapetalae TaxID=1437201 RepID=Q94BZ7-2  ali  42  84..ETTTSKGYSSEQIQVLEGLDPVRKRPGMYIGSTGSRGLHHLVYEILDNAIDEAQAGYASKVDVVLHADGSVSVVDNGRGIPTDLHPATKKSSLETVLTVLHAGGKFGGTSYSVSGGLHGVGLSVVNALSEALEVSVWRDGMEHKQNYSRGKPITTLTVLPLESKGTKGTSIRFWPDKEFTTAIEFDHNTIAGRIRELAFLNPKVTISLKDDDPEKTQYSEYSFAGGLTEYVSWLNTDKNPIHDV-----------LGFRREINGATVDVALQWCSDYSDTMLGYANSIRTIDGGTHIEGVKASLTRTLNTLAKKSKTVKEKDISLSGEHVREGLTCIVSVKVPNPEFEGQTKTRLGNPEVRKIVDQSVQEYLTEFLELHPDILESIISKSLNAYKAALAAKRARELVRSKSVLKSSSLPGKLADCSSTDPEVSGMY.................................................................................................................................................................................................................... 516
15 0.000e+00UniRef50_A0A1H3FU23 DNA topoisomerase (ATP-hydrolyzing) n=2 Tax=Thermoactinomyces sp. DSM 45892 TaxID=1882753 RepID=A0A1H3FU23_9BACL  ali  33  2......SHTYTSDSIQSLGILGGVRAKPA----SIGLESHNHTFLEILGNSIDEHRAGWGKEIIVTKHVDGSVTVRDFGRGVPMDQNRV-GDWSYKKVFDELWAGGKYDGGSYQYSLGTNGVGATGTNYTSDFFQVTVHSSGKVYQVEYEKGVETSDGIQICKNEKIAIGTTITWRPSAEFRGKSEIDDDFIITTLQDQAIVNGGLKFLFKNEQLEEEQVF--YFQDGVKDYIRSISSEEHSLTDVVKW-TTEQKGRDNENDKDYKIKADIYFSFNRETSFS-RYYHNSSWLENGGTPEDFVKNSFTFVLDKFLKDQNLYTKGEKKISFDDVEDSLMIVTSTYSTISLFTDQTKKKIGSDFMKRVITTWLREQLEVYLVENPQEAKLILSQVLVNKRSREKAEKTRLDVRKKTVNNLTARIDGFINCKSKDASKTELYIVEGKSALGSTKQGRDAEFQAIYALRGKILNCLKADYDKIFRNEIIVDLLKILGCGIEVKFDLNNLRWSKLIICTDADVDGFHIRTLLLTTIYRLMPTLLDEGRVFIAESPLYEITNQNKSYFAYSDREKEEIVSTLK-GNVLIQRSKGLGENTAEMMWETTMNPETRKLVQVMKDDVEQTQGYFEMFLGDDLVSRKQYIEENLSF...... 649
16 0.000e+00UniRef50_M4BBA0 DNA topoisomerase 2 n=1 Tax=Hyaloperonospora arabidopsidis (strain Emoy2) TaxID=559515 RepID=M4BBA0_HYAAE  ali  19  87MGGTGTAKQSIEQIYQKKSQLEHILLRPDTYVGSTYVPGLYKIFDEIIVNACDNKQRDKMNTLKVTIDEENEISVWNNGKGIPIVLHKEHKVYVPELIFGHLLTGSNFDDKKKKTTGGRNGYGAKLANIFSNEFIVETADSKQRYRQVFKSNMSKKNPPSITKWA-QKDFTCISFKPDLERFKLNFLNGDIVSLRVYDVAGVSGKGLNVFLNGEKIPIKSFPQYVALYPGPRGFEAERDTNEGEDDVSPEENSGGGDDDEDYEKPDERWQVGVGMSEDGFQQV-SFVNGICTTKGGQHVNYIVDQIATKLVSVLKK----KNKGDAVKPNYIKNHIFVYVSALIENPAFDSQTKETLTTRANSFGSTFNLSDKFLKQVEKS---GLVEKILSFAAFKQTAELRRKGGNGGKRSRLTGIPKLDDANHAGTAKSKDCTLIVTEGDSAKTVAVGGLGRDYYGVFPLRGKMLNVREASHTQILKNEEIQNVVKILGLKYGQKYESTK------------------------------------------------GLRKGRTKEVFYTMPEYEGWRERTNQRGWIIKYYKGLGTSTAAETKEYFSDLHQIGFIYDGDGDADVIDMAFSK---KRVEDRKDWLRGY......... 728
17 0.000e+00UniRef50_A0A2R6M5Y7 DNA topoisomerase IV subunit B (Fragment) n=4 Tax=cellular organisms TaxID=131567 RepID=A0A2R6M5Y7_9EURY  ali  51  11......................................................................................................................................................................................................................................................................EGGEVQVEVAMQATDELQGSLHAFANNINTREGGTHMTGFKTALTRVVNDYATDNDLLRDLEDTLKGEDIREGLTAVLSVKHPDPQFEGQTKTKLGNSEVRGIVESAMHEHLGTFFEENPDTAETIVSKAVEAAKARKAAQKAEELTRRKSALDSTALPGKLADCQTRDPDEAELFIAEGDSAGGSAKQARNPEFQAVLPIRGKVLNVEKHRLDRILENDQIRNIITAIGTGIGDEFDVADARYKKIIIATDADVDGAHIRTLLLTFFYRHMRPLLENGYVYATQPPLYRIRYRGETYDAMTDEERDEIIANCGGEPDQVQRFKGLGEMNPEQLWDTTMNPENRILKQITIEDAATADKMFSVLMGDAVEPRKEFIKEHAPEAEWVDI 399
18 0.000e+00UniRef50_A0A2A5RJ30 DNA topoisomerase (ATP-hydrolyzing) n=1 Tax=Lactococcus fujiensis JCM 16395 TaxID=1291764 RepID=A0A2A5RJ30_9LACT  ali  28  1MTEIEKTNQ----QLKELSGLTHLRLRPGMYVGSVANA--YHLYREIRDNASDEIINGFATDVWVTLHEDGSLSVRDNGRGLPIQPMQMIDIPSARAAVSRLNVSSHYELDNS-ASAGTNGVGSKAVTALSDFVDLKIWRDNKYYSDHFYYAQPQSVENLPEGDKVGYHGTEFTFKPSEEVFESIDFDFDLLKSDLHRLAYLNASATYHLSDET--SEQKITLHEEGGLKAYVQFLSENSEGQLITSIHEFEGTVTTESKIPNAPATTIQIALAWTTASEMTAIGFTNTLFNSQGGTHIDGFLQGISRLFNNYNKNLNLSKD---TIEARDLRPGLIAVISLLHTDPVYSSQTKDMMTETSAKSALNKITYEQGQFEWDKYISEVEAVIKQSIQRAQKFADFSKIKLDTKENKAKLSKKLVPAKKLYGANNVTAAELFITEGDSASGNLIQCRNGYYQAVMPVRGKVINSFKATPEKVMGNEEAVTILNAIGAGIGSNYNEEKLNYNHVIIATDTDSDGDNISSLITTLIFSYMPDLIKNGHLYRAIAPLYANTKNKKVINTYSQQEQEALLNS-GQEIVKVARYKGLGELNVPLTRETLVNPETRRIFQFTTEDFDQAYETQQMLMGTKVEARREFLMENGDFA..... 666
19 0.000e+00UniRef50_H2Z116 DNA topoisomerase 2 n=2 Tax=Ciona savignyi TaxID=51511 RepID=H2Z116_CIOSA  ali  21  1...........................................................MSTIKININPENLISVWNDGKGIPVVEHKVEKMYVPEMIFGHLLTSSNYNDEDKKVTGGRNGYGAKLCNIFSTKFKVETRDEKKIFSQVWSDNMSKTHERKI-KSYDKSDFTCVTFQPDLAKFHMESLDKDTVALLSRRAFDVAGSTHKVFLNGSKLPVKNFKEYVQLY------------------VAKLHDEGGDPLKIIHEQVNPRWEICLT-SSDKGFQQVSFVNGIATTKGGRHTDYVIDQVAKKLVEVVKRKN---KGGVEVKPFQIKNHCWLFVNCLIENPTFDSQTKENMTLQAKKFGSQCTLTEKFLKSASSSGIVDNIMNWVKFKAQSQ-----LQKKSAGKSNKLKGVPKLDDANDAGTKHSMDCTLILTEGDSAKTLAVSGLSVRDKGVFPLRGKLLNVRDASHKQIMDNAEINNIVKIMGLSFKKKYDSDDLRYGRIMIMTDQDHDGSHIKGLLINFFHSNWPKVLQRRMLEEFITPIVKVTKGSQVLCFYTIPEFEEWQASIDHPKWKVKYYKGLGTSTSKEAKSYFMTRHRIKFRYSGPDDDGCIDMAFNK---KRADDRKEWLTNFME....... 568
20 0.000e+00UniRef50_A0A257T994 DNA topoisomerase (ATP-hydrolyzing) n=1 Tax=Acidithiobacillus ferrivorans TaxID=160808 RepID=A0A257T994_9PROT  ali  31  2........SYSAEQFTVLKGLEPVKLRPGMYTRTTCPT---HIIQEVIDNAADEALAGQATRIDVTVCNDGSVIVEDNGRGIPVGIPPGESRPAAELAFTTLHAGGKFDKMAYRFSGGLHGVGVAVTNALSQRVEVEINTGNGRYRLAFTQGDVSEPLTRLEDCGPRTHGTRVQVWPNGQYFDSAKINVRELTHLLRAKAILLPGLQVSL---TLPEQEPVVWKYSEGLAEYLAEIVADLELATPI---FSGASYQDGDTNGFAKGEGAAWALCWSGNVMPNPETYVNLIPTLNGGTHESGFRAGVFEAVRSFMEHHSLVPAK-LKLVQDDVTGKMALVLSARVLDPQFQGQTKDKLTSRDAHKLMAQTMRDPLELWLNSHPDAGKAIAELAIQNAQARTRAAQKIER---KKGSGLATLPGKLTDCESEDIQRNELFV----------------------------------DADQIFKNQEVHNMAVALGIQADPDRVLAGLRYGKIMILSDADVDGSHIQVLILTLFLRHFPALLQRGHVFVVKPPLYRVWRGRRKIYCEAEAERDAAIERLRTEGVKVQRFKGLGEMNPDQLWETAMCPDTRSLLSMTATDQAALHTRFGLLMAKQAAGRREWMERDGWS-AEIDI 622
21 0.000e+00UniRef50_A0A1T4LF79 DNA topoisomerase (ATP-hydrolyzing) n=18 Tax=Bacteria TaxID=2 RepID=A0A1T4LF79_9SPIO  ali  32  103.TKGKKLAAYDDSQIKHLDALEHIRLRSGMYIGSNQNDGIYVLLKEVIDNSIDEFIVGFGNRIDIQIVE-NRVKVRDYGRGIPLGK--------VVECVSQINTGAKYNDDVFQFSVGMNGVGTKAVNALSSYFKVIAIRDGYATEAVFERGKLVAEKNTVKLSKPAKNGTYFEFVPDEEIFGKYSFNMEFVEKRLWNYAYLNTGLTINF--------NGQVFTSQNGLLDLLQ----------------KELEADTIYPIGSYTGAHLQFAFTHTNAYGENYFSFVNGQFTSDGGTHLSAFKEGFIKGVNEFFQENYKSED---------IREGITAAVLVKVKDPIFESQTKNKLGNTDIRQWIVSEVQSGLDDWLHKNPKAAEMXXXXXXXXXXXXXXXXXXXXXXXXXXXXVSIRIPKRFHLEDGTKGENSMIFITEGNSASGVMTHSRDANSQAIFSLRGKPENMYGKKQTDIYKNDELFQLMRALGI----ENSVEDLRYSKIVIATDADNDGFHIRNLVLTFFLGYFEELVTSGRVWILETPLFRVRTKKENIYCYSEDERDKAQKKLG-KNCETSRFKGLGEINPSEFRQ-FIDPQTMHLTPVEVSQLKVIPQLLAFYMGKNTPERRSFIEQHLLSNAEIDV 712
22 0.000e+00UniRef50_A0A2G6CAK3 DNA topoisomerase IV subunit B (Fragment) n=1 Tax=candidate division SR1 bacterium TaxID=2044938 RepID=A0A2G6CAK3_9BACT  ali  42  4ITNATNQNEYDASNIKVLEGLEPVRQRPGMYIGSTDIRGLHHMIQEIVDNGVDEALAGHCKNITTVLHEDGSVSVYDDGRGIPVDKHPKTGKSALETVFTVLHAGGKFDKSVYKVSGGLHGVGASVVNALSEWLEVTVHKHGKIHFQRYERGVPQGDLQVI--GETTRQGTTVKFKPDAQIFDTVEFISGTELSRLKQCAYLTPGVTFTFIDEHTKEKQRF--YFEGGINTWLHNLVGDQTR-----------LGIQHGLSAEGKDCYVDLCFQFVATSTDYVMSFVNNIPTKDGGTHVLGFKSAVLRVINEIAKEKGKIDKKIGEFQYADVLDGLYAILNVKIPEPQFEGQTKGRLGNSYVRKQVENIVYEYINAYFRQNEEEFDQVFEKINLAARARLAAKFAKETVLRKNVLAGGVLPGKLSDCARK............................................................................................................................................................................................................................ 418
23 0.000e+00UniRef50_A0A2J0KKX4 DNA topoisomerase IV subunit B (Fragment) n=1 Tax=Candidatus Moranbacteria bacterium CG08_land_8_20_14_0_20_34_16 TaxID=1974670 R  ali  52  20............................................................................................................................................................................................................................................................................VEVAMQYTGSYKEHIFSFANNIFTPEGGMHESGFRAALTRVINSYARKSGALKEKDDNFTSEDMQEGLTAVISIKLKNPQFEGQTKAKLGNGEARGIVSAVVAEALAEYLEAHPNNAKAIMSKISITAKARIAARAAKDAVIRKGALEGMTLPGKLADCSSRDASQSELYIVEGDSAGGSAKQGRDRKFQAILPLRGKLVNVEKTTLDKVVKSDTLKPIIIALGAGIGETLNLDKLRYHRIIIMADADVDGLHIRTLLLTFFYRYFEELINRGHIYIAQPPLFRIQKGKEVIYVYSEEEKNKLINSFRQKGVTIQRYKGLGEMNPEQLWETTMDPEKRMMLKVTVEDAEKADQMFETLMGSNVEPRRRFIQTHAKNVKNLDV 430
24 0.000e+00UniRef50_V6LMQ8 DNA topoisomerase 2 n=1 Tax=Spironucleus salmonicida TaxID=348837 RepID=V6LMQ8_9EUKA  ali  24  7...............KRVDPREHVLLRPDMYIGSIFVPGLYKIFDEIVTNASDNKQRDKQSYIKCWFEPDGKITVQNDGVQGFLSFNKQEKMYIPELAFGVLMTSSNYDDSEERVTGGRNGFGAKLTNIYSKQFKVEVCEGGKKYTQLWTNNMLNRNEPEIKDTSSNQNYVKISFIPDYARFQLTDLNNDNLRRRIFDIAGCNEKLQ-VFLNEERLPVSGFQDYARMFFTASSPKFVEENQPVAEPTDATKQVFWQDQYISYYSPHDFWDIAVFYSEAQEFQQLSFVNSICTLEGGMHVELMIDNLIAPLNDAVKKFLAKDGIKDPLTRAQVKNNVFIVIRSLIVNPSFDSQTKVALRTPKVQLKKTLTFIDTDPSYKKFIKSQNNDTLLYSLGQLVSKTQSKLLAKMDGAKKANIIVPKLDDAVAAGTSQSNKCFLFLTEGDSAKGLAVEGISQKFYGVFPLRGKVLNVREVSHDKLANNAEINNLKKILGLRQQCKYDIAQLRYGKVVIMADQDYDGSHIKGLILNVFDTFWPNLLKSGYLQEFITPIVRCRRKNEVIDFYTLQELETWIEQIDIKKWQVQYYKGLGTSDKAEAREYFTSNNIVKNQKQFVHDKDALNLAFHKQLSN---QRKIWLNETSADV-YLD. 695
25 0.000e+00UniRef50_A0A0P0YMC1 Putative DNA gyrase/DNA topoisomerase IV subunit A n=1 Tax=Yellowstone lake mimivirus TaxID=1586712 RepID=A0A0P0YMC1_9VIRU  ali  21  7...........STKYQQKTDKQHILDNPDTYIGSTYIPGLFKLFDEGIVNCRDHVIRMPVSYIDVTIEADGTIIMTNDGNGIDVAEHPEYKIWIPELIFGHLRTSTNYDKNEKKIVGGKNGFGFKLALIWSIRGSIETVDHGLKYKQEFNDNLNEICPPQITKCTGKKPYTKISFCPDYARFGMTEDIISLLKKRVYDVAAVTDKTLKVKYNSQLVPVKNFVQYIDLYIG-----------------------NKDEVKRVYEDNGERWEYAVALSSSHEFAHVSFVNGIHTSKGGKHVEYILNQITRKLVEYIEKKRKVKVNPNNIK-----EQLILFLRCDIENPAFDSQTKDYMNTPFSKFGSVCVVSDKFIEKLAKIGVMDAACALTEVK-----ENKAAKKTDGTKTKNIRGIPKLIDANWAGTERSSECTIIFCEGDSAKAGIVSGLDRNSYGVYPMKGKILNVRGENIKKISENKEIAEIKKILGLETGREYDTNDLRYGRVLIMTDADLDGHHIKGLCINLFHTQWSGLLQPGFIGFMNTPILKAHRGNQTIVFYNEGEYNEWKGSINVNSWKIKYYKGLGTSTGKEFREYFKQKKIVGFEHTGKESDETIDLIFNK......................... 634
26 0.000e+00UniRef50_A0A1I7ZEF9 DNA topoisomerase 2 n=1 Tax=Steinernema glaseri TaxID=37863 RepID=A0A1I7ZEF9_9BILA  ali  19  145....THKKLSIEQIYQKKSQLEHILLRPDTYVGSVYVPGLYKIFDEILVNAADNKQRDPMNKIKITIDEKNEISVYNNGRGIPVVMHKEEKLYVPELIFGTLLTSSNYNDDERKVTGGRNGFGAKLCNIFSTKFTLETRELGKKFKQTWIDNMTKDKDCEISKAT-GEDFTKITFTPDLAKFKMTALDDDIIALMSRRAYDVAGSTKKVFLNDKEIPIKGFKQYVEFYVKN-------------------ATEGEDAPKMVHEACGDRWEVALAVSDKGFQQV-SFANSIATTKGGRHVDHVADQIVAKIIEVVKKKTAKGGFK--IKPFQIKSHMWVFVNALIENPTFDSQTKETMTLQAKSFGSSCKLSDKKCHLXXKSFGSSCKLSDKFFNAAFKQLEQQDKKCSSKKTSKLKGVPKLEDANDAGTKNSHLCTLILTEGDSAKTLAVSGLGRDRFGVFPLRGKMLNVREASICAIGDNAEINALLKIIGLQYKLKYDDEDVKTLRYGLGTSTSKEAKEYFSDMVRHRIKFQ---------YSGPNDDEAATKGKEELSFFSIPEYVEWRQNTNWHTYRVKYYKGLGTSTSKEAKEYFSDRHRIKFQYSGPNDDEAVDLAFSK---KKIEERKIWLTRWMETRKE... 838
27 0.000e+00UniRef50_A0A1D8GCR0 DNA topoisomerase (ATP-hydrolyzing) n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1D8GCR0_9CLOT  ali  34  3.....KKHNYDNESLSTLVEKDKVRLRPGVIFGSDGLEGCQHTLMEIVGNSRDEACEGWGNVIEVTRFKDHSIEVKDEGRGIPLEWNPKEQKYNWEIVFTILYGGGKYDNNSYQFSIGLNGLGTAATQFASEYMDVTVFRDEYKYELHFAKGDNVTGTEIKTKCGYEHSGTIIKWKPDLAVFNDINIPLDFFKTSLKRQAIVNKGITFKLYDEE--SGETFTYLYENGIKDHIRQLSGEK--GFTELQYFELETKGRDREDKPEYKVKLEIAFCFNNEVN-LLEYYHNSSFLEYGGSPDKAVRNAFVYALDQKLQKEGKYNKDEKKITFQDIGDSLLLIANTYSTITSYENQTKKAITNVFIKDVMTDFLKEKLEIYFIENKLETEKILEQVLINKRSREKAEKTRRKQLSKKIDNISNRVKKFVDCRSKDKNKRELFIVEGDSALGSTKMGRDAEFQAIMPVRGKILNCLKSDYDKIFKNDIIMDLLKVIGCGVETDFDLSNMSWNKLIICTDADVDGFQIRCLIITMLYVLTPTLIEEGYVYIAESPLYEISDEKGHSYFYTEGEKAQILKKIK-GKFKIQRSKGLGENEPEMMWETTMNPDSRKLVQVTPAEAKATQEAFELFLGDNLPGRKQFIEEHGH--KYLDI 658
28 0.000e+00UniRef50_A0A1Z8V8H9 DNA topoisomerase (ATP-hydrolyzing) n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z8V8H9_9PROT  ali  20  1MSSTDSEL---AKQYQRKTDKQHILDNPDTYIGSVYIPGLYKLFDEGIVNARDHVMRMFVSYINANIEEDGTIILSNDGNGIDIAKHPEYDIWIPEMIFGHLRTSTNYDKTEKRIVGGKNGFGFKLALIWSTYGKIETIDHGLKYEQTFRNNLDIIEDPIITKPKTSKPYTKVLFKPDYARFGITGLSSDMIGLLKKRVFDIAAKKVKVGFNEELTPVKNFQQYVDLYVGSKTE-----------------------TKRIYETYEERWEYAIALAPNHEFTQVSFVNGICTFKGGKHVDYIMGQITRKLCDYIEKK-----KKVKVSPTAIKEQLMLFLRCDIVNPSFDSQTKDYMNTPSAKFGSSCTVSDGFIEKVAKMGVMEMACSLTE-----AKENKMAKKTDGSKTKNVRGIANFIDANFSGTTKSAECILILCEGLSALSGIVSGLDRNTIGIYPLKGKLLNVRGEQIKKIADNKEITDIKKILGLETGCEYNHKHLRYGKVMVMTDQDLDGSHIKGLCINLFHSEWSSLVHPGFISFMNTPILRAKKGAQVKLFYNDGEYNQWKEENGTQGWTIKYFKGLGTSTSSEFKEYFANKKIVDFVHNGKTSDDTIDKVFNK---KRPDDRKVWLENY-DKTAYLD. 662
29 0.000e+00UniRef50_I2JRH2 DNA topoisomerase 2 n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JRH2_DEKBR  ali  24  41.SSKKNGGKTASDNYQKLTQLEHILKRPDTYIGSVEVPGLFKIFDEILVNAADNKIRDPMKRIDVKIDPNNLFSVKNDGRGIPVEIHTKEKIYIPELIFGNLLTSSNYNDKEKKVTGGRNGYGAKLCNIFSTEFTVKTADNGKTYSQTWHNNMSIVDKPKIKPMKTKSEYTEISFKPDLAKFGMESLDDDILGVLRRRVFDLCGSVRGVTLNGKALKINNFKQYTELYVKALSENQNGSSSRSSSXVKVEQIESTKKVPLIYYAINDRWEIAFSLS-DGNFHQVSFVNSIATTSGGTHVDLIVNMLVNKIMEHIKKKHRR----AMLRPFQIKNNIFVFINCLIENPAFTSQTKEQLTTRPSQYGGRXL--ELPETFLKKVFNSG--ILDQVMDIAQANADRALKRMDGRKKNRITGYPKLEDANXAGTREGYKCTLILTEGDSALTLAVAGLGRNYYGCYPLRGKLLNVREASADQIMRNAEIQAIKQIMGLQHKKKYDPANLRYGHLMIMTDQDTDGSHIKGLIINFLVDFLPWSFRGSKFF.......................................................................................................... 622
30 0.000e+00UniRef50_A0A146HR65 DNA topoisomerase 2 (Fragment) n=1 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146HR65_9AGAR  ali  24  1.........................................................................SVYNNGSGIPIEIHSEEKIYIPELIFGNLLAGSNFDDDEKKLTGGRNGFGAKLANIYSHEFTVETADNGQKYKQTWTEHMGKCGKAKITKNSAGENWTKITFRPDLKLFKMDSIDEDTASLLRKRTWDMAGTVKKVYYNGKRVSIKNFKQYVELYVTSAAEQKEDG------------DAAKAKSALVYERISNRWEVGFTVSDGSSQHV-SFANSIATTKGGTHVNLIADQISKAVIAAIGK----KNKGATVKPAQIKNHMWIFINSLIENPTFDSQTKEQLTLPASKFGTKPMLSEDFIKKVMKSSI-----IENILNWAQFKADQQAKKTDGSKRSRLTGLPKLSDANNAGTKYAKNCTLILTEGDSAKTLAVAGLSRDNFGVFPLRGKMLNVRDAKHEQIMKNEEIQNIKKILGLQHGKSYSSTDLRYGRLMIMTDQDHDGSHIKGLLINFFDKFYPSLLKDDFLVEFVTPIVRVRKGNKKIDFFTIPEYEQWLEETGSDKWEPKYYKGLGTSNDADAREYFMEKHMIPFAATQEGDRDLIDLAFNK---KKAEDRKEWLRQF......... 555
31 0.000e+00UniRef50_L8WTI6 DNA topoisomerase 2 n=1 Tax=Thanatephorus cucumeris (strain AG1-IA) TaxID=983506 RepID=L8WTI6_THACA  ali  23  119.ATIQRKDKGASEMYEKLTQLEHILKRPDTYIGSIFVPGLFKIVDEILVNAADNKINDSMDTIKVEIDEEGLISVYNNGKGIPIEVHSKEKIWIPEMIFGHLLTSSNYDDDEKKLTGGRNGYGAKLTNIYSTEFTVETADKKQKYKQTWMNNMSKPGKAKITKNPRGEEFTKVSFRPDFKRFGMEGMDHDIASLLKRRVYDMAGTVKKVFLNGERIKIKNFKQYVEMYVNSAKENAGEGEGPKPTVIF--------------EEISPRWEVGFALS-DGSFQQISFANSIATTKGGTHVNMIAEQISKNLIAGIEK----KNKGAKVKPQTIKNHMWIFVNSLIENPTFDSQTKEWLTLPSSKFGSRPHVSEDFMKRVS-TTVAKSGIIDNVLSWAKFKADQENKKTDGTKRTRLTGIAKLSDANNAGGRHASECTLILTEGDSAKSLAEAGLSRNNFGIFPLRGKLLNVREATHDQVMKNAEIQAIKQIMGLKHGVAYDVGSLRYGSIMIMTDQ-------------------------------------VTKGNQKINFFTIPEFQKWNEENNKDKWYVKYYKGLGTSKDSDAREYFMEKHMIPFAKTEEGERELIDMAFNK---KKADDRKDWLRQF......... 734
32 0.000e+00UniRef50_P90520 DNA topoisomerase 2, mitochondrial n=6 Tax=Dictyostelids TaxID=33083 RepID=TOP2M_DICDI  ali  24  79..SEKTTTRKIEDIYQKKTPTEHVLLRPDMWVLSTYIPGLLKIYDEILVNAADNKKRDKMSFIKVEINPNNSISIMNDGKGIPVVMHQTENCYVVEMVMGNLMSGSNFNDSELKVVGGRNGFGAKLTNIFSKEFTVETVDKGKKYFQRWSNNMGDRSEPIITPGEGESDYTKITFKPDLEKFKIKSLWDDNIERRLYDIAGCNTELMVTLNGKRLNY--NFQSYVKLY----EHHLNNSTKRED------NEEQYREESFEFGEISPRWKIGIGLSETGQFTQVSFVNSINTVKGGTHVNFLADQIVRYVGEKLKKKH----SDLEIRPMNIKHHLALFVNCLVDNPSFDSQSKETLTTKPMLFGSTPEIPESLLAQFVKNSKIIERVAGWALMKQKADLI-HSTSGRQSKTTLIKSISKLDDANWAGGLKSKECTLIITEGDSAKSLALAGLSRNSYGVFPLRGKLLNVRDVASKQLLSNEEINNLTTILGLSHKNSYDMEDLRYGRVMIMADQDHDGSHIKGLVMNFIHYFWPNLLKRGFLVEFVTPIIKATKSSQKKSFFTIKDYEKWRETISSKQYTIKYYKGLGTSTSAEAKEYFLDKHVIKFIW-GDEADDLIKMAFAK---DLSSLRQRWIKE.......... 774
33 0.000e+00UniRef50_K0RFT0 DNA topoisomerase 2 n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0RFT0_THAOC  ali  22  97...RTKTSKTIEETNQKKSQREHVLIRPDTYIGSTYTPGFYKIYDEIVVNAADNKQRDPMDRLEIEIDAENTISVMNNGKGIPVVEHKEHGCYVPTLIFGHLLTGSNFDDDEKKTTGGRNGYGAKLANIFSTEFTVECLDNEKQFTQTFRDNMSRTEDPSVKKATKSEDYTKITFKPDLNRFNMEKLDEYAVGLLSRRAYDIAGSM------------------SGKGGKKLSVFLNGKKLPIKDFKSYLALFDDLDAPLAFERVNDDWEVGVGVNTEGSGKQISFVNAIATTKGGSHVNFITSKIVKAVQAVVEKRNKGGKKAQP---AQIKNHLTVFINCLVENPTFDSQTKENMTLKQSSFNKKIALSDQFMKRWK--------------SAAYKL----------------KGITKLDDANNAGTAKSKDCTLIITEGDSAKSLAVSGLSRDFYGVFPLKGKPLNVRDATHAQIMKNEEIMNLVEIMGLKFKTTYNIKSLRYGHLMIMADQDHDGSHIKGLIINFIHHFWPSLLDPGFLQQFITPIVKCTKGKKSETFFTLPEYNEWKEGTGDDGWSIKYYKGLGTSTSNEAKQYFLESHVIEFNRLSTDIDDLIQRFFSKKFDK-----KQWMKIRAYSTYDVD. 749
34 0.000e+00UniRef50_L1IY62 DNA topoisomerase 2 n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1IY62_GUITH  ali  22  261...SKARDDPEQSQYQKKTQLEHVLLRPDVYVGSSYIPGLLKIFDEILVNAADNKQRDVATKIKVKFDKKNTVQVYNDGKGIPVCRHAKYDDYIPELVMGNLLAGSNFDDTKTRLAGGRHGYGAKLTNIFSSVFTIETVDSSRAYRQTWRNNMTTCEPPTIEKLTKAEDYTKVTFTIDLKRFGKKSLDDDTIALWARDVAGCNNGL-KCWINGTLVKVRSFQDLMLLYRSALTQEKGAEGAKAVEVI-------------EDNSGRWKVAVGSAVNNSSSELSMSFVNSVWTSRGGTHLKHVQDLFIKYVATVLNNKY----KDLDVNERTIRNNMWIGVAALIENPSFDTQGKELLVTPTEKFGSEFKVSRKKMEEVVQKTEIVERIVLEG---KLVKDLDKSSKTMGAWSQKRLLLPKLEDANWAGTAKSRECTLILTEGDSAMVSGLSVLGRDRYGVFPLKGKLINVREATNLQVKNNTELAAIKAILGLQNSATYDLDKLRYGKVMLMTDQDHDGSHIKGLFINMIHAYWPELLRSNFLFEFVTPIVKVYTGKAYKTFFTQIEFKQWLQDKDRNKFHIKYYKGLGTNTAQEGKEYFLESHRLSFVYDGKQDDNSITLAFSK----DADERKKWIQDHADSVDFID. 940
35 0.000e+00UniRef50_A0A2M8NVY2 DNA topoisomerase IV subunit B (Fragment) n=2 Tax=Bacteria TaxID=2 RepID=A0A2M8NVY2_9CHLR  ali  53  2........................................................................................................................................................................................................................................................................YTIGVEIAFQYTDSTTVTELAFANTIGTPDGGSHLTGMRSAITSVINRYARSEGYLKEKDVNFSGNDTLEGLTAIVSIKHPNPQFESQTKVKLLNPEVQGVVSQAVSEAFQEFLQMNPREGRKIVEKCLLSKRAREAAKKARDLVRSGSLLESSTLPGKLADCSVHGRSNSELYIVEGDSAGGSAKQGRDRHFQAILPLRGKILNTERAHLDKILDNNEVKAIIAALGTGIHEDFDITKLRYQRIILMADADVDGAHIRTLLLTFFFRHVPQIIQEGHLFIAQPPIFLLKQGKTQEYFYSEPGLKALKKFKDPDKVHVQRYKGLGEMNADQLWETTMNPEKRTLLQVTIEDAAEADKIFDMLMGASVPPRKRFIQTHAKRVRNLDI 396
36 0.000e+00UniRef50_Q1JHR0 DNA gyrase subunit B n=178 Tax=root TaxID=1 RepID=Q1JHR0_STRPD  ali  51  9...EKKMQEYDASQIQVLEGLEAVRMRPGMYIGSTAKEGLHHLVWEIVDNSIDEALAGFASHIKVFIEADNSITVVDDGRGIPVDIQAKTGRPAVETVFTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSTQLDVRVYKNGQIHYQEFKRGAVVADLEIIGTTDVTGTTVHFT--PDPEFTETTQFDYSVLAKRIQELAFLNRGLKISITDKRSGMEQEEHFHYEGGIGSYVEFLNDKKDVIFETPIY----------TDGELEGIAVEVAMQYTTSYQETVMSFANNIHTHEGGTHEQGFRAALTRVINDYAKKNKILKENEDNLTGEDVREGLTAVISVKHPNPQFEGQTKTKLGNSEVVKITNRLFSEAFQRFLLENPQVARKIVEKGILASKARIAAKRAREVTRKKS............................................................................................................................................................................................................................................. 407
37 0.000e+00UniRef50_Q8RS75 DNA gyrase subunit B (Fragment) n=9 Tax=Bacteria TaxID=2 RepID=Q8RS75_9THEM  ali  44  1.............................................EVVDNSVDEALAGYCDWIRVTLHEDGSVEVEDNGRGIPVDIHPEEGRSALEVVFTVLHAGGKFSKDSYKISGGLHGVGVSVVNALSEWLEVRVHRDGKIYRQRYERGKPVTPVEVI--GETDKHGTIVRFKPDPLIFSETEFDPDVLEHRLREIAFLVPGLKIEFEDRINGEKKTFKF--DGGIVEYVKYLNRGKKVFHDVIYMKRTEKVQTKNGEDE---VIVEIAFQYTDSYSEDIVSFANTIKTVDGGTHVTAFKTMLTRLMNEYGKKHGFLKG-DDSFQGEDVREGLTAVVSVYVKNPEFEGQTKSKLGNEEVKEAINRVMRDELKKIFDANPELVKTILSKIMSTTQAREAARRAREMVRRKNVLQNTTLPGKLADCSSTDREKTELFIVEGDSAGGSAKQARDREFQAVLPIRGKILNVEKSSLDKLLKNEQISDIIVAVGTGIGDDF....................................................................................................................................................... 446
38 0.000e+00UniRef50_H8XUI5 DNA topoisomerase (ATP-hydrolyzing) n=156 Tax=root TaxID=1 RepID=H8XUI5_FLAIG  ali  32  1MLEELNPNQYTEDNIRSLDWQEHIRIRPGMYIGSTPDDGIYILVKEVIDNCIDEFAMGAGKTIEVTI-KDRLVTVRDYGRGIPLGK--------VVDVVSKMNTGGKYDSKAFKKSIGLNGVGTKAVNALSNYFRVESVRDNQQKAAEFSAGVL--TLEEDLVETTKRRGTKVSFIADETIFKNYKYRNEYVEKMLRNYTYLNRGLTLYYNGDKF--------YSEFGLKDLLEDNITAEDMVYPVIHLE---------------GDDIEIALTHSKSYSEEYYSFVNGQNTTQGGTHLGAFREGVVRTLKEFYNKN---------FEASDIRKSIVAAIAVKVEEPVFESQTKTKLGSPSVRTFVNDFIKTKLDNFLHKNPEIADQLLRKILQAERERKELSGIRKLAKERAKKASLHNKKHLTDVKNPRYLESTLFITEGDSASGSITKSRDVNTQAVFSLRGKPLNSYGMTKKIVYENEEFNLLQAAL----DIEEDYENLRYNNIVIATDADVDGMHIRLLLITFFLQFFPELIKEGHLYILQTPLFRVRNKKETIYCYSDEERINAIEKLKP-KPEITRFKGLGEISPDEFKHFIGQD--IRLDPVMLDKAMSIEKLLEFYMGKNTPDRQDFIINNLK--VELD. 616
39 0.000e+00UniRef50_D0MV61 DNA topoisomerase 2 n=19 Tax=Oomycetes TaxID=4762 RepID=D0MV61_PHYIT  ali  21  24...................................YVPALYKIFDEIIVNAVDNKVRDPMRHLDVIIEPGSWISVYNDGKGIPVKFHKTEKVYVPELVLGHLLTGSNFDDTAARLTGGRHGYGAKLTNIFSKEFVVETGDMGLRYKQVWHNNMRTRGEPEITSGKDAKDFTKVSFSPDLEKFEMEKLTASMLKKRVYDVAGCLSDVQ-VTLNGKKLPISGFESYIKTFRYS---TTNNPVSKTAKPSKDSDDAASSGSDYIYSRVNKRWKIGVLPS-DVGFVQVSFVNGMSALRGGSHVGYVSDQICRRVAEHVNKKFP----ELSVSTAQVKPHMAIFINCQIENPTFDSQMKEFMTSRPPTFGSTCVLSERLLKLVLSDSGIVERVVQS--ARARQRAALLKKVSSTRAKSSSVNVPKLEDANLAGGARSSECSLILTEGDSAKALAVAGLGRDQYGVFPLRGKLLNVRDATVAQLGKNAEFAHLCTILGLRMDEHYGRQKLRYGRVIAMTDQDHDGSHIKGLLFNLFHTFWPELLEGGFISEFITPIIKVSRGLETRRFFSLPEYFEWKASIDSKHYVIKYYKGLGTSTSAEGREYFLDNHLVDFHWSGDNDGDALDMVFSKA---RAADRKAWLLNEYSPASYLD. 660
40 0.000e+00UniRef50_D2V5K5 DNA topoisomerase 2 n=1 Tax=Naegleria gruberi TaxID=5762 RepID=D2V5K5_NAEGR  ali  21  3...SSQLAKSIEQQYQKKTPIEHVLERPDTYVGSTFIPALYRIIDEILVNAVDNHHRKHTNELRVTIDEKNWIHIRNNGKSVPVEMHKIEKIYVPELVFGNLLTGSNFDDNEVKFTGGRNGYGAKLANIFSTDFTIEIMDHGTHYIQNWKKNMSQISTPTIVENKQKEPYIQVSFHPDFKKFQSTGLNIDLLKRRIYDLSACNPKLN-VYLNDKKVEVDNFKEYVKLFYQNNSSGEHPEKMFVHKHICDG------------------WEIAIGASVGEEFNQISFVNSIATVQGGSHVNFVLNQLSTKISEYIAKTYT--DLQLTISPYMVRNHITLFINSLIENPTFDSQTKETLTTKSISFAQKVVISNDLINSIANHTP-----IIDNIIAFANYKQSSASSKKFKKRESKLLIPKLDDANLAGTNRSMECVLILTEGDSAKALAISGLSRDRFGVFPLKGKLLNVREASADQIRDNQEIQNLKKILGLDDVSKTDTKRLRYGKVMLMCDQDHDGSHIKGLLLNMIHFFYPELLRNNFVDEFITPIIKVSKGSDVKSFFSIPEFQNWVPENEKNRWNQKYYKGLGTNSSKEAKDYFSNLKRHVIALQYDDDSENIELAFSK---DLANARKSWVAS-LKDGTFLD. 662
41 0.000e+00UniRef50_M8B9P8 DNA topoisomerase 2 n=4 Tax=root TaxID=1 RepID=M8B9P8_AEGTA  ali  46  24....................................................................................................................................................................................FTTTIEFDFSTISSRIRELAFLNPELTITLTKEEQDAQVQHNEYCAGGLVEYVAWLNNDKKPLHDPI-----------AFRKELDGIIVDVSLQWSDSYSDTVLGYANSIRTVDGGTHIEGLKTSLTRTINSFAKKSKIMKDKDISLSGEHVREGMTCIISVKVPNPEFEGQTKTRLGNPEVRRIVEQSVQENLTEYLELHPDVLDSILSKSLNALKAALAAKRARELVRTKSVLKSSSLPGKLADCASSNPAESEIFIVEGDSAGGSAKQGRDRKFQAILPLRGKILNIERRDEAAMYKNEEIQNLILGLGLGVGEDFKKEALRYHKIVILTDADVDGAHIRTLLLTFFFRYQRALFDEGCIYVGVPPLYKVERGKQVHYCYDEADLKELVNTFPTNSYNTQRFKGLGEMMPLQLWETTMDPERRLLKQLTVEDAAEANVVFSSLMGARVEYRKELIQKAASNLDHLDI 488
42 0.000e+00UniRef50_A2E5K0 DNA topoisomerase 2 n=2 Tax=Trichomonas vaginalis TaxID=5722 RepID=A2E5K0_TRIVA  ali  20  1MSRSDSQEKLSEEQYVKLTHREHVLTRPDSYIGSIYVPGLYKIFDEILVNAADNKQRDPLTTIKVEVDPQNRISVWNDGKGISTQKQFSPNYYIPEFIFSQLLTSSNYNDKQEKVTGGRNGYGAKLANIFSKKFHINIYDEGINYQQTITDNMTNIQPPKLKNGKGKGSYTEISFWPDLERFNLQTITKDHVDLIRRRVYDLAGILPKVFWNGNQVPIKKWEDYCKVYLKEDVKPL---------------------VCEVKNEKGYTWKIGVAPSKSREFQQISFVNCVATSNGGTHVDVVVNQITKYITDYLKNRRSGK---VETKPSVVKNFLYVFVDSLVINPSFDSQTKERLTLDQKKLKDDCKLPDNFLDKILKTDIVALVTEYANFKEQ------RKVANMKGTKKGRLIINKLEDANMAGKAESLKCTLILTEGDSAKATAVTGLGRDYYGVFPLRGKLLNTRDISAKKLSENDEIQNIIKIMGLDPMEKYEMKRLRYGSIMIMADQDVDGSHIKGLIINFVHSMWPNLLKRNFITEFITPIVKVTKGNNKISFFTIPEFSQWKANNNGKGYKMKYYKGLATSTAEEAKEYFSNKHKKVFIYTNENDEERINLAFAK---KRADDRKNWLAQLDANETYL.. 663
43 0.000e+00UniRef50_A0A2E3C882 Uncharacterized protein n=1 Tax=Euryarchaeota archaeon TaxID=2026739 RepID=A0A2E3C882_9EURY  ali  24  2...........AENYKKYTQIEHVLERPGMYVGDIWNPGIFKIFDEILTNASDERQRNKMTCIKVWISDDNTISIYND-SGIPIEIHPEYNVYIPELIFANLLTTSNHDDTKKRTTGGLNGLGAKLAAIFSDTFTVETASGGKKYTQTFEKNLSKICKPKL--GKSVKEYTKITFKPDFKRFGVDTLNEDILIRRTFDMCAITPKGVDVYYNDKKLNVKDFSEYISMYI------------------------GPKKNCPRVIQETPRWQVAIAPSENG-FQCISFVNGVNTSDGGSHVEHVIGPIVKKITEIIQEKH----KSLTIKPNYIKDNIFVFINCIIENPSFSSQTKEKHITKVSGFGSKFSASDEFVKSVSK------LGIIENVLALADAKEKKSLQKTDGKKTSRIIIPKLDDANRAGTKDSSKCTIIFTEGDSAKATAISGLSRDTYGVFPLRGKLLNTRTATYSQLSKNEEINHIKQILGLQNGKKYNVSELRYGKILIMTDADTDGFHIKSLLVNFIGNSWPELLKIDFISSLVTPVIKVTKKDMVMPFYNLSDYNKWRETNKIEGYKVKYYKGLGTSTSSEAKEYFKDMKTLDYKVESNTDEKYLHMAFTK---TEADARKKWILDNITSPKTLD. 629
44 0.000e+00UniRef50_E4XKZ9 DNA topoisomerase 2 n=2 Tax=Oikopleura dioica TaxID=34765 RepID=E4XKZ9_OIKDI  ali  22  1......MGKTIEETYKKVDSLEHVLLRPDMYVGSIFIPALYKIYDEILVNAADNKVRDPQNMVKVDIDENNKISVLNNGKGIPIEIHKEHGVYVPELIFGHMMTSSNYDESEKKTTGGRNGYGAKLCNIFSTEFTVETVNKGKRLTVTWTGNMKKKGNAVI-KSYSKDDYTKISFTPDLKRFNMTHLSNDMVSLRAYDIAGTTPGVSVFLDGQRFNKKDPFKDYCNMYTKGKILDTGKEVTLIYEKP-------------ENKEAKGRWDVGFAISDNGFQNI-SFVNSINTSKGGHHVNAISDQLVKRLEELVNKKN---KGGLAVKAHQIKSHCWIFVNSQIENPAFDSQTKETLTLVKSKHGSKPILSDAFIKKVEK------SGIVETITNFMKFKENQAKGKIGGKKQKKVVILKLDDAPEAGKTRSKDCTLILTEGDSAKTAALAGVSKRYYGVFPLRGKLLNAREAGHQQLTKNEEIKNIIQAMGFDFKRKYDNPSLRYGRLMIMTDQDVDGSHIKGLIINFLHHFWPNMIRGPTVQQFITPIVKIFLKKKKTNFYSLPEFNKWQREVPNDAYRVEYYKGLGTSGPEEFKEYFQDRHRIPFRYSGPNCDERIKMAFAR---DLVDDRKEWLTEFEAGEDEL.. 666
45 0.000e+00UniRef50_A0A1Z5K4Y3 DNA topoisomerase 2 n=2 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5K4Y3_FISSO  ali  22  77..........IESQYLRKTPLEHVLLRPGMYVGPNEVPALVKVFDEILVNASDNRLRYPCSRIDVIIQPGNDISIYNDGKGIPIQIHKKENMYLPEMLFGHLLTGSNFNDDEKRITGGRHGYGAKLTNIFAQQFTVETADRGLFYHQTWWENMTRASEPIITEWNEGTDFTRISFVPDLPRLTGNQHDYSLMCRRVVDVAGCAAGKLTVTLNGKDVSMPSFAQFVELHRKS------------------------SSPPLIHYNMNPRWKISVGLSDTGSFESVSFVNGMATHRGGTHINALVQQISKKIQEKVEKIDPQLAK--LISHGLIRRHLFVACDALIENPTFDSQMKEYLTSSPTNFGSSYSLTQKLLNDLVKPEDQGPGIVEDVLRVASGRQQANLVKELTSKKSKRQSIPKLEEAHQAGSESGWDCTLILTEGDSAKALAVAGLGRERFGVFPLRGKFLNVRDASVTQLTNNAEVKALCSILGLDFDKKYDRRELRYGRVMLMTDQDQDGSHIKGLVINFFRYFWPDLLRPPFLSAFVTPLLKASRKKGQLAFYSMAEYNAWRDSIDPKKYRIKYYKGLGTSTTEEARGYFFDDHIRPFKWTSDADGDLLDMVFDK---NSAAARRQWILDTYDETSSLEI 770
46 0.000e+00UniRef50_A0A1J4KFE1 DNA topoisomerase 2 n=1 Tax=Tritrichomonas foetus TaxID=1144522 RepID=A0A1J4KFE1_9EUKA  ali  21  12.SNTTSGTETADENYMKYELREHVLKRPENYIGSTYVPGLYKIFDEILVNAADNAQRQPTKKIQVEINEEGFISVWNDGKGIPIAKKENEEYWIPEFIFGQLLTSSNFDDTKKRTTGGRNGFGAKLANIYSNTFIVECNDTYYHYTQKFTDHMENIEKPKIIKKKKVTSSTMIKFYPDCSLFGMDRLDDDIVSLFKKRVWDMAGVLKGVLLNGEKVPVKNFEDYCKKYLDENATFL-------------------------SCEVNDRWKIGIAASDGQFGQV-SFVNSVATTRGGTHVDYVANQITKYI---CKELENSRGNKITVRPNIAKYHIFVFVNCLIDNPSFDSQTKETLMLKVSEFGSKCDVPEAFLKKIMKQTEIPGLIRDY----AKFKQNSDMKKMGGRKTARIHGILKLTDANEAGKAKSSQCTLILTEGDSAKTMAVTGLSRDLYGVFPLRGKLLNTRDITTAKLQKNEEIQNLMKILALKPGTKYNDKDLRYGSIMIMTDQDQDGSHIKGLIINFIHSMWPELIKQGFLCEFVTPIVKVFKGNTSKAFYTLPEFIQWKKEHDDKGYSIKYYKGLATSSDEETKEYFFKRHKITFQFSGETDEERIQLAFSK---KRADDRKNWLAELDPDTTYL.. 671
47 0.000e+00UniRef50_M3SF64 DNA topoisomerase 2 n=92 Tax=root TaxID=1 RepID=M3SF64_ENTHI  ali  44  1MSETN---TYDSSSIKVLKGLDAVRKRPGMYIGDTDDTGLHHMVFEVVDNSIDEALAGFCSEISITIHMDESITVRDNGRGIPVDIHKEEGVSAAEVIMTVLHAGGKFDDNTYKVSGGLHGVGVSVVNALSEELRLTIRRAGQVWEQVYVHGVPQAPLAVI--GETDTTGTQVHFKPSAETFSNIQFSWDILAKRIRELSFLNSGVGIVLRDERSGKEELFKY--EGGLRAFVDYLNTNKTAVNEVFHFQVQR---------DDDGVGVEVALQWNDSFNENILCFTNNIPQRDGGTHLAGFRSALTRNLNNYIEAEGLAKKFKVATTGDDAREGLTAIISVKVPDPKFSSQTKDKLVSSEVKTAVEQEMGKYFSDFLLENPNEA......................................................................................................................................................................................................................................................................... 370
48 0.000e+00UniRef50_A0A2J7ZRN5 DNA topoisomerase 2 n=5 Tax=Tetrabaena socialis TaxID=47790 RepID=A0A2J7ZRN5_9CHLO  ali  22  3..........DAGSYQKLDHREHVLLRPGMYIGSVYVPGLFKVADEIIMNAVDHSVRHPVKRICVSINKEGVISVENDGDGIPVQLHAEEGVHVPELIFGHMLTSANYDDSEERTIGGQNGIGAKACNIFSKWFEVETVDRKKVYTQRFHDNMSITDVPTI-KSSSKKPYTRVTFLPDYKRFGTDALDDDMYALLLRRVYDVTAITDAVSLNGEKIPFKSFERYCDLYLGTRND-----------------------AGRVYEALAPGWEAVVALSDGAGLQQISFVNGVATLRGGRHVDHFVNLLCKRLGDAIES----KRKGVAVKNQFVRDNLFVFLRATVPNPAFDSQSKETLTTPVAKLGIKLDLTDKFVDKVCKLEGLIDRVVGLSDVA----TEKGLKKTDGTKRSTISGIPKLDDAEWAGTTKSEQCILILTEGDSAKAMAISGLGRQKFGVYPLRGKVLNVCDVSAQKISENVEIANLKKILGLQAGKTYNVKDLRYGAVMALTDADTDGSHIKGLLMNLFVHQWPSLLEPGFLCSMLTPIVKATRSKQELSFYSNTDYQAWRTATAQNSWKTKYYKGLGTSTAEEAKKYFKDM--RLVKYVWDESKDLMDMAFNK---KRANDRKLWLGSYNPKIA-LD. 661
49 0.000e+00UniRef50_A0A0L0CX58 DNA topoisomerase 2 n=1 Tax=Plasmodium falciparum RAJ116 TaxID=580058 RepID=A0A0L0CX58_PLAFA  ali  21  1MAKNK----TIEERYQKKSQIEHILLRPDTYIGSTYVPGLYKIFDEIIVNAADEKSENPMTCIKIEINKENRISVYNDGEGIPVDIHKEMNIYVPHMIFGELLTSDNYDDAEDRITGGRNGFGAKLTNIFSKEFIVQCGDSRKKEFKMTWSDNMSKFSEPHIKNYNGKDYVKVTFKPDLNKFGMTEMDDDIESLLFKRVYDLAGTCSVVYLNGQRLAVKDFKSYVDLYXXXXXXXANQNNDTPTKXXXXXXXXXXXXXIVKIHEKQHRWEIVVSKSDGSQFQQVSFVNSICTTKGGSHVNYIVEQLLSSL---SKKANAKNKGGMEIKSGHIRNHLWVFVNCLIVNPTFDSQTKETLTTKPVKFGSKCILSDKTINNVLKSPILSNILLWAQAKAQVELKKKMKA-GSSKARERIIGIPKLEDANDAGSKYSQECTLILTEGDSAKTSCLAGLSRDKYGVFPLKGKLLNVRDASFKQLMDNKEIQNIFRIMGLDIKNKDDIKGLRYGSLMIMTDQDYDGSHIKGLLINMIHKFWPSLLKHK------------------------AEYEQWKENTNLLGWKIKYYKGLGTSTDREFKQYFSDIHKIMFLWTGDRDGDSIDMAFSK---KRIEDRKLWLQNFIL....... 681
50 0.000e+00UniRef50_A0A0L7REH1 DNA topoisomerase 2 n=2 Tax=Pancrustacea TaxID=197562 RepID=A0A0L7REH1_9HYME  ali  20  11..DNGPKKKTIEGIYQKKSQLEHILLRPDTYIGSVYVPGLYKIFDEILVNAADNKQRDPMDAIKIEIDPNNVISIWNNGKGIPVVVHKEENMYVPTMIFGHLLTSSNYDDEEEKVTGGRNGYGAKLCNIFSHRFTVETSKEYKKCLKQTWCNNMESASAPRIKDFSGEDFTKVIFSPDLSKFKMQSLDDDIVALMSRRAFDIAASTRKVYLNGTRIPIKNFKDYVDFYIKGKEDDMG------------------SPLKLVYENCGPRWEIAITLSDKGFQQM-SFVNSIATTKGGRHVDHVTELIVKQLIETLKKKNKAG---VTIKPFQIKNHLWIFINCLINNPTFDSQTKENMTLQPKSFGSKCALTDKFITSVNYSNINSAHINSVMKDIKKRFMKCLLCNGGTFVYSQYAGIPKLEDANDAGTNRSLECTLILTEGDSAKSMAVSGLGRDRYGIFPLRDIYISLY----------------------------------------------DGSHIKGLLINFIHHNWPSLLKLNFVEEFITPIVKASKGNQSLSFFSMPEFHKWKETNNFHTYKIKYYKGLGTSTAKEAKEYFMARHRIRFKYDGDQDDQNIIMAFSK---KCVDQRKDWLMNHMDETK.... 618
51 0.000e+00UniRef50_A0A0G1FLZ7 Topoisomerase (ATP-hydrolyzing) protein (Fragment) n=4 Tax=root TaxID=1 RepID=A0A0G1FLZ7_9BACT  ali  50  5........................................................................................................................................................................................................................KFQEYTFHFEGGVASYVRHLNHLSEAKHDRVFYAQK----------EVSGIQVEVGVQYVDDYKETVFSFANNIYTVEGGMHMVGFRTALTRSLNNYARTKGYLKEKDDNISGEDTREGLTAVISVKLKDPQFEGQTKAKLGNAEVKPIVDSVVADGLTIFLEENPRDAEAIIGKCLLASRARMAARAARDTVLRKGALEGFALPGKLADCSSRDPKESELFVVEGDSAGGSAKQGRDRRFQAILPLRGKILNVERARLDKMLANNEVKSLIIALGTNIGEMFRLEDLRYDKIVIMTDADVDGAHIRTLLLTLFYRHFKPIIDQGHLYIAQPPLYRVARGKDVKYVYSDDELEKIRKEFATSKVNVQRYKGLGEMNPQQLWETTMDPVRRMMKQVTIDDAAKADETFDILMGADVAPRKRFIHTHAKSVKNLDI 464
52 0.000e+00UniRef50_A0A1D3D569 DNA topoisomerase 2 n=1 Tax=Cyclospora cayetanensis TaxID=88456 RepID=A0A1D3D569_9EIME  ali  23  56............QRYQKKSQLDHILLRPDSYIGSTFAPGLYKIVDEILVNAADVKARGKMTAIKVNVDPEGMIRVWNDGEGIPVAIHKEHQVYVAELIFGQLLTSDNYDDTEARVTGGRNGFGAKLTNIFSSYFEVECADSKRKQKIKWTDNMGKQQAPVLTPFNGAGDFVAVKFKPDLGRFGMSTLDEDLISLLRKRCYDLAGTSTAVYWNGVRLPVRSFVDYVDLYLGSXXDSEAEDAAETQADEDKENERTPEKQVIKIHEKMHRWEVVISQSDGSGFQQVSFVNSICTPKGGHHVNHVIEPLLAAL---VKKANAKNKGGMEIKPPHVRQHLWVFVKCLIENPAFDSQTKETLTTTVSRFGSKCNLSERTVNAVAKSAILDGVLLWAQTKAQVEL-RRQMSVGKTKGKERLTGISKLEDANEAGGRYAQACTLILTEGDSAKTSCLAGLSREKYGVFPLRGKLLNVREASFKQLKENREIQNILRILGLQINDKQDTRGLRYGSLMIMTDQDYDGSHIKGLLINMLHHYWPHLLQCNHFTEFVTPIVKVSKGSVEKAFFTLVEYDMWRKQAGNSGWKIKYYKSLTTLRFVESFVYLLDPATFVLLPLRSNDGELIDMAFSK---KRAEDRKRWLQGY......... 804
53 0.000e+00UniRef50_A0A1V6FMK6 DNA gyrase subunit B n=15 Tax=root TaxID=1 RepID=A0A1V6FMK6_9FIRM  ali  55  1...................................................................................................................................................................................................................................................................MCQECNEQVVEIALQYNSGYNEAIYTFANNIKTEEGGVHLDGFKFALTKVINDFGTQLKLLKEEEKL-SGEDVREGLVAVINVKLPNPQFEGQTKTKLGNSTMREFVKKVFTDKFSEFLEENPKDAKELINKSVNAQRAREAARK-ARESFRKTAMDSTALPGKLADCIDTNPMNCEIYLVEGDSAGGTAKQGRDRQYQAILPLRGKILNVEKARIHKILDNEEIKSMFTAFGCGYGDDFDLSKRRYDRIICMTDADVDGSHIRILLLTFFFRFMKPLIVNGHIYIALPPLYKVTKGKEERYFYSDEELRQYLDTIGGARYDLQRYKGLGEMNATQLYETTMNPETRTLLKVTVEDAEEADSIFSMLMGDIVDLRREFIEQNATLVKELDV 389
54 0.000e+00UniRef50_A0C0L0 DNA topoisomerase 2 n=4 Tax=Eukaryota TaxID=2759 RepID=A0C0L0_PARTE  ali  22  3.......QKTIEEQYKKMTHIEHILQRPDTYIGSIYVPGFFKIFDEILVNAADNLQRDKQSYIKVDI--GNEITIKNDGLPIPVEIHKEYQIYVPELIFGVFLTGSNFDDSEKRVVGGRNGYGAKLTNVYSTEFTLEVCDGNNYFKLVWNNNMSNKQIPTIKQLKKDP-YVSISYKPDYKRFGMKEIEADTLTRRVYDLAGIYGSKINVYLNDEKIKINSFQKYVDLYLP----------------------TEGAIKIFDKDMTTPRWEVVVSYSPT-QFQHVSFVNAIYTAKGGTHVNYVTDKIIQEIQN--EMNNNKKYKSIEVQKYQIKQSLWVFINCLIDNPTFDSQTKENMTTKVSEFGGSSEEKFKVTEKFSKALIKTDIIETIFQQAKAKADAKLNKQLKGTKTGRLHGIEKLDDANDAGKKNSELCTLILTEGDSAKALAMAGIDRDRYGVFPLKGKLLNVREASLKQILQNEEIENLIKIIGLQKERQYDLKSLRYGSVMIMTDQDIDGSHIKGLIINFIHHFWPSLVKSGFLKEFVTPLIKATKGNQTIPFFTVQDFNKFAQEEDIKNWKIKYYKGLGTSDDQEAQEYFKNLHTIQFRYDGDDDDSSIDLCFNK---KKANDRKQWLAQYNHDL..... 644
55 0.000e+00UniRef50_D0NA12 DNA topoisomerase 2 n=26 Tax=Oomycetes TaxID=4762 RepID=D0NA12_PHYIT  ali  20  93.....TPKQSIEQIYQKKTQLEHILLRPDTYVGSIYVPGLYKIFDEIIVNACDNKQRDKMNTLKVTIDEKNEISVWNNGKGIPIVLHKEHKVYVPELIFGHLLTGSNFDDKKKKTTGGRNGYGAKLANIFSNEFVVETADSKQKYKQVFESNMSKKNPPSITKWA-QKDFTCISFKPDLERFKLDFLNDDIVSLRVYDVAGVSGKGMNVFLNGDKIPIKSFPQYVALYPGPRGYEADKDKDDEDAHPDENGDDDDEDYSEDKAKKAKAARAKPS-NVTKNGVIFEKPDERWQVGVGMHVSYIVDQITAKLVSVLKK----KNKGEAVKPNYIKNHMFVYVSALIDNPAFDSQTKETLTTRANSFGSTFNLSDKFLKQLEKS---GLVEKILSFAAFKQTAELRRKGGSSGKRSRLTGIPKLDDANHAGTAKSKDCTLILTEGDSA------------------------------KTILKNEEIQNVVKILGLKYGQKYESTKLRYGHLMIMADQDHDGSHIKGLVINLIHHFWPSLVVDGFLQEFITPIVKCTKGRTKEVFYTMPEYEAWRERTNQRGWVIKYYKGLGTSTAAETKEYFSDLHQIGFTYDGDGDADVIDMAFSK---KRVEDRKDWLRGY......... 728
56 0.000e+00UniRef50_UPI00083D2D96 DNA topoisomerase 2 n=1 Tax=Habropoda laboriosa TaxID=597456 RepID=UPI00083D2D96  ali  23  30..DNGPKKKTIEGIYQKKSQLEHILLRPDTYIGSVYVPGLYKIFDEILVNAADNKQRDPMDAIKIEIDPNNVISIWNNGKGIPVVVHKEENMYVPTMIFGHLLTSSNYDDEEEKVTGGRNGYGAKLCNIFSHRFTVETSKEYKKCLKQTWCNNMESASAPRIKDFSGEDFTKVIFSPDLSKFKMQSLDDDIVALMSRRAFDIAASTRKVYLNGTRIPIKNFKDYVDFYIKGKEDDMG------------------SPLKLVYENCGPRWEIAITLSDKGFQQM-SFVNSIATTKGGRHVDHVTELIVKQLIETLKKKNKAG---VTIKPFQIKNHLWIFINCLINNPTFDSQTKENMTLQPKSFGSKCALTDKFITSVR--------------------------------------IPKLEDANDAGTNRSLECTLILTEGDSAKSMAVSGLGRDRYGIFPLRGDDL---------------------------------KTLRYGKMMIMTDQDQDGSHIKGLLINFIHHNWPSLLKLNFVEEFITPIVKASKGNQSLSFFSMPEFHKWKETNNFHTYKIKYYKGLGTSTAKEAKEYFMARHRIRFKYDGDQDDQNIIMAFSK---KCVDQRKDWLMNHMDETK.... 611
57 0.000e+00UniRef50_UPI000B36275E type IIA DNA topoisomerase subunit B n=1 Tax=Crenothrix polyspora TaxID=360316 RepID=UPI000B36275E  ali  34  2......SNEYNASAIEVLSGLDPVRKRPGMY---TDTTRPNHLVQEVVDNSVDEAIAGHAKSIDVVIYKDGSVLVSDDGRGMPVDIHPEQGIPGVEVILTQLHAGGKFSNKNYQFSGGLHGVGVSVVNALSAKLEVEVKRNGKLYRIEFADGHKLTELTETGTVGRNNTGTSVKFWPNEKYFDSNKISVLKLKHVLRAKAVLCSGLKISL--KVDGTDEEYQWCYQDGLREYLLDRVGDIEFSPVSPFMGNMAA----------NHEAVEWGIVWSIENPEEAESYVNLVPTAQGGTHVNGLRAGLTEAMREFCDIRNILPR-GVKLAPEDVWENCHFVLAVKXNQHPAEGEKIAEIIISSAQK-------------------------------------RLKSNKKIIRKKITSGPALPGKLADCSAQDLKRTELFLVEGDSAGGSAKQARDRDFQAIMPLRGKILNTWEVESSQVMASQEVHDIAVALGIEPGSS-DLQYLRYGKVCILADADSDGNHIATLICALFYQHFRPMIRAGHVFVAMPPLYRIDVGKRVFYALDDSERQGVLD............................................................................. 516
58 0.000e+00UniRef50_A0A1Q7TCF6 Uncharacterized protein n=3 Tax=Verrucomicrobia TaxID=74201 RepID=A0A1Q7TCF6_9BACT  ali  43  24......AQKYDAAQIDKLEGLEAVRKRPGMFIGDPDERGLHHLVFEVLDNSIDEHLAGFCTKIEVTVHVDGSLSVRDNGRGIPVDIHPKWKMPAIELVLTNLHAGGKFGQGAYKYSGGLHGVGAKCTNALSEWFKVEVSRDGKVYHMAFAKGKTTDKLTVIGEVKNKKTGTLITFLPDPTIFTTTEFKFERLATRLRELAFLNPGIEITLTDERSDPPKKETFFFKHGIEEFVKQLGENKQVLHPRPIVISRQRDEVF----------LDVVLQYNDSYNDQILPFANSIPNPDGGTHLTGFRTALTKAVNQYAKSSNFLKEKDPSISGDDVREGLICVLSIKLPNPRFESQTKVKLVNTEIDGIVNSVAYDGLMTYFDKNPPIAKRVFDKVL................................................................................................................................................................................................................................................................. 402
59 0.000e+00UniRef50_A0A0G4IKT0 DNA topoisomerase 2 (Fragment) n=1 Tax=Plasmodiophora brassicae TaxID=37360 RepID=A0A0G4IKT0_PLABS  ali  22  23.ASRRLSTATLEKQYQRMTAREHVLLRPEMYVGPLYVPGLLKIFDEILVNAADNQARDKMSYIDVKINKKGEICVENDGSALPVAIHPAEMIYVPELVFGHLLTSSNFDDERERFTGGRHGYGAKLVNIFSNSFDVRVYDASRKFHQLFTDNMMNRSDPQVKDKGSKSSWTRITFRPDLKRFLLDDIDADILSLMQRDIAACNPRLD-VRLNGRSLKVPSLADYIAL------------------------HAGLDASEFASINVNKQWQLAVGPTSSGRFESTSFVNSVATMRGGSHVDAVVAQIRHYLSGVVEKELRRSGS----STPRIKDFLHVFLICTVANPAFESQTKEMLTTPANTFAKHATLSHSALEAIRFNTK-----IVDNILTAAEKRSREILKKTDGRKLKQVLVPKLEDANWAGGRNAAQCCLILTEGDSAKALAVSGLSRDRFGVYPLRGKLLNVRDASASQIADNKELLYLKQILGLQTGKKYDVSELRYGQVMLMADQDHDGSHIKGLVINMIHNFWPDLLRPGFLTQFVTPIVRCRKGDREKHFFTLPDYEAWRARHTDWKAK--YYKGLGTSSAAEAKEYFLGQHRVSFKWGRKEDDDLIDLCF---KADRSDDRKEWLAQ.......... 667
60 0.000e+00UniRef50_A0A2H0W2W4 DNA topoisomerase IV subunit B (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A2H0W2W4_9BACT  ali  45  11.KPPKSQSDYSAKQITVLEGLDPVRKRPGMYIGNTASEGLHHLIWEVVDNGIDEAMAGFCTQIDVELLPDGTVQVTDDGRGIPVDIHKTAKVSALEVVMTKLHAGGKFGEGGYKVSGGLHGVGVSVVNALSEFTKAEVRRDKKTWIQEYERGKPKK--KVKPIGPAKTTGTTITFKPDPEIFTVTEFNLQTIIDHLRQQAYLTKGIRLNIIDSRDKHKLAYSFYFEGGIKSYVKHLNVNVEPKHDNVFYAEK----------EVDDVKVEVAVQYSNEYKETLFGFANNIYNPEGGTHISGFRTALTRSLNSYAKKKNILKEKDQPLSGEDCREGLTAIVSVKIKEPQFEGQTKAKLGNAEVKSIVDSVTSDALGTFLEENPRDAEAIVGKC.................................................................................................................................................................................................................................................................. 389
61 0.000e+00UniRef50_A0A2R6LAW6 Uncharacterized protein (Fragment) n=1 Tax=Halobacteriales archaeon SW_5_70_135 TaxID=1919200 RepID=A0A2R6LAW6_9EURY  ali  43  5.......SEYGAGQIRTLGDLEGVRKRPAMYIGSTGARGLHHLVYEVVDNSIDEALAGYCDEIEVTVHEDGSVSVSDDGRGIPVDTHEEHGRPAVEVIMTVLHAGGKFDNDSYPISGGLHGVGVSVVNALSKWLEVTVKRDGAVWFHRFDHGEPQGDERVREMRDDEETGTTIHFWPDDEVFELTEYEFDTLASRLRELAFLNPGVQLAIADERSDDRQAFAF--EGGIREFVEYLNETRTPLHEDVVYVEDGTEV------EAGEMQVEVAVQATDELQGSVHAFANNINTREGGTHLTGFKTALTRVVNDYADDQGMLSDLDENLTGEDIREGLTAVVSVKHPDPQFEGQTKTKLGNSAVRG--------------------------------KXXXXXXXXXXXXXXXXXXXXXSLPGKLADCQSRDPDESELFIVEGDSAGGCFTGDTEIALASGRSITFEELVGEYDDGETHYCYTVNDDGRIDIGRIEHPRVTRENAELVEVTLDDGETCTPDHEFML............................................................................................................................. 485
62 0.000e+00UniRef50_A0A0U1HB29 DNA topoisomerase 4 subunit B n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A0U1HB29_YEREN  ali  36  433..........................................................................VIDDGRGMPVDIHPEEGVPAVELILCRLHAGGKFSNKNYQFSGGLHGVGISVVNALSKRVEVTVRRDSQIYSIAFENGDKVQELQVIGTCGKRNTGTSVHFWPDVSFFDSPRFSVSRLSHLLKAKAVLCPGVEIVFKDQVNNTEQ--RWCYADGLTDYLMEAVNGLITLPEVPFVGSFAGDTEAID---------WALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNILPR-GVKLSADDIWERCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFSLWLNQNVQAAEQLAELAISSAQRRMRAAKK---VVRKKLTSGPALPGKLADCTSQDLSMTELFLVEGDSAGGSAKQARDREYQAIMPLKGKILNTWEVSSDEVLASQEVHDISVAIGIDPDSE-DLSQLRYGKICILADADSDGLHIATLLCALFVRHFRALVRNGHVYVAMPPLYRIDLGKEVFYALDEEEKAGVLEQLKRKKPNVQRFKGLGEMNPLQLRETTLDPNTRRLVQLTIGDDD-IDKMMDMLLAKKSEDRRNWLQEKGD....... 990
63 0.000e+00UniRef50_A0A1Z5KZT0 DNA topoisomerase 2 (Fragment) n=1 Tax=Ornithodoros moubata TaxID=6938 RepID=A0A1Z5KZT0_ORNMO  ali  23  1...........................................................................................MYVPTLIFGHLLTSSNYNDDEKKVTGGRNGFGAKLCNIFSTKFTVETYSKSEYFSQTWENNMTKTAKPKLKPKDTGDDFTKITFYPDLPKFKMEKLDPDMVALMSRRAFDVAGSTRKVFLNKKKIPVKGFKEYVQLFLKDKEDEQGK------------------PIVPIYESVNDRWEVAVALSDSGDFQQMSFVNSIATTKGGTHVDYVADHVVKKVQEMVKKKNKAGVK---IQNKQVKDHMWVFINCLIENPTFDSQTKENMTLQVKNFGSKCDPSEKFYTQVLKCGIVDAVMSWLAFKAQKQLGQKCSSKKHSKLK----GIPKLEDANDAGTRNSIDCTLILTEGDSAKTLAVSGLGRDKYGVFPLRGKMLNVREASHKQILENAEINNLIKILGLQYKKKYDLRTLRYGRLMIMTDQDQDGSHIKGLLINFIHHNWPSLLRLPFLEEFITPIVKASKGKTELSFYSLPEFEEWKATNDWQRWRVKYYKGLGTSTAKEAKEYFSDRHRIRFRYQGGEDDRAIELAFSKKM---VDQRKEWLRSGMEERK.... 541
64 0.000e+00UniRef50_A0A0N1H9P5 DNA topoisomerase 2 n=1 Tax=Phialophora attae TaxID=1664694 RepID=A0A0N1H9P5_9EURO  ali  24  111MAQDPKKKKRVSEQYQKLTQLEHIIKRPDTYIGSVFVPGVFKIFDEILVNAADNKQNDKQSYIDVHIDERGVCSVENDGRGIPIEIHSKEKIYIPEMIFGVLLTGSNYDDDEQKITGGRNGYGAKLCNIFSTKFTIETSKHKKKYKQVWTDNMSKMHDPIIAEQK-GEDYTKVTVY---------------------DLAGTLKGVKIRLNGKGLPPSQSFERYAELYTKAIKLERGDDTTTDDSNIIMAKEK-------------NERWSVGVAVSDGSFQQVSFTNSINTSSGGTHVNMIVDQLVTKLAAHVKK---GNKGGVALKPAQIKNHLFLFVNAQIVNPAYTSQTKEQLTNKASSFGSKFEVTDAFVKKIVEGTS-----ILQDLLATQQQKADSLLKKTDGKKRTRMNNPKLVDANKAGTASGHLCTLILTEGDSAKGLAMAGRSPDHFGVFPLRGKILNVRDATVDQISKNAEINAIKSFLGLQHKKVYDTRSLRYGHLMIMTDQDHDGSHIKGLLINFLQCQFPSLLRIPFLVEFITPIVKIWKGDQQKTFFTMPEYEAWKAE-GHKGWSSKYYKGLGTSTAEDAQVYFSDRHHKEFHTMREGEPELIELAFS---NKKADERKTWLQSY-KAGDYLD. 755
65 0.000e+00UniRef50_A0A0N4U200 DNA topoisomerase 2 n=2 Tax=Chromadorea TaxID=119089 RepID=A0A0N4U200_DRAME  ali  22  30...........SRKYQRISPLEHILCRPDSYIGSVFVPGLLKIFDEILVNAADNKLRDPMKCVRIDVNEDNIISVWNDGRGIPVEIHPVEGVYVPTLIFGSLFTSSNYDDNEIKIIGGRNGFGAKLCNIFSKEFKVETNHSHLKFSQIWKNNMTTTEGPLIESSD-EKDFTRISFKPDLSKFSLSDLSENMVILMKKRAIDVAGTLNSVFFNGDKIMLSGFRDYVELFLNNY-----------------DHNTGKKGGNYSYRSVNDRWQVAVAISDDGFQQI-SFVNNIATPKGGRHVDYIVNQVVEKLKEEIDRRTNVFK---SVRSEQIKNHLMIFINCLIENPAFDSQTKELLITSCSKFGSTCILPNSFFKEFFSKTEIIERLLLDIDKRRIKLLNQSK-------KSSLSDIVKLDDALYAGTNKSYLCTLIVTEGDSAKALAVAGLSRDYYGVFPIRGKLINTRDLDEKLACENSEIAALIRILGLKFGEDYKRSHLRYGRLMLMTDQDPDGSHIKGLIINFIHTYWPSLIHSNFIQYFVTPLLKVFHHSGSLSFYSTKEYEDWKTACGFRKYKVKYYKGLGTSSSQEGREYFINRHTVDLISDESTD-KMIELVFDRNMSK---QRKDWINNETKKIK.... 671
66 0.000e+00UniRef50_A0A2G8KFJ7 DNA topoisomerase 2 n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8KFJ7_STIJA  ali  21  70..........VERIYQKKTQLEHILLRPDTYIGSTFVPGLYKIFDEILVNASDNKQRDPMNCIKITIDPENVISVWNNGRGIPVIEHQKEKMFVPEMIFGHLLTSSNFDDTQKKVTGGRNGYGAKLCNVFSNKFTVTANKEYKRKFKQTWSKNMTKKTEPALTDFMGSDYTEITFSPDLEKFKMSVLDKDTVALLTRRAYDIAGKGVKVYLNGTKLPVVSFKSYCELYLKDKTTD------------------DGAPLKLVEEKVNDRWEVCLAMSEKGFQQV-SFVNSIATTKGGRHVDYISDQVVGKLMDIVKRKN---KGGVNIKPFQLKNHVWLFVNCLVENPTFDSQTKENMTLQAKKFGSTAPLSDKFLKAVTSVGIVESVTTWMKFKQQTEL----QKKCHSSKHSKLKGIPKLDDANDAGTRFSKDCTLILTEGTRPNHHGKCG--------------DNNVIKIIGLQYKNNETAETLKT--------------LRYGKVMIMTDQDQDGSHIKGLLINFIQYNWPNLLKHNFVEQFITPIVKVTKQKDSLSFYSIPEFEEWMRETENWKWKIKYYKGLGTSTMKEAKDYSLTWKDIVFFLITWD--QTMMPLLNWPLPRKVEDRKEWLTSWLEERK.... 677
67 0.000e+00UniRef50_A0A075AVT9 DNA topoisomerase 2 n=1 Tax=Rozella allomycis CSF55 TaxID=988480 RepID=A0A075AVT9_9FUNG  ali  23  22..QQKRDNRPVEEVYQKKTQLEHILLRPDTYIGSTYTPGFYKIFDEILVNAADNKQRDPMGVIRVDIDENNVISVMNDGRGIPIEVHADEKVYVPELIFGHLLTSSNYNDSQKKVTGGRNGFGAKLCNIFSTEFVVETADKKKKFRQVFKKNMSEVGQPKI-VDYSKDDFTKITFKPDLKRFGMETFDEDVEKLFVKRVYDMAGVVKKVYLNGERIKIKDFKSYV--------------------NQFVKEDENGVKPTVLFEKSD-RWEVGFCISEGQFQQI-SFVNSICTSKGGTHVAHVADQIVGALVEATKK----KNKAAPLKPFQIKNQMALFINCLIENPSFDSQTKETMTLKQSSFGSKCILGEEFMKKVLKSGI-----VENILNVAQAKQNQMLKKSDGHKTSRISGIPKLDDANYAGTKSSSQCTLILTEGDSAKTLAVQGLSRDYFGVFPLRGKLLNVREASAKQILENQEIQNIKRILGLQQGKNYTSSELRYGHVMIMTDQDHDGSHIKGLLINLFDKFWPSLLKPGFIQEFITPIVKCTKGNKVESFYTIPEYEEWKKNNNGQGWTIKYYKD............................................................... 607
68 0.000e+00UniRef50_A0A0T5ZXH2 Gyrase subunit B protein (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A0T5ZXH2_9BACT  ali  43  1MAKKSSNNDYTAAQIQVLEGLDPVRKRPGMYIGSTDISGLHHLVLEIVNNSIDEALVGVCNRIDVRIGKDGYTTVTDNGRGIPVDIMPKYKVSALEIVMTKLHAGGKFGEGGYKVSGGLHGVGSSVVNALSEHMKVEVKRDGKLWVQEYKRGEPLYKVKEIGKVPADETGTIVSFLPDPEIFGKDQTDFSFLTERLRQFAFLTKGVFFHLTDERGDREENY--FFEGGIRSFVEALNRNKNPLHPAFYAHEN-----------RNGVDVEVSLQYNEGYNENVLCFANNIFNPGGGTHLTGFRAGLTRVVNDFGRAKGAIKDGGEGITGDDVREGLTAVVSVKIKNLQFEGQTKDKLGNAEVRPVVEQVVREKLFEFLEETPSAAQRIVSKGLLAAEARLAARAARDTVLRKGFLEGMGLPGKLADCQTDDPAE........................................................................................................................................................................................................................ 424
69 0.000e+00UniRef50_A0A0G1UHP7 Gyrase subunit B protein (Fragment) n=4 Tax=Bacteria TaxID=2 RepID=A0A0G1UHP7_9BACT  ali  45  1MAKQEKEGSYTAKDIYVLEGLEPVRKRPGMYIGTTDTAGLHHLVWEVVDNSIDEAMAGYAKNIRVELLPGNKVAVTDDGRGIPVEIHPQTKKSTLETVLTTLHAGGKFGGESYKVSGGLHGVGVSVVCALSAWMRAEVHRDGGIYEQEYKRGKPQY--KVRKIGKSNTTGTKVIFEPDAEVFKTIEFDRKRILDHLRQQAFLTKGIRIEAIDQRNEKERNYYAFQDGGLLSFIRYLSRNDKPLQEVPFYINKTSE----------GVEVEATFLYKNEPETQELSFANNIYTPDGGMHLTGFRSALTRSLNNYATENDYIKKTEDNLTGDDVRDGLIAIVSVKIREPQFEGQTKARLGNPEARTGTETVIGEALKDFLERNGADARRIMEQCLLXXXXXXXXXXXXETVLRKGVLEGLTLPGKLADCSSRNPEESELFIVEGDSAGG........................................................................................................................................................................................................... 438
70 0.000e+00UniRef50_A0A0H3UZ54 Putative DNA gyrase n=1 Tax=Geobacillus virus E3 TaxID=1572712 RepID=A0A0H3UZ54_9CAUD  ali  34  2........TYGNESIRSLSDREAVRLRPANILGSDDINGCFHCLIEIADNAIDEAKGGYGNKIIITKHKDNYYSVEDFGRGVPMDWNSVENKYNYELIFQTLYAGGKYDDDAYAFAKGLNGLGAAATAFSSKHMLVRSYRDGYKYEIEIVEGEVVGGLKK-EKYNYDSTGTFVKWQPDLSVFTETDIPFEWIKKYAEEQAIVNKGITVEVYNEETNEK--YTYYYENGIIDYIHKLNQGK--NFTDVVYWETEAVGRDREDKKDYRSKYQIAFCFNNEVN-VMESYHNSSFLKHGGSPHEAIKNGFTYAIDQLIKKKGEYKKGEKKITFDDIRDSLIIVTNTYSTETSYENQTKFAITNKFIRDFMTEYIKQQLEIYFIENPLEADKIVKQVLINKRSREKAEQTRLSIKKKNINNITNRVDGFVNCTSKDNTKTELIIVEGKSALGATKQGRNPEFQAIYALRGKILNCLKAEYDKIFKNDIVVDLLKILGCGVEIKFDINNLRWSKIIIVTDADQDGAHIRTLLLTLFYRLTPTLIKEGKVYIAESPLYEIVQGDKSYFAYSDKEKDEIISQLK-GKFIVQRSKGLGENTPEMMWETTMNPETRKLIQITVDDIEKMQKYFELFLGDDLQGRKDYIEEHLHE...... 645
71 0.000e+00UniRef50_A0A0H5C6T3 DNA topoisomerase 2 n=1 Tax=Cyberlindnera jadinii TaxID=4903 RepID=A0A0H5C6T3_CYBJA  ali  23  14.....KPKKNASEQYQKLTQLEHILKRPDTYIGSTEVPGLFKIFDEILVNAADNKIRDPMKKLE------------------------KEKMWIPELIFGNLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTVETADKNKTYSQTWKNNMSVAGKPKIKAVKKAVEYTKITFKPDLAKFHMEKLDDDILGVLRRRVYDLAGTVKGVYLNGTKLKIRNFKEYVEMYIKALDKKRLA--EGQISEVEAQKKPTIIYKKIDDPKAKGRWEIAFGV-ADSSFNQISFVNSIATTSGGTHVNYIADQIIDKIQEILKKKHKKSSVKP----FQIRNNMFLFINCLIENPAFTSQTKEQMSTRKPQFGSDCKIPDDFVNQIMK-----TEFIEKILDAAQANEDRALKRTDGARKSRLTNLPKLHDANMAGTKEGYKCTLILTEGDSLAVAGLAVVGRDYYGCFPLRGKPLNVREATASQITNNAEINALKQIVGLQHKKRYDTKSLRYGRVMLMTDQDTDGSHIKGLLINFIESQWPELLKPGFLLEFITPIVKVKPRKDTMSFYSMIQYEDWVNKESHKTWSHKYYKGLGTSTQEEGREYFLDRHLKTFEALQEEDKVSIDLAFSK---SKADARKEWIGDFKEDEQVED. 657
72 0.000e+00UniRef50_A0A183FFQ3 DNA topoisomerase 2 n=1 Tax=Heligmosomoides polygyrus bakeri TaxID=375939 RepID=A0A183FFQ3_HELBK  ali  21  12..............YERKSPIEHILLRPDTYVGSTYSPALLKIFDEILVNAADNKQRDAMNELRVDVDKSGVISIFNNGRGLPIEIHPLEGIYVPTLIFGNLFTSSNYDDREVKVVGGRNGYGAKLCNIFSKEFTVETRQSGRVFRQTWTNNMRECGEPTVTSDPTAVDGTKITFRPDVAKFGMSALDDAICKMFQKRTYDVAGTLRNVFYNGELVQVPSFREYVGLYSDESSQ-----------------------CDILYVNASRRWQWA----------------------GGKHVDHITDQLVNIIKPLVDANVKNGVKKVVI-----RNHLFVFVNALIENPAFNSQTKGVLTTLIPEFGSKCPLDSAVVKEWAERSG----LLDELTSDALAREGRPERRRRKVIPEDLSDIVKLEDANWAGSRHLEECRLLITEGDSAKALAVAGLGRDRYGVFPIMGKLTNVSGLSTEKASSAKEINHLMRILGLKYGVDYSMAKLRYGGIIILTDQDEDGSHIKGLIINFLHTFWPQLLRNGFVQSFRTPLLKARRGSETISFYSMSEFNKWKESTDAEKFTIKYYKGLGTSTSKEAREYFFDKHLVKFRHEDDEDDLRIRLMFDKRRSDD---RKQWISE.......... 621
73 0.000e+00UniRef50_A0A1D2VRA9 DNA topoisomerase 2 (Fragment) n=3 Tax=Saccharomycetales TaxID=4892 RepID=A0A1D2VRA9_9ASCO  ali  23  70.....PKGKTSSEKYVKLTQLEHILKRPDTYIGSTEVPGLFKIFDEILVNAADNKIRDPMSKIEVTIDPENEISILNDGKSIPIEIHEKEKIYIPELIFGTLLTSSNYDDNEKKVTGGRNGYGAKLCNIFSNKFTVETNDPKRNYKQTWQENMSKCNKPIITKITPKSSFTKISFQPDLTRFGMNELDKDILGVMKRRVYDISASVKNVFLNSSKLKVKDFKSYVNLY----VKALTEKKKLEAPYKDENETETEKEPYVAYRKVSDYFEVAFAVS-DGTFNQVSFVNSIATTSGGTHVNYVTDQIVSK----IIEKKKKQDKKTKLKPFQLKNYMFLFINCLIENPAFTSQTKEQLTTRPSSFGNYKTNFNVPDEFIKDIMKTDLNSTLDDIILKNVDKDLQKT-DGSGRKSRITKYIKLEDANKAGKSDGYKCTLILTEGDSARGQAASGLKRDYYGIFPLKGKILNVRDASSDQITKNAEIIAIKEIIGLKHKTKYNTKSLRYGKIMIMADQDYDGSHIKGLLINFFEISFPGLLEPGFLLEFITPIVKVTVTKQIINFYSIPEYEKWRDTKGVSNFKAKYLKGIGSSTEKDIKSYFLDLHKKNFRTLQDTDKQCIDLAFNK---KRADDRKEWIGNF......... 742
74 0.000e+00UniRef50_A0A1U3TE00 DNA gyrase subunit B n=7 Tax=cellular organisms TaxID=131567 RepID=A0A1U3TE00_9MYCO  ali  43  1.........................................................................................................................MGASVVNALSEWLEVEIHRDGNIYTQNFKNGGIPATGLVKTGKTKKTGTKVTFKPDSEIFKSTTTFNFDILSERLQESAFLLKDLKITLTDLRSGKEREEIYHYEEGIKEFVSYVNEGKEVLHDV-----------TTFAGHSNGIEVDVAFQYNDQYSESILSFVNNVRTKDGGTHEVGFKTAMTRVFNEYARRINELKDKDKNLDGNDIREGLTAIISVRIPELQFEGQTKSKLGTSEARSAVDSVVSEKLPYYLEEKGQLSKSLVKKAIKAQQAREAARKAREDARKKNKRKDTLLSGKLTPAQSKNTDKNELYLVEGDSAGGSAKLGRDRKFQAILPLRGKVINTEKARLEDIFKNEEINTIIHTIGAGVGTDFKIEDSNYNRIIIMTDADTDGAHIQVLLLTFFFKYMKPLVQAGRVFIALPPLYKLEKGKKVEYAWTDEELENLQKQLG-KGFILQRYKGLGEMNPEQLWETTMNPETRTLIRVQVEDEVRSSKRVTTLMGDKVAPRREWIEKHVEFGMQED. 524
75 0.000e+00UniRef50_A0A2J8AJ65 DNA topoisomerase 2 n=1 Tax=Tetrabaena socialis TaxID=47790 RepID=A0A2J8AJ65_9CHLO  ali  21  3..........DAGSYQKLDHREHVLLRPGMYIGSVYVPGLFKVADEIIMNAVDHSVRHPVKRICVSINKEGIISVENDGDGIPVQLHAEEGVHVPELIFGHMLTSANYDDSEERTIGGQNGIGAKACNIFSKWFEVETVDRKKVYTQRFHDNMSITDVPTI-KNSSKKPYTRVTFLPDYKRFGTDALDDDMYALLLRRVYDVTAITDAVSLNGEKIPFKSFERYCDLYLGTRND-----------------------AGRVYEALAPGWEAVVALSDGAGLQQISFVNGVATLRGGRHVDHFVNLLCKRLGDAIES----KRKGVAVKNQFVRDNLFVFLRATVPNPAFDSQSKETLTTPVAKLGIKLDLTDKFVDKVCKLEGLIDRVVGLSDVA----TEKGLKKTDGTKRSTISGIPKLDDAEWAGTTKSEQCILILTEGDSAKAMAISGLGRQKFGVYPLRGKVLNVCDVSAQKISENVEIANLKKILGLQAGKTYDVKDLRYGAVMALTDADTDGSHIKGLLMNLFVHQWPSLLEPGFLCSMLTPIVKATRSKQELSFYSNTDYQAWRTATAQNAWKTKYYKGLGTSTAEEAKKYFKDMRLVKYVW-DERSKDLMDMAFNK---KRANDRKLWLGSYNPKIA-LD. 655
76 0.000e+00UniRef50_A0A0G0V5L2 Gyrase subunit B protein n=3 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G0V5L2_9BACT  ali  38  2....SDTQKYTGQQIVVLEGLEPVRKRPAMYIGSTDITGLHHCLNEIIDNCIDEALAGFAKNIWVIVHPDNSATIADDGRGIPVDIMPKYKKPALEVIMTTLHSGGKFEGTAYKVSGGLHGVGAACVNALSNLYQVEVRRDGKIYSMEFSRGKVKSPLTTIPKTKNTVSGTTVTFSPDPEFKEGIELDTKTIIHSLKDRAYLTSKIYFHFFDQRDGGEHHY--YFEGGILSLLSEINKGKTVLHPPIYLHRA-----------DSGIDTEVAIQYNDSFQENTPSFVNIINTHEGGSHLSGFKTALTKSIKDYAERKEMVKNKDDSITGDDVREGLTAIISIKMKDLQFEGQTKGKLGNSEVQPIVAKIVREELDIFFEEHPDIAKTIVGKTLLTIQIRKAAKAAKDAIMRKGAFDSLGLPGKLADCQSKKPEECEIFVVEGDSAGGCFSGDTKIALTDGRSLSFVELIQEDSAGKKNYCYSINQQGSICISPITHPRLTQKNASVIKIILDNNQECTPNHPFLL............................................................................................................................. 523
77 0.000e+00UniRef50_A0A2W1GLF3 GyrB, Type IIA topoisomerase (DNA gyrase topo II, topoisomerase IV), B subunit n=1 Tax=Pyrenophora tritici-repentis TaxID=45151 R  ali  23  133...SKPKKGGASSKYQMLTHLEHIMKRPDTYIGSTYVPGLYKIFDEILVNAADNKQNDKMSEIRVTVDETGEISIKNDGKGIPIEIHKEHGIYVPEMIFGHLLTSSNYDDDQQKVTGGRNGYGAKLCNVFSTEFTVETVDQKKKYRQTWTENMSKMGKAKISDIK-SDDYTKVSWKADYARFGMTGIDDDFEAMVKRRTYDMAGTLRKVYLNGDRIKLTSFAKYMEMYTKSISRDQGKSEDDKEKDVIITDKLD-------------RWDIGFAVS-DGSFNQVSFVNSIATTSGGTHVNHIADQIVEKLMAIVNKKNKAAVK---LKPAQIKNHLFLFVNCSIVNPAFTSQTKEQLTTRPSQFGSKPVLSDKFLNAI------AKTDVIQNIMHFAQQKADQMMKKTDGNKRNRISNAKLTDANKAGTKDGHLCTLILTEGESASVLALAGRNQDLFGVFPLRGKLLNVRDATVDQIMKNAEIQNIKKFMGLQHKKEYDMKSLRYGHLMIMTDQDHDGSHIKGLLINFLQCQFPSLLKPGFLLEFITPIVKVWKGDNMKSFFSMPEYEEWKEQHQHKGWDHKYYKGLGTSDIPDAQIYFLDTHMKRFQ-------ELI--LFS--MADNV................... 769
78 0.000e+00UniRef50_D3APY1 ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein n=4 Tax=root TaxID=1 RepID=D3APY1_9CLOT  ali  43  29MAKT----QYNADSITVLEGLEAVRKRPGMYIGSVGTKGLNHLIYEIVDNAVDEHLAGFCNQIWVTLEADGSCTVRDAGRGIPVEMHKK-GMSAERIVLSTLHAGGKFDNDAYKTSGGLHGVGSSVVNALSERMSVKVYKNGLIHYDAYERGIPTVELLLPTRGKTKETGTEINFLPDGEIFEKTRFKAEWLKSRLHETAYLNPNLQITYQNKRGGEEETILFHEPEGIISYVKELNSGKAPVHDPIY-----------YKGTIDKVEVEVAFQFVDTFEENILGFCNNIFTQEGGTHLAGFKTRFTQMINSYARELGILKEKDANFTGADTRNGMTAVVAVKHPDPIFEGQTKTKLASADATKAVFTVTGDELQRYFDRNLEILKAVISCAEKSAKIRKAEEKAKTNMLSKSKFSFDSN-GKLANCESRDAEKCEIFIVEGDSAGGSAKTARNRMYQAILPIRGKILNVEKASMEQ............................................................................................................................................................................. 491
79 0.000e+00UniRef50_A0A1S4ES70 DNA topoisomerase 2 n=2 Tax=Neoptera TaxID=33340 RepID=A0A1S4ES70_DIACI  ali  22  23.KKTPANKMSVEKIYQKKSQLEHILLRPDTYIGSTYVPGLYKIFDEILVNACDNKQRDPMNCIKITVNQENTISVWNNGKGIPVVEHKDEKMFVPTMIFGHLLTSSNYNDEEDKVTGGRNGYGAKLCNIFSSKFVVETSCSKKSFKQVWKDNMSKVTSPEIKSGS-KDDFTKITFTPDLTKFKMTSLDKDMVDLITRRAYDAAASTKKVFLNGEKLPVKNFQDYVKLYTD-------------------RQDEDGDPVKIIYENVNPRWEVAIAPSDRGFQQV-SFVNSIATTKGGRHVDAVVDAIVKQIIEVVKKKN---KGGMALKPFQVKNHIWIFINCLIVNPTFDSQTKENMTLQKGSFGSTCKLSEKFINQVTKSGIIESVLQWAKFKEQNQLQKTSTGKKQNKLK----GVPKLEDANDAGTKNSIDCTLILTEGDSAKSLAVSGLGRDKYGVFPLRGKLLNVREATHKQILENAEINNLVKILGLQYSKKYDMKTLRYGRLMIMTDQDQDGSHIKGLIINFIHHNWPTLLRLPFLEEFITPIIKATKAREELSFYSLPEFEEWKEETNWHTYKIKYYK................................................................ 616
80 0.000e+00UniRef50_C4R475 DNA topoisomerase 2 n=2 Tax=Komagataella phaffii TaxID=460519 RepID=C4R475_KOMPG  ali  22  55..SSTANNVNVSDQYQKLSQLEHILKRPDTYIGSVEVPGLFKIFDEILVNAADNKIRDPMKNIEVTIKPENLIEVKNDGK---------------ELIFGNLLTSSNYNDDQKKVTGGRNGYGAKLCNIFSTEFIVETYDKGKLYTQRWSQNMGKTDKPVIKSIKKATEYTKVSFRPDLAKFNMTELDEDILGVLRRRVFDLCGSVRSVKLNGEKLKIRNFKQYVEMYVKA-LEHKNDPIKTEDXXXXXXXXXXXXXQTIVYQTLNDRWEIAFAVSDS-TFNQVSFVNSIATTSGGTHVNFIADQIVKK----IEKEIKTKNKKAMIKPFQIKNNMFLFINCLVENPAFTSQTKEQLTTRASQFGGKK--TEVPDDFIKKILRTGIVDAILDIAAMNAD--KALKKNDGSRKNRITGYPKLEDANKAGTKEGYKCTLILTEGDSASSLAVAGLGRDYYGVYPLRGKMLNVREASADQIMKNAEIQAIKQIMGFQHKKNYNINSLRYGHIMIMTDQDHDGSHIKGLIINFLESSFPGLLKPNFLLEFITPIVKVTIKRKVIPFYSMPEYEAWREQ-NTESFKQKYYKGLGTSLAEEMREYFLDKHMKTFHALQDVDPGFIDLAFSK---KKADDRKEWLRGFEPGV-HLD. 714
81 0.000e+00UniRef50_U6MZI4 DNA topoisomerase 2 n=2 Tax=Eimeria TaxID=5800 RepID=U6MZI4_9EIME  ali  21  32....KRAKKTIEERYQKKSQLEHILLRPDSYIGSTFAPGLYKIVDEILVNAADVKAREKMTAIKVNVNQEGTIRVWNDGDGIPVAIHKEHKVYVAELIFGQLLTSDNYDDTEARVTGGRNGFGAKLTNIFSTYFEVECADSKRNKKIKWTDNMSKQDPPVISPFNGAGDYVAVKFKPDLRRFGMTTLDEDLISLLRKRCYDLAGTATAVYWNGMRLPVRNFVEYVDLYLGESTGEGTEDGTETAQDEDKENERPPERQTIKIHEKMHRWEVVISQTDGSAFSQVSFVNSICTPKGGHHVNHVIEPLLAAL---VKKANAKNKGGMEIKAAHVRQHLWVFVKCLIENPAFDSQTKETLTTTVSRFGSKCNLSERTINAVAKSPILEGVLLWAQTKAQVEL-RRQMSVGKTKGRERLTGISKLEDANEAGGRYAQECTLILTEGDSAKTSCLAGLSRDKYGVFPLRGKLLNVREASFKQLKENREIQNILRILGLQINDKQDARGLRYGSLMIMTDQDYDGSHIKGLLINMLHHYWPQLLQCNHFTEFVTPIVKVSKGSVEKAFFTLVEYDMWRKQAGNLTGT--------------------------------GDGELIDMAFSK---KRAEDRKRWLQGY......... 699
82 0.000e+00UniRef50_Q4Q836 DNA topoisomerase 2 n=34 Tax=Kinetoplastida TaxID=5653 RepID=Q4Q836_LEIMA  ali  21  1......MGKTVEQIYQKKTQHDHILTRPDMYIGTTWTPGLYKIFDEILVNAADNKVRDPGQTVIRVWMTESYVRVYNNGEGIPIQKHREHDLWVPEMIFGHLLTSSNYDDEEAKVTGGRNGFGAKLTNVFSKQFEVETVRSRKKFYMKWTNNMLQHDDPVIVPCDSA-DYTMVTFYPDFALFHVDKFTEDMLKRRVYDIAGCTDKTLKCFLNDERIACTTFPEYVDLYPTMGEE----------------------RKAASYSRVNDRWEVCVRVSN-IGPQQVSFVNSIATTRGGTHVKYIMDQITSKVMEQA-----KKKKKTDVKPHMIRPHIFLFVNCLIENPGFDSQTKETLNTVKSKFGSTCD----LPNSIVDYIMSSGIVERSVEMANSKIAREMASKMRSSDRKQIMGIPKLDDANEAGGKHSHRCTLILTEGDSAKTLCTAGLDRDYFGVFPLRGKPLNVREASLKKLAACEEIQCVMKIMGLDIRQTYNSDGLRYGHLMIMSDQDHDGSHIKGLLINFIHCFWPNLLRPGFLQQFITPIVKARPKGKAISFFSMPDYFEWKKAIGDNNYQIRYYKGLGTSGAEEGREYFIDRHRLNFVEQEQSEEDRIVMAFGK---DRVEDRKEWITNFKTNV..... 646
83 0.000e+00UniRef50_P34534 Putative DNA topoisomerase 2, mitochondrial n=10 Tax=Caenorhabditis TaxID=6237 RepID=TOP2M_CAEEL  ali  22  35..PSTSFASEAAAKYEKKSPTEHVLLRPDTYIGGTYPPGLLKIFDEILVNAADNKARDSMNRLEVWLDETARISVWNNGSGLPVEIHPTEGIYVPTLVFGNLFTSSNYDDSEIKTVGGRNGYGAKLCNIFSKEFIVETVDTKRRFRQKWYDNMKKCNEAVEILDETVKDYTKVEFVPDLERFQIDKLSDDVIGRRVFEVAATLPRDVDVYLNGQKCDVDGFEDYVKMFNDSSSLLFLHPTPRWHVGVAKRNNFFGESHVVL-------------------PKIVSFVNNINTEKGGSHVDYVMDKIVNIIKPIVDSKLGDPTK--SVKPAVIKNNLSIFINCLIENPSFESQTKETLTTKAKNFGSIFECDAKKTAEWAEQSGLIEDIVEEVLNMK----KKKLPGKRVSVSSVRDIVKLEDAEWAGITGTAEKCTLILTEGDSAKALALAGLGRETYGVFPLKGKLLNVSNLDDARASKNEEISNLLRILGLKFENSITRESLRYGRLLILADQDEDGSHIKGLIVNFIHKFWPSLVHDGFIQSFRTPLLKAKKGDKVRSFFSMNEYRKWADVEEGGKWKIKYYKGLGTSTSNEAREYFLDHHTVNFKYTGTTDDDAIRMAFDR---DKSDERKEWIRRSENEITNED. 694
84 0.000e+00UniRef50_A0A1V5P839 DNA topoisomerase 4 subunit B n=7 Tax=root TaxID=1 RepID=A0A1V5P839_9FIRM  ali  45  22..............................................................................................................................................................PLKEVGRTRKQGTVVTFKPDERVFESTEMNFELISRRMRELAYLNRGIIMRLIDLRKQKREAEYCFLS-GLTDFVAFLNADKTALYPAPIYFK----------GEKDGIAVEVAMQHNDGYAESIFSYVNNIPTTEGGMHETGFKAALTKVLNDYCRRTGVLKEKDASLSGEDFREGLTAVLSLKMKTIQFEGQTKTRLGNTEARPAVEYVVMEQLIPFLEKNSETASRIAEKAQKAAHXXXXXXXXXXXXXXXXXXXXXPLVGKLSSCTGRNIQKNELFIVEGDSAGGSAKQGRDRSFQAILPLRGKPLNVEKKRLDQVLENAEFRSIITALGTGIGEDFDLAQRKYEKVIILSDADQDGAHIRAILLTFFYRYMKPLIMNGHIYIGLPPLYKVHKGERVIYAYNEAELALAAKELG-RGYLVQRYKGLGEMNPSQLWETTMNPDCRSLIRVGIEDAADVEHIVTVLMGDKVHSRKEYISEFANF...... 497
85 0.000e+00UniRef50_A0A2H2I8V8 DNA topoisomerase 2 n=2 Tax=Caenorhabditis japonica TaxID=281687 RepID=A0A2H2I8V8_CAEJA  ali  22  40...........AAKYEKKSPTEHVLLRPDTYIGGTYPPGLLKIFDEILVNAADNKARDPMNRLEVQLDPKARISVWNNGKGLPVEMHPSENMWVPTLVFGNLFTSSNYDDSEIKTVGGRNGYGAKLCNIFSKEFHVETTRRGRVFKQRWFNNMQSCDEPMIASGENLQDFTKVEFVPDLARFHVDHLTDDVIKKRVCEVTATAPRGIDVFFNGHRIPVDNFEDYVKAFNTSENDSNEHQILFLHPTPRWHVGVARRIALEGAEML---------------PKVVSFVNNINTEKGGTHVDYVMEKLVAILKREIDK--LLEKSKKSVKPALIRQNVSIFINSLIENPSFESQTKETLTTKPKTFGSVFECDAKKVTQWAESTGLIDDIVEQVLNIKPKKMSASPKNTSV---SVRDIVKLEDAAWAGLPGKSKSCTLILTEGDSAKALALAGLSRETFGVFPLKGKLINVSNLDDVKASQNEEIANLMRILGLSFDQPQIAENLRYGKLMILADQDDDGSHIKGLVINFLHRFWPGLLQNSFVQSFRTPLLKAQRGEDVKSFFSITEYQKWAETENLEKWKIKYYKGLGTSTSNEARQYFRDKHVVNFQYKDASDDEAIRMAFDR---EKTEERKSWIQ........... 694
86 0.000e+00UniRef50_A0A158QZI7 DNA topoisomerase 2 n=1 Tax=Nippostrongylus brasiliensis TaxID=27835 RepID=A0A158QZI7_NIPBR  ali  21  50..............YERKSPIEHILLRPDTYVGSTYSPALLKIFDEILVNAADNKQRDPMDELRVDVDQKGTISIVNNGRGLPIEVHPIEGIYVPTLIFGNLFTSSNYDDSEVKVVGGRNGYGAKLCNIFSKEFIVETSSKQKVFRQRWTNNMRECAEPVVTDDVNAMDYTKVTFCPDVSKFGMEVLDDAICRMFHKRTYDVAGTLRNVFYNGQLVKVSSFREYVSLYSDDSAADL------------------------LYVNASRRWQWAVKRTSGGFQQI-SFVNNIATTGGGKHVDHVVDQLVNIIKPLVDANVKSGVKRVAIK-----NHLCLFVNALIENPAFNSQTKGVLTTPVSDFGSKCAVDSAVVREWAERSGLVDELTSDTL----AREARPQRKQRKVVSEDLSDIVKLEDANWAGNGHMEECRLLITEGDSAKALAVAGLGRDRYGVFPIMGKLTNVSGLSEEKANSAKEINHLIRILGLKYGTDYNRQSLRYGGVIILTDQDEDGAHIKGLIINFLHTFWPQLIRCGFVQSFRTPLLKARRGSETISFYSAAEFNEWKRNTDADKFTIKYYKGLGTSTSKEAREYFSNQHLTTFRHEDDDDDLRIRLVFDKRRSDD---RKRWITE.......... 679
87 0.000e+00UniRef50_Q4UEG9 DNA topoisomerase 2 n=8 Tax=Piroplasmida TaxID=5863 RepID=Q4UEG9_THEAN  ali  21  3......KAKTVEERYQKKTQLEHILLRPDTYIGSTYVPGLYKIFDELLVNAADVYARQKMTCIKVTIDRTGAIVVYNDGEPIPIQIHSEHKMYVPQLIFGELLTSDNYDDSEERVTGGRNGFGAKLANIFSKTFTVVVKKTHKKFKMTWCNNMTKTKSPAHIESYTGPDFVKITFIPDYSRFNLEELDEGTYRVLKKRVYDMAGTLVKVYLNNERIKVKDFKDYVNLYLPEDATEIVK-----------------------IYEKMYRWEVVIS-SSEDGFRQVSFVNSINTLKGGTHVSHVVDPLVQSLT---KKVNSKNKGGIELKPNQIRNHIFVFINCQIVNPSFDSQTKETLTTKIVKFGSKYTMSDKTLNQVLKSKIFDNIISWLHEK---TNIELKKKMKVAKGNDKLFGIPKLEDANKAGTRYATECTLILTEGDSAKTSCLAGLSRDKYGVFPLKGKLLNVREASYKQLTQNIEVQNILKIMGLDITNKQDSSGLRYGSIMIMTDQDYDGSHIKGLLINMFHNFWPKLIQNGFIKEFITPIIKVTNKNQVHSFFTIEDFNNWKQTVDISNYRVKYYKGLGTSSDNEFKEYFLNRHIVEFKYVDTVDDDSIDLAFSK---KRIDDRKKWIQNY......... 648
88 0.000e+00UniRef50_A0A0P7EYP7 DNA topoisomerase (ATP-hydrolyzing) n=2 Tax=Vibrionaceae TaxID=641 RepID=A0A0P7EYP7_VIBAL  ali  33  1......MSEYNAKQLKVLEGLEPVREKPGMYVGSTDGAGVEHCAWEVVDNSCDEAQTGNCDKITVEVEQGGYVSVTDNGRGIPTDVMDGRQEPGAVTCYTKLHAGGKMSTDAYKFSGGLHGVGGSVVNALSSHLEVFVKRGGKLHHFNFENGGMWTDNYITGDCELEDTGTVVRYKLDANYFNKFTISEESLVASMNDRSTLLPGVTLEL----NYMGNKHTFLSNEGIADFIKEYTEASNPIMREVLRIEEETTHKGTIASVKPDGSIELDKNGMQKRVPHIETFVNNIRMRQHGKHLDGLIASVCDVVKAYA---FQTLGKNEKLENEDILAGAQFALALKAQNVQFKGQTKEALQSKKGETIVKKVFMPVFEAWIDSNPEAAKRLVEKSIRAAXXXXXXXXXXXXXXXXXXXXSVSLTGILAPCSSRNIDENELFIVEGDSAGGTAKAAADKKLQAVLPLGGKILNTFTTKPNKVYANKQINIIVEALGTGIGKDFDYSKLKFGKIIPLTDADVDGAHIQVLFIALCFKHMPELIKRGHLFIADTPLYKLEKKNKVIYIKDDKELNEKYPNGIPSGYHKGRFKGLGEMNAKELKETAMGFKDRTIRQLTEEKHEFYEELFDILMGDDPSLRYEYIQKHIDFTTEL.. 675
89 0.000e+00UniRef50_A0A2I0UK67 DNA topoisomerase 2 n=1 Tax=Limosa lapponica baueri TaxID=1758121 RepID=A0A2I0UK67_LIMLA  ali  21  41.KNDTSKKMSVERVYQKKTQLEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDKMTCIKISIDPENIISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETCKEYKHSFKQTWMNNMMKTSEPKIKHFDGDDYTCITFQPDLSKFKMEKLDKDIVALMTRRAYDLAGSCKKVMLNGKKLPVNGFRSYVDLYVKDKLDETGVALKVIHEVV------------------NERWDVCLTLSEKGFQQI-SFVNSIATTKGGRHVDYVVDQVVGKLIEVVKKKNKAG---VSVKPFQVKNHIWVFVNCLIENPSFDSQTKENMTLQPKSFGSKCQLSEKFFKAASNCGIIESILNWVKFKAQ----TQLNKKCSSVKHSKIKGIPKLDDANDAGGKHSLDCTLILTEGDSAKSLAVSGLGRDRYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKSYEDPSLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHGFLEEFITPIVKAFSKKK------IDDRKEWLTNF-MEDRRQRRLHGLGTATKHLTYNDFINKELILFSNSDNE.................................... 660
90 0.000e+00UniRef50_A0A1Z9B7W7 DNA topoisomerase (ATP-hydrolyzing) n=2 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1Z9B7W7_9PROT  ali  32  1.............................MY---TRTENPLHILQEVIDNSADEALAGYSKSVSIICHEDESYSIVDDGRGIPVGLHPNEKIPVIEIVYTKLHAGGKFEESAYAFSGGLHGVGVSVTNALSKKVEVTVWRQSFEWXIVFENGEVVSNLAKK-KQVRNKTGTSVRVWPDNKYFDSKTIPLDTLKXSLRARAVLLPGVKFTF-DSEIDNSKQTWFYXNGLADYFSQNILGSDFTAP----IWESESYVKTEDDFFSEGEGAKWILAFSNSGPIIRESYVNLIPTLAGGTHEAGFXEGIFQAVKXFIEQHKMLPKGTKXLS-EDVFSRISFILSAXVLDPQFQGQTKEKLTSRDALRLISSRIKGPFEIWLHKDTEIGKKIADLVIHHA---QLXQRASKVIERKRSSSVAVXPGKLTDCESKDXNRNELFLVEGDSAGGSAKMGRDKLFQAILPLRGKVXNTWEADKLRLLANSEVHDISVAIGIDPHDENNFTNLRYGKICILSDADVDGSHIQVLLLTLFIKHFPRLVSGGYIYISRPPLYRIKKPPKKIYALDEKELDGICEKLNKEGFTISRFKGLGEMNADQLWETTLNPDTRRLMPVKIEASELTKQKFNMLMAKESSSRRSWLEK-MSDKAQVDL 627
91 0.000e+00UniRef50_D2IUU9 Gyrase B (Fragment) n=22 Tax=root TaxID=1 RepID=D2IUU9_BACUN  ali  44  1..........................................LVYEVVDNSFDEALAGYCDHIEVTINEDNSITVQDNGRGIPVDYHEKEKKSALEVVMTVLHAGGKFDKGSYKVSGGLHGVGVSCVNALSTHMTTQVFRNGKIYQQEYSCGHPLYS--VKEVGTTDITGTRQQFWPDGTIFTETVYNYDILATRMRELAYLNAGIKISLTDLRVKDEKKEIFYSEEGLKEFVRYVDSSREHFMNDVIYINT----------EKQGTPVEVAIMYNTSYNENVHSYVNNINTIEGGTHLAGFRRALTRTLKKYAEDNKMLEKAKVEIAGDDFREGLTAVISIKVAEPQFEGQTKTKLGNNEVMGAVDQAVGEALTYYLEEHPKEAKLIVDKVILAAQARIAARKARESVQRKSPMSGGGMPGKLADCSSKDPEECELFLVEGDSAGGSAKQGRNRAFQAILPLRGKILNVEKAMWHKAFESDEVNNIIQALGIRFGVDGEDSK................................................................................................................................................... 453
92 0.000e+00UniRef50_A0A101HSY7 DNA gyrase subunit B (Fragment) n=5 Tax=Bacteria TaxID=2 RepID=A0A101HSY7_9FIRM  ali  55  1......................................................................................................................................................................................................................................................................................YVENIFSYANNIKTTDGGTHEAGFKAALTRVVNDYGRKYNILKNSVGNLSGEDIREGLIAVISVKVPEPQFEGQTKTKLGNSEVRSIVDAVVVEGLGTFLEENPAVAKRILEKAITASRAREAARKARDLTRRKSALESSTLPGKLADCSDKDPSVSELYLVEGDSAGGSAKQGRDRRFQAILPLRGKIINVEKARLDRILANEEIRAMITALGTGIGDEFDLSKARYHKIILMSDADIDGAHIRTLLLTFFYRYMRPLIDNGYVFIAQPPLYKVKKGKMEHYIYNDQELEKLLKRIGREGIVLQHYKGLGEMDATQLWETTMDPDTRTVMQVNLEDAMEADAIFSMLMGDKVEPRREFIQENATLVRNLDV 372
93 0.000e+00UniRef50_W6L624 DNA topoisomerase 2 n=1 Tax=Phytomonas sp. isolate Hart1 TaxID=134013 RepID=W6L624_9TRYP  ali  21  1......MSKTVEQIYQKKTQHEHILARPDMYIGTTWTPGLYKIFDEILVNAADNKVRDPGTMIKVWIDE-HSVRVYNNGEGIPIQKHREHNLWIPEMIFGHLLTSSNYDDNEAKVTGGRNGFGAKLTNVFSKRFELETVRSRKKFYMKWTNNMIDHEDSLITPCD-GPDYTMVTFYPDFARFRMEKFSQDLIWLMQRDIAGCTDKSLKCFLNGNRIPVTNFTEYVALYPTMGEE----------------------VHKHSYARVSDRWELSVRVSN-IGFQQVSFVNSIATTRGGSHVRYILDQIINKVIEQAKKRS-----KTEVKPHMIRPHIFLFLNCLIENPGFDSQTKETLNTVKSRFGSACEIPPAMIDYILRSGIVERS----VEMANSKLTREMSSKLRNSDRKQILGIPKLDDANEAGGKYSHRCTLILTEGDSAKTLCTAGLDRDYFGVFPLRGKPLNVRDASLKKVIQCEEIQSVFKIMGLDIRQKIDVNTLRYGHLMIMSDQDHDGSHIKGLIINMIHYYWPNLLRVPFMQQFITPIVKARRKDKAISFFSMKDYFEWKQSIGDSHYEIRYYKGLGTSGAKEGREYFENIERHRLDFVERSDADRICMAFAK---DRVEDRKEWITHYKANENN... 649
94 0.000e+00UniRef50_J4C854 DNA topoisomerase 2 n=3 Tax=Theileria orientalis TaxID=68886 RepID=J4C854_THEOR  ali  21  3......KVKTVEERYQKKSQLEHILLRPDTYIGSTYVPGLYKIFDELLVNAADVYARQKMTCIKVTIDETGAIVVFNDGEPIPIQIHSEHNMYVPQLIFGELLTSDNYDDSEERVTGGRNGFGAKLANIFSKTFTVVVKKMKKKFKMTWCENMRKTKGPAKVEPYQGQDFVKITFLPDYEKFNLKQIDPGTLKVLKKRVYDVAGTTVKVYLNNERIKIKDFKEYVNLYLPEDASETVK-----------------------VHDKMYRWEVVVSGSEEG-FRQVSFVNSINTIKGGTHVSHVVDPLVQSL---SKKVNSKNKGGIELKPNQIKNHIFIFINCQIVNPSFDSQTKETLTTKIIKFGSKYTMSEKALGQVLRSKIVDNILNWLHE--KTNIELKKKMKVSSKGSDKLFGIPKLEDANKAGTRFSMECTLILTEGDSAKTSCLAGLSRDKYGVFPLKGKLLNVREASYKQLTQNVEVQNILKIMGLDISNKEDSSGLRYGSVMIMTDQDYDGSHIKGLLINLFHNFWPKLIQNGFIREFVTPLIKVTKAGQVLSFFTMEDFNRWKETVDITSYKIKYYKGLGTSSDKEFKEYFLNRHLIEFNYVDNKDDDSIDMAFSK---KRIEDRKNWMQNY......... 648
95 0.000e+00UniRef50_A0A010QMY1 DNA topoisomerase 2 n=8 Tax=Opisthokonta TaxID=33154 RepID=A0A010QMY1_9PEZI  ali  23  106.APKTKKNAT--DTYQKLTQLEHIIKRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDAMTTMKITVDREGEISVENNGKGIPVEIHGKEKIYIPEMIFGHLLTGSNYDDDEKKTVGGRNGYGAKLCNVFSEQFTLECQDNGKRYKQVWTDNMSKCGKAKISSSKTS-DFVRVTFKPDFKRFSMTGIDDDLEALINRRVYDMAGTVRKVYLNGTHIKL-AFKGYCEMYAKAISKERGAEEGVEPKVV----------VEVDKTDAHPRWEIAFTVS-DGSFQQVSFVNSIATTSGGTHVNYVADQITGS----LLKTLDKKKKGHALKQNHIRNHIFIFVNCLVNNPAFTSQTKEQMTTKVSQFGSKCPLTEEFLKKIAK-----SDAIQNIIDFAEKKADKMMAKSDGNKRSRISN-AKLVDANLAGTRHGHECTLILTEGDSAKSLAVAGRDPDRIGVFPLRGKMLNVRDASIDQITKNAEIQNIKQFMGLKHKQTYDTKSLRYGHLMIMADQDHDGSHIKGLLINFLQVQYPSLLQIPDFFEFITPIVKVWQGQRLKSFFTQPQYEEWKDSNRNDRWHYKYFKGLGTSSNEDAQVYFLDDHLKEFDTMKTEEADLFDLAFSK---KKADARKEWL............ 758
96 0.000e+00UniRef50_UPI000A177241 hypothetical protein n=1 Tax=Clostridium botulinum TaxID=1491 RepID=UPI000A177241  ali  37  1MSEEIK---YDESQIDVLEGLEAVRKRPAMYIGSTNKTGLHHCVWEIINNSVDEARMGECTLVEIKILKNGHICIKDNGRGIPCGLHPKKGISTLEVILSTLHAGGKFGENGYSKAGGLHGVGTSCVVALSDDFDATVYRDGKIYNQKYCKGKKTTE--VRTIGETKERGTVITFYPDKSFKDTIEFDYETIKDRLIDIAYQNSNTTFILKDEREGKENEEEFYFKDGIKEYINNRIGKTKTILHNTIYINT--------HCEEKDVDVEVCFNFIDKYGEDTKSLVNSISTTEGGTHVQGFYNGLAKVFSEFARQNKILNQKDKDFKMEDVREGIVSIINAGVNEPEFEGQTKSKLGDSYVKSVFQNIIKEYFSVFIIEHQEESLKLANKF---KTTQKMRNKVKNIKNKTSQIDDPRITSKVINCTTFPPKFCEIYIVEGDSAGGSAKSGMDRRFQFILPTKGKILNVEKMMGNRVLTSDTLNQFILATGLSYKKQADMSELKCGKIILMTDADTDAEHIRLLWITYIWRYHRWLIDEGLLYIAKPPLFKVTNKKTKKYCFSEYDRDEAVKYGGIKNCLIQRYKGL.............................................................. 578
97 0.000e+00UniRef50_W2T8R7 DNA topoisomerase 2 (Fragment) n=2 Tax=Ancylostomatidae TaxID=33278 RepID=W2T8R7_NECAM  ali  20  333...KKSTTNPIVESYERKSPIEHILLRPDTYVGSTDSPALLKIFDEILVNAADNKQRDPMNELRVDVDERGKITLFNNGRGLPIEIHPKEGIYVPMLIFGNLFTSSNYDDREVKVVGGRNGYGAKLCNIFSKEFVVETWSQGRSFKQIWKNNMRDCDEPVVSESQDLVDGTRITFSPDLAKFGLSKLDDDICEMFKKRTFDVAGTLRGVVVYYNGELVEVNTTFRKMRWLTIIFVFWVPSFREYVDLYSDDSDDVSSNNVLFVNASKRWQWAVKRSGAGFQQI-SFVNNIGTTGGGKHVDYITDQLLNIIKPLVDSYLKTGIKKNAIKNK-----ICVFVNALIENPAFSSQTKEILTTAIADFGSKCICDVTSVQTWAMESG----LVDELTCEALAKEGRPAKKVKPKTEDLSDIVKLEDANWVGDATHSQDCRLLVTEGDSAKALAVAGLGRDRYGVFPVMGKFMNVSGLKKEKLEASKEVNQLMRILGLKYGEDYNRAKLRYGGIIILTDQDEDGSHIKGLIINFLHTFWPELLRNGFIQTFITPLLKARRGSESYSFYSMDEFKKWEESTDAAKYTVKYYKGLGTSTSKEAREYFSNKHLVSFRYDGEKDDEKIRMAFEKRRSDD---RKRWISERLQSVE.... 1005
98 0.000e+00UniRef50_A0A0N5CF92 DNA topoisomerase 2 n=2 Tax=Strongyloididae TaxID=6246 RepID=A0A0N5CF92_STREA  ali  20  50MENNKSAGKTIEQMYQKKSRSEHTLLRQDAYIDSVYVAALYKIYDEILVNVADNKQRDKMNIIKVNIDKSNTISIYNNGKGIPVAHHGVEKMYVPELNFGTLLTSSNYNDDEKKTTGGSNSYGATDYEMHSTRYSYTSGKVYKNLFIRTLVNNAIKDREPEIEKASGEDFTKVTFKPDLKKLKMKELDDDIIGLMARRAYDIAGTTPGVYLNGKVIPVKSFKEYAEKYVESVVGEDNK------------------KPKIIYEKVNDRWEVALTVS-ERDFQSVSFVNSIATSKGGRHVDYITEQITANMIDTIKK----KAGGVNIEPFQVKRHIWVFVNCLIENPTFDSQTKENMTLQAKSFGSKAEMSEKFYKEALKCGVVEAVLSWIRFKQQEQADKKCSTKKSTKVK----DIPKLEDAYEAGTKNSYKCTLILTVGDSAKTLAVSGLSRDYYGVFPLCGKMLNVRDCSMKQINDNQEIGHMIKILGLQYRLKYDTEDLRYGRVMIMADKDQDGSHIKRLLINWIHCNWPALMKNNFVEEFITPIVKASKGNTSLSFFSLPEYMEWRNSTNWKSYKIKYYKGLGTSTSKEAKEYFMDRHRIPFTYSGPECEEAVEMAFSK---KKIETRKAWLSNWMREKK.... 705
99 0.000e+00UniRef50_K0TQD1 DNA topoisomerase 2 n=15 Tax=Eukaryota TaxID=2759 RepID=K0TQD1_THAOC  ali  22  35.AASKGKTKTIEETYQKKTQLEHILLRPDTYIGSVFTPGLYKIFDEILVNAADNKQRDPMDRLEVEIDAENTISVKNNGKGIPVVEHKEHNCYVPTLIFGHLLTGSNFDDDEKKTTGGRNGYGAKLANIFSTEFTVECLDNEKKFSQTFRDNMHTAETPKIKKATKAEDYTKITFQPDLKFNMNGQLDSDTTGLLSKRAYDIAGSM------------------SMKGGKKLSVFLNGKKLPIKDFKSYIALFDNIQKPDAFEKVNDQWEVGVGVS-DGSFQQISFVNAIATTKGGGHVNYIADQVAKKLQAAVKKKN---KGGTEIKPNQIKNHLAVFVNCLVENPTFDSQTKENMTKKPSTFSSVKL-SDKFIKAVEK-----SGVVDSIMQFAKFKANQALKRKGGTKKTKLTGITKLDDANNAGTAKSKDCTLIITEGDSAKSLAVSGLSRDFYGVFPLKGKPLNVRDATHAQIMKNEEIMNLVEIMGLKFGTTYNIKSLRYGHLMIMADQDHDGSHIKGLVINFIHHFWPSLLDPGFLQQFITPIVKCTKGKKSETFFTLPEYEEWKEGTGNKGWTTKYYKGLGTSTSSEGKEYFLDIHEIHFNEIDVDDADLIDMAFSKA---KVEERKVWLNR.......... 706
100 0.000e+00UniRef50_A0A1Q9DNV1 DNA topoisomerase 2 n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9DNV1_SYMMI  ali  21  284...................................YVPALYKIFDEILVNAADNLQRDKMKAIKVDIDRKGRIKVWNDGKGIPIQLHKKYKVFVPELVFGHLLTSDNYDDSERKVTGGRNGYGAKLTNVFSRKFVIETAGGGKKYKQEWTGNMSKKGKPQVTKGSSAASYTSVEFWPDLSKFGMKELEADTVALMMRRVYDIGGTSCSVYLNGRKLEVKNFVDYCQQFHGD--------------------------EGYAYAQLNKRWQVLVARSDGDGFQQNSFVNAISTPKGGTHVNYILDQLVDAISS---KASKQAGKGVEIKRVHVKSHLWLFINCLIENPAFSSQTKEQMTLKASQFGSHCSLPRAFIEEVLTNTGIVDAVISEAQSKMTLQMDKSNSKASHG--KRVLGVPKLEDANEAGGKLSKECTLILTEGDSAKALAVAGLSRDKYGVFPLRGKLLNVREINQKALADNKEAMNIVKILGLSFDKK-KVTDLRYGKVMIMADQDYDGSHIKGLLINFFHYFWPDLLRKGFLQQFVTPIVKATKDGKVEQFFTMVEYEKWKAKTKDGGWKIKYYKGLGTSTAAEAKEYFGNDHRMDFKWKGPSENKLIDMAFNKGRSDD---RKSWMNKY-QEGTFLD. 874
101 0.000e+00UniRef50_UPI000D7BF9F7 DNA topoisomerase IV subunit B n=1 Tax=Candidatus Sulcia muelleri TaxID=336810 RepID=UPI000D7BF9F7  ali  40  18..................................................SIDEYLSGYCTKIRITFHKNEYITVLDNGRGIPVDLYKNKGISTLEVIMTKVGAGGKFDKKAYKISGGLHGVGISCVNALSCYLLARIFRNGKIYEQIYSKGIPITKLKKLDKNKKQMRGTEITFKVEKSFFGKKIFDYNLILNRIKELSYLNKGLLLILIDKRFYPNKKEFCYSKKGIKEFCYSKKGIKEFCYSKKGIKENYLKKFFYLKKKNKKIQLELAMKFNSSFKEKIYSYVNNIPT-----HISGFKRALTKT-----FKKFYYKKYKIEISGKDIREGIIAIISMRIANPQFEGQTKKKLGNNEIIGLVEKIVSNELNIFINANPLLKKKILKKVFSKKVRNLIQKQI-----------NNILPLKLADCSSNNHNLCEIYLVEGDSAGGTAKQGRERKFQAVFPLRGKILNVEKSMKEKIFENEEIRNLFSVLGIFLRKKENIKNIRYKKIIIMTDADIDGSHISTLILTFFFRNLKILIEKGYIYIATPPLFLIKHFNKKLYAWNEKEKEKILKNIGNKGIHIQRYKGLGEMDAEQLWETTMNPLNRTLRQVKIDNFKNANYIFSMLMGKKVFKRRKFIEQNALF-ANID. 610
102 0.000e+00UniRef50_U4PQV7 DNA topoisomerase 2 n=1 Tax=Caenorhabditis elegans TaxID=6239 RepID=U4PQV7_CAEEL  ali  22  35..PSTSFASEAAAKYEKKSPTEHVLLRPDTYIGGTYPPGLLKIFDEILVNAADNKARDSMNRLEVWLDETARISVWNNGSGLPVEIHPTEGIYVPTLVFGNLFTSSNYDDSEIKTVGGRNGYGAKLCNIFSKEFIVETVDTKRRFRQKWYDNMKKCNEAVEILDETVKDYTKVEFVPDLERFQIDKLSDDVIGRRVFEVAATLPRDVDVYLNGQKCDVDGFEDYVKMFNDSSSLLFLHPTPRWHVGVAKRNNFFGESHVVL-------------------PKIVSFVNNINTEKGGSHVDYVMDKIVNIIKPIVDSKLGDPTK--SVKPAVIKNNLSIFINCLIENPSFESQTKETLTTKAKNFGSIFECDAKKTAEWAEQSGLIEDIVEEVLNMK----KKKLPGKRVSVSSVRDIVKLEDAEWAGITGTAEKCTLILTEGDSAKALALAGLGRETYGVFPLKGKLLNVSNLDDARASKNEEISNLLRILGLKFENSITRESLRYGRLLILADQDEDGSHIKGLIVNFIHKFWPSLVHDGFIQSFRTPLLKAKKGDKVRSFFSMNEYRKWADVEEGGKWKIKYYKGLGTSTSNEAREYFLDHHTVNFKYTGTTDDDAIRMAFDR---DKSDERKEWIRRSENEITNED. 694
103 0.000e+00UniRef50_Q6RCM0 DNA topoisomerase 2 n=9 Tax=Entamoeba TaxID=5758 RepID=Q6RCM0_ENTHI  ali  22  1MSKEKEKL---EDIYVKLSHKEQILTRPDTYIGSVEAPGLFKIYDEILVNASDNFQRDPMTTIKVTI-EGNSITVYNNGKGIPIEIHKKEHIYIPELIFGHLLTSSNYKDDDKKVTGGRNGYGAKLANIFSTKFSIETCDGKKIYKQTWKNNMSDKEEPEIESVKKVEEYTKVTFTPDYKRFQMKGMEDDALIRRAYDIAGCNPGKRI-WINGKKVCFKNFAEYARMYVGD--------------------------EPIVSEKAGERWDICVCASKGEPMQI-SFVNSINTSHGGTHVDYVTGLMTKYL---AEKMKKLNKKGAEIKPFQIKNHLFVFVNSLIENPAFDSQTKETLKTQVNKFGSKPSLSDKFFKELGK-----LSVVDDILAWAIKKGEMDLNKSGGKKTARITGIPKLDDANKAGTKEGNLCTLILTEGDSAKTLAVSGLSRDYYGVFPLRGKPLNAREIAPSKVKENHEFENIAKIMGLRYGKVYTSIDLRYGSVMIMADQDFDGSHIKGLLINYFHTFWPSLLKDNFLVEFITPIVKVKRGKQEISFFTLPQFNEWIQEGQLKKWEIKYYKGLGTSKDSDAKAYFLDTHKIKFAYDGAGSDEVIDLAFNR---KRADDRKEWLKGYDPN-TYLD. 648
104 0.000e+00UniRef50_A0A0V0QDZ1 DNA topoisomerase 2 n=1 Tax=Pseudocohnilembus persalinus TaxID=266149 RepID=A0A0V0QDZ1_PSEPJ  ali  23  91....SKKPKTIEQTYKKLTQLEHVLQRPDTYIGSTYVPGLYKIFDEILVNAADNYQRKRMDEIRIVIDEENLISVKNNGQGIPVQIHQEYNIYVPDLIFGNLLTGSNYDDDQKKVVGGRNGYGAKLANIFSSKFIIECGDGKKSFRMEWQNNMTKKSEPIVESYK-GEDYTCVTFIPDLKRFQLARLTKDILKKRAYDIAGIFNNKVKVYLNNKKIEIKNFKQYIDLYIPDVADE----------------------FKIYDKKMTTDRWEVMVSFSDGQFKQVSFVNSICTSKGGTHVNSIIDRIVDAIKEGIQK----KNKKIEIKPHMIKSHLWVFCNCLIENPTFNSQTKEYMTLKPQQFGSKLEISESFIKKIVNSGVIDTII---NQAKAKENDKLLKTMKGGKKASRITGIPKLEDANNAGTRKSEECTIILTEGDSAKALAMAGIGRDSYGVFPLRGKMLNVRDADAKQIRENQEIQNLIKIIGLKAGQEYDLKELRYGSVMIMTDQDHDGSHIKGLIINMFQKFWPTLFSQGFMREFVTPIVKARHKNQVFKFFTLTDFKNWLEQQNPNDWKCKYYKGLGTSDNKEAIEYFEDQHQIDFIYQNEEDDAAVDMIFS---NKKIEQRKQWLQNYNPEV..... 742
105 0.000e+00UniRef50_M1GJU8 DNA topoisomerase (ATP-hydrolyzing) (Fragment) n=70 Tax=Bacteria TaxID=2 RepID=M1GJU8_9GAMM  ali  44  1......................................................................................HEEEGVSAAEVIMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEKLELTIRRDGKVHEQTYRMGVPQAPLRVV--GDTEQTGTTVRFWPSMEFRVNTEFEYDILAKRLRELSFLNSGVSIRLVDKRTNAEDLF--HYDGGIKAFVEFLSRNKNPIHPNVFYFST----------EKDGIGVEISMQWNDGFQENIYCFTNNIPQRDGGAHLVGFRTAMTRTLNSYMDKEGYNKKSKVSATGDDAREGLIAVISVKVPDPKFSSQTKDKLVSSEVKTAVETLMNEKLVEYLLENPNDAKTVVGKIIDAARAREAARKAREMTRRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKARFDKMLSSQEVATLITALGCGIGRDYNPDKLRYHSIIIMTDADVDGSHIRTLLLTFFYRQMPEIIERGYVYIAQPPLYKVKKGKQEQYIKDDEAMDE................................................................................ 472
106 0.000e+00UniRef50_UPI000711C38A DNA topoisomerase 2 n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI000711C38A  ali  22  377.TENEVILKQIGENYQKLTQREHILKRPD--IGSITTPGLLKIFDEILVNAVDNKQRSPMTTIKVTVDKEGLITVYNDGNGIPVVMHPEFDMYVPSLIFGQLLSGTNFDDTTKKVTGGRNGYGAKLTNIYSTEFRVETVSNGKRFVQTFHNHMEIEDKPRVTKASKSKEYTEIQFKPDLSLFGYSSLDDDMISIMHRRVIDVAGIINRVYWNGERVNVK--------GFEDYVEFEVEAKEGADNRILGELVFSTNP--------RWQYAVVPTRTEGIFPVTMSFVNGICTSRGGKHLTYLTDQLVSHLQPLLEKRLKRPVKPLLI-----RQHLSVFCNCLIENPTFDTQTKDFLTTSVKEFGSTPHLSDSFLQKIMRSGLP-----ELVAASMKIKDEESLRKGSGVKASRILGIPKLDDANNAGTRRSNETTLIVTEGDSAKALAVGGLGRDNYGVFPLKGKVLNVKDVSEKASLENEEIQNLVRILGLKYGKEYETTDLRYGHLLTMTDQDYDGSHIKGLILNLFATYWPSLLRLGYVSQFITPIVRATRGSESHSFYTYTQFHNWIQTQDQKQWHIKYYKGLGTSTAKEGKEYFLDSHVIPFLPMSQPEEDLIDMCFRR---KRCEERKEWMNEWTEDR..... 1033
107 0.000e+00UniRef50_A0A2T3KMZ8 DNA topoisomerase (ATP-hydrolyzing) n=1 Tax=Photobacterium kishitanii TaxID=318456 RepID=A0A2T3KMZ8_9GAMM  ali  32  2......AQEYNANSFEVLKELDPVKRRPGMYIGSTDGAGVTHCFFEVVDNATDEALINMCNEISIIIKDDGFVEVIDNGRGIPVDINDETGICGATLVYSKLHAGGKFSNKNYRFSGGLHGVGGAVVNALSTDLILTIKRDGKIHQITFYNGGHFDSAKVIGECDPKDTGTSVRYKLSKQYFNQFELSEAWLVNMLKDRACLKAGLRYNLDYKEPLCVKEETTYKGSRDKYFDDGTQAFRDVEKTDPETGTKVKSKVAVKETYTEDVEVEFAVFIEDKMSQMSKSYVNNITTPLHGKHLDGLVEGFCQAVKDYLFARLPKKIPSSQLLDSDISSGCQFAIMAMMQDISFKGQTKDELNSQKARTVIYPISLQYFKRWLEMNPSAAERIVMKSIRCQEQRLHNQKAKDEEEKNSSSTSMSLTGILTPCRSRDINVNELFIVEGDSAGGTARKAADKETQAVLPLKGKILNTFKATPTKIAQSAQIKILTAAIGTGVGDEFDYSKLKYGKIIPLTDADVDGSHIQLLTVAYLYKFAVKLIKAGHIFIAVPPLHKLTRKREVVFIKNDEEFARLYPKGCPQGWTKGRFKGLGEMNDYELEETAMNVKTRSIYQLNYKPEKEAVELFDILMGDDPSKRLDFIRENIDFTD.... 687
108 0.000e+00UniRef50_A0A1P6C3R4 DNA topoisomerase 2 n=8 Tax=Chromadorea TaxID=119089 RepID=A0A1P6C3R4_BRUMA  ali  22  63............EKYQRLTPLKHILYRPDSYIGPTFVPGLLKIFDEILVNAADNKRRDPMTTIAINIDKENTISIWNNGRGIPVEIHPREGIYVPTMIFGTLFTSSNYDDSELKIVGGRNGFGAKLCNIFSTEFSVETCQSGLRFFQCWRNNMNDVDDPIISDASTNSDYTCVTFKPDLSKFKLSTLDEDTIQVMIRRIVDIAGTLDNVFLNGTKIEVSGFKDYVKLFST------------------YTGESVENSTVPSYCSVNDRWQIAVARS-DTGYNHISFVNNINTLKGGRHVDYIVNQIVSRLKHEINQRY---GCDKFISAHQIKNRLHIFVNSLIENPAFESQSKEYLTTSVKNFGSTCIVPESFYENFIKDSDIIHHLL-------CDISQQHTTSLNRSMNRSLWDLSKLEDAADAGTKNGCNCTLIITEGDSAKALAVAGLGRKQYGVFPIRGKLTNVRGMDAKMAVENAEISALVRILGLKFGENYSSHSLRYGRLLIMTDQDPDGSHIKGLIVNFLHVYWPSLLKANYVSYFITPLLKAKRGSDIKSFYSTADYEKWRAENPDSKYSIKYYKGLGTSSAKEAREYFNDRHTVNFIYDGKISDESIELAFAK---NKADDRKVWIAE.......... 699
109 0.000e+00UniRef50_A0A0B7NGG4 DNA topoisomerase 2 n=18 Tax=Fungi TaxID=4751 RepID=A0A0B7NGG4_9FUNG  ali  21  182.ESTPANNKTIEEIYQKKTQLEHILLRPDTYVGSIYVPGLYKIIDEILVNAADNKIRDPMNSIEVVVDTQNFISIRNNGCGIPITMHKDENCYVPELIFGHLLTSSNYDDNEKKVTGGRNGYGAKLCNIFSTEFTVETADKERKYKQVFKKNMTTIGKPNITANSRGEQYTRISFKPDLKKFNLTEMDEDFIKKRVYDLAGICKGVN-VSLNGTKIGVKSFQDYCHLYSNTME----------------FRPKEGAPPIIVGNNKDSPRWTVNFAVSDGQFNQVSFVNSICTAKGGTHVNYIADQIVKHLLPEVQKKAHSKN----IKPFQIRNHMCLFINCLIENPAFDSQTKENMTLRTSAFGSTYKMTDAFIKNIKNSGIIDNIVRWVKFK-----EDEKMEKADKGSMARRLNIPKLEDANLAGVRPHNKCTLILTEGDSAKALVLSGLSRDKYGVFPLRGKVLNVRDSSAAEIMNSAEITNIKAILGLKHNKTYDVSELRYGKLMLMTDQDHDGSHIKGLLINFIDSMFPSLLDPGFLLEFITPIIRCRHKKQEISFFTIPEYETWAEEHNRNSWEPKYFKGLGTSDKADARKYFLDIHKKEFATPTPEARELVDMAFNK---KRVNDRKAWLDTY......... 833
110 0.000e+00UniRef50_J9D3E4 DNA topoisomerase 2 n=1 Tax=Edhazardia aedis (strain USNM 41457) TaxID=1003232 RepID=J9D3E4_EDHAE  ali  24  4........KTIEEQYQKKSQIEHILLRPDTYIGSIYVPGLFKIFDEVLVNAADNKIRDNMSYVKVIIDASCVISVENDGKGIPVAVHKTEKVYVPELIFGHLLTSSNYNDKEKKMTGGRNGYGAKLCNIFSSVFVVETRDKHLFYRQTFYDNMGRKDEPEIKKGAITSDFTRITFKPDLKKFNMSSLDADIIALLSKRVYDLSGTVISVFLNNREIKSKGFKSYCKLYF-----------------------ENADEHVFYHSVVNDRWEIVFS-NSEDQFSQVSFVNSICTSKGGTHVNHVLDQIIEPIAEHIKK----KEKGLTIKPFQIKSSIFIFINCLIENPSFDSQTKENLTLNPKKFGSKCVPIDDIIKQILRNGSF----IEKIVGFARAKQSAQLKKTDGTKTTRLSGIPKLDDANMAGTRQSSKCTLILTEGDSAKALAVSGLSRDFYGVFPLRGKLLNVREASHKQIMENSEINAIKKIVGLQHGKAYDDASLRYGHIMIMTDQDHDGSHIKGLLINFLDHFFPSLLRKSFLQVFITPIVRVSKKNGTIDFFTLPEFYKWQAETGSEQYKIKYYKGLGTSTSADAKFYFSNKHVKNFDELTASDKELLNLAFNK---KKADQRKSWLKNWAPGV-FLD. 693
111 0.000e+00UniRef50_A0A1Y1WR74 DNA topoisomerase 2 n=1 Tax=Anaeromyces robustus TaxID=1754192 RepID=A0A1Y1WR74_9FUNG  ali  23  17..................................TIVPGLYKIFDEILVNAADNKIRDPMDTIKVTIDEKNEISVYNNGKGIPVEIHEKEKVYIPELIFGHLLTSSNYDDNEKKVTGGRNGYGAKLCNIFSTEFIVETSDKGKKFKQVFNDNMSKRSKPKLT-NATKDDFTKITFKPDLKKFGMEKMDEDFEALLLKRVYDIAGCVVKVYLNDERIKIKNFKDYCQMYINSTKKESDENDLGNMPN---------QNPNIIYERVNERWEIAFAMS-DGQFQQVSFVNSICTIKGGTHVNYVSDQITSKLIDSLKR----KNKSLSIKPFQVKNHLWVFINCLIENPAFDSQTKETLTLRASSFGSKCPVSDNFINKVLK-----SGVIDNILTWAKYKQSQMLKKTDGHKRSRISGIPKLDDANNAGTKHSKDCVLILTEGDSAKALAISGLGRDNYGVFPLRGKMLNVRDASHKSIMDNAEVSAIKQILGLQHGKVYNTDSLRYGHIMIMADQDTDGSHIKGLVINFLDHFWPSLLKPGFLLEFITPIVKVSRKGSEISFYTLPEYEKWKEDTNNKGWKIKYYKGLGTSVAADAKKYFMQHHCKKFSEIEQDDRKLLDMAFSK---KNADKRKDWLKEYRPDI..... 618
112 0.000e+00UniRef50_A0A1X0NR68 DNA topoisomerase 2 n=1 Tax=Trypanosoma theileri TaxID=67003 RepID=A0A1X0NR68_9TRYP  ali  21  2......SNRTVEEIYQKKTQHEHILARPDMYIGTTWTPGLYKIFDEILVNAADNKVRDPQTVIKVWIDPEGMVRVYNNGEGIPVQRHREHQLWIPEMIFGHLLTSSNYDDTEAKVTGGRNGFGAKLTNVFSTRFELETVRSRKKFFMRWRNNMLDSEEPVITPCE-GPDYTVVTFYPDFEKFNLQGFGEDMVYMMKRDVAGCTDKTLRCYLNDTKIACTCFADYVDLYPMMGEE----------------------KKPASYARVNDRWEVCVRVSN-IGFQQVSFVNSIATTRGGTHVKYITDQIIAKVTEQAKRK-----NKTEVKPHMIRPHLFVFINCLIENPGFDSQTKETLNTPKPRFGSTCDLPASMVDCILKSSIVERS----VEMANSKLTREIASKLRNADRKQILGIPKLDDANEAGGKYSHRCTLILTEGDSAKALCTAGLDRDYFGVFPLRGKPLNVRDATLKKVMACAEFQAVSKIMGLDLRQKHSIEGLRYGHLMIMSDQDHDGSHIKGLIINMIHNYWPDLIKPGFLQQFITPIVKARKKGRAISFFSMPDYFEWKNSIGDRNYEIRYYKGLGTSGAKEGREYFIDRHRLDFVYDDATDDSRIVMAFAK---DKVEERKQWITQF......... 646
113 0.000e+00UniRef50_J5Q6D7 DNA topoisomerase 2 n=10 Tax=Fungi TaxID=4751 RepID=J5Q6D7_TRIAS  ali  23  152.APKSAKKKTASEMYQ---------KRPDTYIGSTYVPGFFKIFDEILVNAADNKINDPMDTIKVNIDENNSISVWNNGKGIPVEMHSKEGIMIPELIFGNL----NYDDDQKKLTGGRNGYGAKLANIYSLEFTVETADNMKKYKQVFSQNMGKKTTPKITENKKGEEWTQITFKPDLARFSMTNIDDDTYALLMKRVYDVAGTVIKVNLNGERLKVKNFKQYVDMYVAANSAA------------HTAEGAAVTKPTVVYENAGKRWEVAFALS-DGEFNQVSFANSIATTKGGTHVDMIATQLANKLQAFIVK----KNKTAKVKPFQIKSHMWIFVNALIENPSFDSQTKETLTLKSSAFGSKCELSEEFIKKVAKSGI-----VENVLAFAKFKQDQAMKKTDGAKRSRIGGIAKLDDANWAGGRNASQCTLILTEGDSAKSMAVSGQGRDRFGIFPLRGKLLNVREANHDQIMKNQEIQNIKQILGLKHNHNYTSTDLRYGHLMIMTDQDHDGSHIKGLIINFLDHFYPSLLKPNFLNEFITPIVKVTKGKQERMFFTMPEYEEWKEANNNGHGWFAKY-----------LKYFNDRHRLRFGTLEDEDKTLIDLAFNK---KKADDRKEWLRQF......... 779
114 0.000e+00UniRef50_I7M5X3 DNA topoisomerase 2 n=6 Tax=Oligohymenophorea TaxID=6020 RepID=I7M5X3_TETTS  ali  21  1MSKQEKS---VEERYQKKSQIEHILLRPDSYVGSIFVPAFYKIFDEIIVNAADNFQRNPMDTIKVMIDQQNMISVWNNGQGIPIQIHKEHNIYIPEMIFGHLLTSSNYDDKEEKVVGGRNGFGAKLTNIFSKKFIVECNDDKKYYKQEWRKNMSERTEPLITENKKGGNFTCVTFYPDLSKFKMQNISDDMLRKRVYDMAGIFNNKVKVYLNNEQIKIKSFSQYVNLFIPDIEEQYKCYDPTMTSD---------------------RWEILVTFS-DGQFKQVSFVNGICTSRGGKHVDFVIDKIVERMQEQI----LKKNKDLDIKPHQIKQNLFIFMNCLIVNPSFDSQTKDTLTTKASAFGSKPELSEKFIKKILGTGIIEQIVS----QAKARQNAKLAKTLKGGKKGRITGIPKLDDANDAGTARSENCTLILTEGDSAKALAMAGIGRDNYGVFPLKGKLLNVREANKKQIIENQEIQNICKIIGLDPQNYENTKQLRYGSLMIMADQDSDGSHIKGLVINFIHHFWPSLFKKGFLKEFITPILKVTKGDEVHSFFTIQDFKNFAAQKGDKQYKVKYYKGLGTSTDKEAKEYFSNKHQINFQYLDENDMEAIELGFS---GKKIKERKDWLANYDPN...... 651
115 0.000e+00UniRef50_A0A0T9X9D2 DNA gyrase subunit B n=15 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A0T9X9D2_MYCTX  ali  48  1............................................................................................................................................................................MRFWADPAVFETTEYDFETVARRLQEMAFLNKGLTINLTDERPHKVKSRTFHYPGGLVDFVKHINRTKNAIHSSI----------VDFSGKGTGHEVEIAMQWNAGYSESVHTFANTINTHEGGTHEEGFRSALTSVVNKYAKDRKLLKDKDPNLTGDDIREGLAAVISVKVSEPQFEGQTKTKLGNTEVKSFVQKVCNEQLTHWFEANPTDAKVVVNKAVSSAQARIAARKARELVRRKSATDIGGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAILPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRDPEFAYSDRERDGLLEKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGEDVDARRSFITRNAKDVRFLDV 505
116 0.000e+00UniRef50_R6F6T5 DNA gyrase subunit B n=4 Tax=Firmicutes TaxID=1239 RepID=R6F6T5_9FIRM  ali  51  43.................................................................................................................................................................................DDSEAFADAFATSEESTKARTGGKIGKIHTITLENGKKQKVVEF--YYEGGIKEFVAYLNKSKEPLYENILYFE----------GEKNNVYVEVSFQHNDSYNESVFSFVNNINTPEGGTHLQGFRNAITKTFNDYARSAKLLKDSEPNLSGEDIREGLTAIVSVKIEDPQFEGQTKQKLGNSEARGAVDNIVSEQLTYFLEQNPQIAKTICEKSILAQRAREAARKARDLTRRKTALDTMALPGKLADCSDKDPKNCEIYIVEGDSAGGSAKTARSRATQAILPLRGKILNVEKARLDKIYANAEIKAMITAFGTGIHEDFDITKLRYNKIILMTDADVDGAHISTLLLTFIYRFMPELIKQGHVFLAKPPLYKLEKNKKVWYAYSDEELDSILTEVGRDNNKIQRYKGLGEMDAEQLWETTMDPERRILLRVNYDEEMELDLTFTTLMGDKVEPRREFIEENAQFVKNLDI 506
117 0.000e+00UniRef50_N6T8X6 DNA topoisomerase 2 (Fragment) n=1 Tax=Dendroctonus ponderosae TaxID=77166 RepID=N6T8X6_DENPD  ali  22  25.APPKKKPATIEQTYQKKSQLEHILLRPDTYIGSVFVPGLYKIFDEILVNAADNKQRDSMDCIKIEIKPENMVSVWNNGKGIPVVMHEDEKMYVPTMIFGHLLTSSNYNDEEEKVTGGRNGYGAKLCNIYSEKFIVETSKEHKRHFKQTWGSNMTKASEPKIKDFFGADFTKITFYPDLAKFHMDKLTDDIVGLMSRRAFDVAASTKKVFLNGQRLPIKNFRDYVQLYFKG------------------EYDERGNPLKVVYEEFDERWEVAVTLSDSGFQQM-SFVNSIATTKGG---------------------------GTTIKPHQVKNHMWVFINCLIVNPTFDSQTKENMTLQVKKFGSKCSISDKFILGVQKSGI-----IETVLTWAKLKEQTELVKASTGKSAGKLKIHKLVEANKAGSATGWKCTLILTEGDSAKTLAVSGLSRDYYGVFPLRGKLLNVREATHKQILENVEINSLLSIIGLQYKKKYDLKSLRYGKIMIMTDQDQDGSHIKGLLINFIHYNWPELLRLDFLEEFITPIVKAKKKNQEISFYSLPEFEEWKKDTNHHTFEIKYYKGLGTSTSKEAKEYFMTRHKIPFRYGGPEDDDHIVLAFSK---KHIEARKEWLTNFMVDSKH... 657
118 0.000e+00UniRef50_K2BJ35 DNA gyrase subunit B (Fragment) n=4 Tax=root TaxID=1 RepID=K2BJ35_9ZZZZ  ali  51  1.........................................................................................................................................................................................................LNKGIKISLKEEK--TEKHHEFLYEGGIVSFVEDINKTKTPLHKDIIYFEKS----------KEDLGVEFAINYNDGYTETFFSYVNNINTVDGGTHVTGFRTALTKVLNDYMKTNNLVKDKEFKLSGDDVREGLTVVLSVKVKNPLFEGQTKGKLGNSEAKIAVEAVVNEKLSQYLEQNPATGKTIVEKCVLAAKAREAARKARELTRRKSALDNFSLPGKLADCSERDPKLCELYLVEGDSAGGSAKQGRNRKNQAILPLKGKILNVEKTRLDKILANDEIRTLITALGTNIGEDFDVAKLRYHKVFIMTDADVDGAHIRTLLLTFFYRYMQDLIKEGHIYIAQPPLYKIQKGKTIIYAYSDDELQRRLTEIGKDKESIQRYKGLGEMNPEQLWSTTMDPGTRLTMKVALEDIVAADEIFSILMGDQVQPRREFIEAHAKEVKNLDI 439
119 0.000e+00UniRef50_A0A2M8KVG8 DNA topoisomerase IV subunit B (Fragment) n=1 Tax=Candidatus Roizmanbacteria bacterium CG10_big_fil_rev_8_21_14_0_10_45_7 TaxID=1  ali  44  1................................................................................................................................ALSVHFIAEVKQNGKFYRQEYSRGLPKGPVKEVAKGITGKTGTAISFLPDTDFKQGMALDKDRIMRLIKERAYLTSKVLFHFIN--RIEDTEFCYYFEGGIISLVEDLNNGKKSLHPVIYFKQT-----------NGEIEVEGAIQYNDSMKENLLSFVNVINTHEGGTHVTGFRTALTKVVNDYAKNKNMLK-NSPGLTGDDIKDGLTAVLYLKMPSTQFEGQTKGKLGNAEAQTATYQVTKEALERYFEEHPSEAKTLLEKVLLTQMARLAAKAARESVIRKSALEGSTLPGKLADCQEKDPAQSELFIVEGDSAGGTAKQGRDRKFQAILPLRGKILNSEKSYLDKVMKFQELRDLVVALGTGISELFDYTKLRYHKIVIMTDADVDGEHIMTLILTFFFRHLPQIVEKGHIYLAMPPLYKVSSGKKIFYCYTDEERDKTISEHPDGKFAVQRYKGLGEMNAEQLWETTMNPDHRVMKQITIDDAQEADLIFTMLMGEEVAPRKKFIQTHAH-MATLDI 514
120 0.000e+00UniRef50_Q9HGH0 DNA topoisomerase 2 (Fragment) n=13 Tax=Dikarya TaxID=451864 RepID=Q9HGH0_CLALS  ali  24  12....................................VPGLYKIFDEILVNAADNKIRDPMKQLKVNIDESNTITVRNDGRGIPVEIHEKEQMYIPEMIFGNLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTVETADNGKVYQQVWTNNMSKCNPPKIKKMTAKREYTQITFKPDLAKFGMERLDDDIVSVMKRRVFDLCGTVCSVFLNDTKLPIKSFKQYVDMYVQALRQLDDSD--------------DPKSSVVVHENFGDRWEVAFAVS-DGSFQQVSFVNSIATTSGGTHVKMLTDSIVKQLTESISAKR-GKKKALMVKPQEVKNNMFLFVNCLVENPAFTSQTKEQMTTKPAKFGSKPVITEDFIKKL----IAKTSITDKLHSLSQANEDKALARQDGSRRSRVKS-AKLHDANKAGTKDGHKCTLILTEGDSALAQAVVGLKNEYYGCFPLRGKMLNVRDASADQISKNAEINEIKKIIGLQHKKHYTPESLRYGHILIMTDQDHDGSHIKGLLINFFESSFPGLLQPGFLQGFITPIVKVTRHKKVIPFYNMPDFERWREEAQANRWTHKYYKGLGTSLATEITEYFLSRHLKRFHALQDDDKQYIDLAFNK---KKADDRKDWLGAY......... 612
121 0.000e+00UniRef50_A0A1E5RN99 DNA topoisomerase 2 n=2 Tax=Saccharomycetales TaxID=4892 RepID=A0A1E5RN99_9ASCO  ali  22  1MSSPTKSS---SDKYQKISQLEHILKRPDTYVGSVFVPGLFKIFDEILVNAADNKVRDSMKKIEVTIDEKNEISVKNDGSGIPIEIHNKEKIYIPEMIFGHLLTSSNYNDDEKKVVGGRNGYGAKLCNIFSTEFVLETADKKKKYIQKWENNMQTCNPPTIVSYNLKSSYTKITFKPDLKRFHMDVLDKDILGIMNRRVYDINGSVRNVSLNGKSIKIRNFKSYVELYLKSLEKWKRIQKGDTNMD-------NLETPTIIYERFNDRWEVAFAVS-DVSFQQVSFVNSIATTTGGTHINYICDQIIK--------KIQGKLKKKNVKPFQIKNNIFLFINCLIENPAFTSQTKEQMTTRVKDFGSKCEISDEYITKIMK-----TNLSDRIFEIADENADKALKKTDGVKKHRITEYPKLEDANKAGTREGWKCTLILTEGDSALTRAVAGLGRDYYGCYPLRGKMLNVRDASSDQINKNQEIQAIKKIMGLQHKKRYDVKTLRYGHLMIMADQDYDGSHIKGLLINFLETSFPGLLEPGFLIEFITPIIKVKPRKQTLQFFNIPEYSKWREESSRYTWSYKYYKGLGTSGEQEMREYFLDLHLKTFHSLQDDEDEVIELAFSK---KKADARKEWLRQY......... 654
122 0.000e+00UniRef50_L0AWF0 DNA topoisomerase 2 n=1 Tax=Theileria equi strain WA TaxID=1537102 RepID=L0AWF0_THEEQ  ali  20  1MAKPK----TIEERYQKKSQLEHILLRPDTYIGSTYVPGLYKIFDEVLVNAGDVFARQRMTCIKVSISETGAIVVYNDGEPIPIEVHSEHKMYVPQMIFGELLTSDNYDDSEERITGGRNGYGAKLANIFSKSFTVSVGNKKKRKKMTWTDNMTKTQGEPKIVPYQGNDFVKITFIPDYKRFNLTTIDDGTLKLLTKRVYDIAGTTVKVFLNNERIPIKDFKQYVDLYFESTLDIIKIHEKV------------------------HRWEVVVSASDDNTFKQVSFVNNISTIKGGSHVTHVTDPLIQAL---CKKVNSKNKGGLEVKPSQIRNHLFVFINCQIVNPAFDSQTKETLTTKQTKFGSKYTMGERVLGQVLKSRITDNILRWVHERA---NIELKRKMKVSKTTDRLMGIPKLEDANKAGGRFGIDCTLILTEGDSAKTSCLAGLSRDKYGIFPLKGKLLNVRDASYKQLTHNLEIQNILKIMGLDITKKDNPQGLRYGSLLIMTDQDYDGSHIKGLLINLFHCFWPKLLQRGFIREFITPIIKAKKGDNTISFFTIEDFNRWKIGQDLSTWHIKYYKGLGTSTDKEFKEYFSNEHLIDFTYIDQNDDDSIDLAFSK---KRVDDRKVWLQNF......... 646
123 0.000e+00UniRef50_A0A1D6MQM1 DNA topoisomerase 2 n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1D6MQM1_MAIZE  ali  42  4.........................................................................................................................IQLIILMSLSQTLEVTVWRDGKEHRQSYSRGKPTTRLTSSTLETSSRQGTRIRFWPDKDFTTTIDFDFNTISSRIRELAFLNPELTIILTKEEGHTVQRNEYCYAGGLVEYVKWLNTDKKPLHDPI-----------AFRKELDGITVDVSLQWSDSYSDTVLGYANSIRTIDGGTHIDGLKASLTRTINNLAKKSKTIKDKDITLSGEHVREGMTCIISVKVPSPEFEGQTKTRLGNPEVRRIVEQSVQENLTEYLELHPDVLDSILSKSLNALKAALAAKRARELVRTKSVLKSSSLPGKLADCASANPEESEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIERRDEAAMYKNEEIQNLILALGLGVGEDFKKEALRYHKIVILTDADVDGAHIRTLLLTFFFRYQRALFDEGCIYVGVPPLYKVERGKLAHYCYDDADLKEIVNTFPANSYHIQRFKGLGEMMPAQLWETTMDPERRLLKQLRVEDAAEANVVFSSLMGTRVEYRKELIQKAASNIDQLDI 529
124 0.000e+00UniRef50_A0A0G0KV40 Gyrase subunit B protein n=5 Tax=root TaxID=1 RepID=A0A0G0KV40_9BACT  ali  43  1.................................................................................................................................................MQEFKKGISQG--NVKAVGKSDRTGTTITFKADSEIFPEIKYSWTKILDYVRQQAYLTKGVKIVVEDRRDYKIRRHGFYFDGGIVSFVKFLNRGKVVKNDIP----------VYVEKNVDDVAVEISLQYTDGYKEHLYSFANNIFTPEGGMHVTGFKMALTRVLNDYAKKNNLIKEKDGGMTSEDLKEGLTAVVSVKLRNPQFEGQTKSKLGNAEVRGIVSSITSEGLVEYLEKNPGNAKSMIDKCLLTVRARIAARAAKDAVLRKGALEGMTLPGKLADCTTRNAELSELYIVEGDSAGGSAKQGRNRMFQAILPLRGKLVNVEKTSLDKVVKSDTLKPIIIALGCGIGETFDASKIRYGKIIIMADADVDGSHIRVLLLTFFYRYFEELITNGNIYIAQPPLYRIQKGKDVRWVYNDEEKDKIIEELKIAGVTIQRYKGLGEMNPQQLWDTTMDPEHRKMMKVEIEDAEEADRVFDVLMGSDVEPRRRFIQTHAKSVKNLDV 543
125 0.000e+00UniRef50_E3UC77 DNA gyrase B subunit (Fragment) n=56 Tax=root TaxID=1 RepID=E3UC77_9THEO  ali  48  1....................................SSGLHHLVYEVVDNSIDEALAGYCKNIVVTIHKDNSITVEDDGRGIPTDIHPKVGKPAVEVALTMLHAGGKFNNDAYKVSGGLHGVGVSVVNALSEKLEVIVKQHRKIYRQIYERGVPKTDLEVIGETEETGT--TITFKPDKEIFEETVFDYDVLAQRLRELAFLNKGINIKLIDERDGKEEVFNY--EGGIISFVKYLNRNKEVLHDEPIYMEAKNTE----------YEVEVCMQYNDSYNENIFSFANNIDTREGGTHLVGFKAALTKVINDYARKYGIIKDNEKNLQGEDVREGLTAIVSVKLKNPQFEGQTKTKLGNSEMRSIVENVVTDKLTAFLEENPSVAKIIVEKATQAARXXXXXXXXXXXXXXXXXXXXXTLPGKLADCSEKDPSKCELFLVEGDSAGGSAKSGRNSRFQAILPLRGKILNVEKARLDKILSNEEIRAMITALGTGVGDDFDISK................................................................................................................................................... 453
126 0.000e+00UniRef50_A0A137PJ28 DNA topoisomerase 2 n=1 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID=A0A137PJ28_CO  ali  21  126.....EKGKTIEQIYQKKTQLEHILLRPDTYIGSTESPGFYKIFDEILVNAADNKQRDPMKNIKVTIDPNNLISVHNDGKGIPIQLHQKEKVYVPELIFGHLLTSSNYNDNDKKVTGGRNGYGAKLCNIFSTEFIVETKESEQKYYQKFTNNMSVLNPPKILKNSKKEEYTRISFKPDLEKFGMEKLDEDAVGLLKRRVYDLAGCVKGVYLNGSKIAIKNFKEYVEMYLPKDEDE--------------------NPIKVLHDKSNTRWEVIACKSEDEFQQI-SFVNSIATPKGGTHLNHVAEQIVSVIRDAIDDS----KKKVKTKSLYIKNQFMLFVNCQIENPSFDSQTKENMTLPPANFGSKYEMNDSFKKKLKSSEIVTKIKDFLENKEAGKAATTDGKKS-----RSITGIPNLMDAINAGTAKSKDCTLILTEGNSAKNLVLSGIGRDNYGVYPLRGKILNVRDASAKQVNDNKELSDLKKILGLKSGTNYTESQLRYGHIMIMTDQDHDGSHIKGLIINYFDHFFPSLLKPGFLKQFITPIVKVKKGKKTEVFFNLPEYESWKDENPDSKWDPKYYKGLATSTKQEARDYFSDLHQKDFASIQEEERAYIRLAFSK---DKAEARKQWLRGY......... 765
127 0.000e+00UniRef50_A0A2E8ZZT1 DNA topoisomerase (ATP-hydrolyzing) n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8ZZT1_9GAMM  ali  34  2......KKKYTSSDIEVLKGIEPVQKRPGMY---TDTSNPNHLVQELIDNSVDEAISGFCNSILITLDKDNSITVEDDGRGMPVDKHPEHKVSGVEVIMTNLHSGAKFSNKNYKYSGGLHGVGVSIVNALAAMLEISVYRSKKEYRMSFLNGSIKKKLGEHVKSKNKKQGTIIKFTPNEKYFDTIDVDIKSLLSLIKAKSILQPELKLTLNDKKYGSGINDFYHKGTLREYIISQFNKDTNILPNETYSSS----------IDSGDFSMDWSCAWVDSDFDNIQSYVNLIPTSQGGTHVNAFRNAVIDSIRNYCTEK-KLITKQIKILPDDVWKHITFIVSLKMMNPQFAGQTKNXLQSNNISSELTSKIKDNFDIWLNKNPQKAEQIAKHVIANAELRLDSESHKPKL---STTKNLLLPSRLADCTLNDSRVTELFIVEGDSAGGSAKQARDKSFQAXLPLRGKILXTWXINHXKILDSKEVKDISLSIGVQPGSD-DLSNLRYGKICILADADSDGLHIATLLTALFLKHFKPLXKNNHIYISKPPLYRIDYKRDTHYVLDEKEKKKLFTKLXEDDVSVTRFKGLGEMNPSQLRETTLQINTRKLALLKLSSDTADMKLMNMLLGKKSGERKLWLEKKG-NLAQLD. 631
128 0.000e+00UniRef50_UPI0007113E68 DNA topoisomerase II n=1 Tax=Blastocystis sp. subtype 4 TaxID=944170 RepID=UPI0007113E68  ali  21  59MSPEKRRSLAVEEKYQKMTQREHIIKRPDTYIGSTFVPGFYKIFDEILVNAADNKQNDPMDTIKVTIDERGRITVWNNGKGIPVVIHKQYNVYVPSLIFGQLLTGGNFNDDDKKVTGGRNGYGAKLTNIYSREFRVETADEGKRFRQVWRDNMSVAEDPVISS-YRGGEFTEVSYVPDLSLFHMDGFDDDIVALMEKDMAGVTDSSLKVYLNGEKVDVKNFEAYTKLYQMESTSANTKDNKL------------------VFCKAGDRWEIAVGVS-DGHLQQVSFVNSICTSKGGKHVDYIAGKLTDYLAPLVKKKTKKDVKPMMIKQY-----LYIFVNCKIENPAFDSQTKETLTTVSKNFGSLPVLDDKFLAKVAKCGV-----VEAVTSFSRFKDDQMLKKQSGTKTARKLDIPKLDDANFAGTRQSGKCTLIITEGDSAKSLVVGGLGRDYYGVFPLRGKMLNVRDVTRSAVIGNEEIKNLVQILGLKFDTVYDTSSLRYGHLVIMADQDYDGSHIKGLVINFIQYFWPSLLKLDFLQQFITPIVKATRGKKATMFFTMDQYKTWLRTHNQKGYYIKYYKGLGTSTPLEGKEYFSNRHLVPFKAITDEECSEVDMVFRR---NRVAERKDWIGSYTPGVS.... 710
129 0.000e+00UniRef50_A0A1V9ZPS0 DNA topoisomerase 2 n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9ZPS0_9STRA  ali  22  64..............YQKKTPLEHVLLRPGMYIGSVYVPALYKIFDEILVNAVDNKVRDKMSRLEVQVEAKTWISVFNDGKGIPIQFHKHENVYVPELVLGHLLTGSNFNDATARLTGGRHGYGAKLTNIFSTEFIVETGDAGLRYSQTWKNNMRERGEPIIT-EYNGPDFTKISFSPDLPKFELTKLNQSMIRVLRKRVFDVAGCLPNV--DVRWNGESIPIVGFESYVHAFEGSTTKEK-----------------IPSLYTKANKRWEVGIAPS-DVGFVQVSFVNGMTTSRGGSHVNYILEQIVKRIADHINAKH----KDMTVTATQVKPHVALFVNALIENPTFDSQMKEYLTSRPNTYGSTCLLSERYLKSVIANSGIVERVVAAMKTKQRTALNKKVTKKAVQ-------VPKLEDANLAGSARSADCTLILTEGDSAKALAVAGLSRDTYGVFPLRGKFLNVRDASDSQLAKNAEFGHLCTILGLKLGTSYTTDELRYGRVMIMTDQDHDGSHIKGLLLNLFHTFWPNLIKDGFISAFLTPLLKVTSKKKILPFFSVPEYQKWVQENPEINHRVKYYKGLGTSTSAEGKAYFEDLHTVDFKWTEDSDGDAIAMVFSK---DRVAERKTWLTN.......... 692
130 0.000e+00UniRef50_A0A174M5K9 DNA topoisomerase (ATP-hydrolyzing) n=88 Tax=Terrabacteria group TaxID=1783272 RepID=A0A174M5K9_9ACTN  ali  30  1MAKNT--ANYGNDSIRQLKDEERVRLRPAVIFGSDGLDGCAHAAFEILSNAVDEARQGYGKLITLTAFRDGSIQVEDNGRGCPLDWNPSEKRFNWELVFCELYAGGKYNNNQYDFSLGTNGLGSCATQYASEYMDVTVWRDGNKYSLHFKKGKVVGAKKEIEPSDEDRTGTTIKWRPDLEVFTSISIPHDWYRETMRRQAVVNANVTFRLIEGDDGEFSEEDFCYPKGIEDYVLEKVG--TDYLTEPFFIEADRRGRDREDLPDYNVKITACMCFSRTF-MMQEYYHNSSWLENGGSPEKAARSALTSAIDAYIKQQGKYNKNESGIKWQDVQDCLVLVTNCFSTQTSYENQTKKAINNRFIQQAMTAFFKERLSTYLIENKDAANKIMEQVLINKRSRENAEKTRQKTNLQQKTDMANRVQKFIDCRSKDKSRREIYIVEGDSAAGAIRTSRDAEFQGVMPVRGKILNCLKEDYPRIFKSDIIMDLMRVLGCGVEIKFDLDNLNWNKVIICTDADVDGYHIRTLVLTMLYRLVPTLIDEGYVYIAESPLYEINCKEKTYFAYTELEKNGILKEIGDQKCSINRSKGLGENDPDMMWLTTMNPETRRLIKVEPEDVTKMETMFNLLLGNDETGRKRHISEHGKELDQLDL 664
131 0.000e+00UniRef50_A0A2P4Y0T4 DNA topoisomerase 2 n=1 Tax=Phytophthora palmivora var. palmivora TaxID=611791 RepID=A0A2P4Y0T4_9STRA  ali  21  585...DKRGFSSVESIYQRKTPLEHVLLRPGMYIGSVYVPALYKIFDEIIVNAVDNKVRDPMRHLDVIIEPGNWISVYNDGKGIPVKFHKTEQVYVPELVLGHLLTGSNFDDTNARLTGGRHGYGAKLTNIFSKEFVVETGDMGLRYKQVWHNNMRTRGEPEIMTGKDAKDFTKVSFSPDLEKFEMEKLTASMVRVLKKRVYDVAGCLSDVEVTLNGEKVSISGF--ESYIQAFSHSTTTVPASKSAKPMKENSEASSGSDYIYSRVNKRWEIGVLPS-DVGFVQVSFVNGMSTLRGGSHVGYVSDQICRRVAEHVNKKYP----ELSVTTAQVKPHMAIFINCQIENPTFDSQMKEYMSSRPPTYGSSCALSERLLKLVLTDSGIVERVVQS--ARARQRAALLKKVSSTRAKTTSVNVPKLEDANLAGGPRSNECSLILTEGDSAKALAVAGLGRDQYGVFPLRGKLLNVRDATVAQLGKNAEFAHLCTILGLRMDEHYGRQKLRYGRVIAMTDQDHDGSHIKGLLFNLFHTFWPELLEGGFISEFITPIIKVSRGLETRRFFSLPEYFEWKATVDQADLKIKYYKGLGTSTSAEGREYFLDNHLVDFHWSGDSDGDALDMVFSKA---RAADRKAWLLNEYSPDAYLD. 1283
132 0.000e+00UniRef50_B7XIW3 DNA topoisomerase 2 n=18 Tax=Eukaryota TaxID=2759 RepID=B7XIW3_ENTBH  ali  22  1......MPKTIEEIYQKKTPKEHILLRPDTYIGSVFAPGLYKIFDEILVNAADNKQRDPMTYIKVYINEM-SVSIENDGNGIPIEIHQKEQVYVPELIFGHLLTSSNYNDNEKKVTGGRNGYGAKLCNIFSVHFEVETVSKGRKYSQVFKNNMEIIGKPTI-SAYSGKDYTKITFVPDFKRFGMSLFDSDIISIFYKRVYDMCATVKNT-----------------------EIYLNDKKLMINNLKEYAQLYLSHDVKLVTKKINDRWEIACA-STDEQFMQVSFVNSICTSKGGTHVNHVLDQLMDPLISAVKKR----DKTLVLKPLNVKNNLFLFINALIENPIFDSQTKENLTLKSSAFGSKC----QPIDDIIKDIIKNTDIIDKIITFSKIKQAVLLKKTDGVKTTKIVGIPKLEDANFAGTKRSSECTLILTEGDSAKTLAVAGLSRDKYGVFPLRGKLLNVREASNKQIMDNAEISAIKKILGLQHGKTYDTTSLRYGHIMIMTDQDFDGSHIKGLIINFLDYFFPSLLKLGFLQEFITPIVRATKKKEKYDFFTIPEYEKFIEQIKDSGWVIKYYKGLGTSTTDDAKQYFNNLHVKTFIPVELEDRELIDLAFNK---KKADDRKEWI............ 629
133 0.000e+00UniRef50_Q5B224 DNA topoisomerase 2 n=102 Tax=Pezizomycotina TaxID=147538 RepID=Q5B224_EMENI  ali  23  117...........SSKYQKLNLREHITIRPDSYIGSVYVPGLYKIFDEIVVNAADNKQNDNMDEIRVTYSETNEISVWNNGKGIPVEMHEEHGMYIPQLIFGNLLTSSNYDDAKEKITGGRNGFGAKLCNVFSTEFTVETQDQKKRYLQTWTDNMQTVGKPKITAAKGS-DFTRVTFKADFPRFGMDGIDDDFEALIKRRVYDLAGTTGVVKLNGTRLPVRNFKKYMEMYTKAIRRERGDDDSKSDPII--------------TCSPHPYWEIGFAVS-DGSFKQVSFVNSIATTSGGTHVNYIADQIAGKLSESLKKN--KKGTGSILKPAQIRNYCFLFVNAKIVNPAFSSQTKEQLTTKQTQFGSKPILDESFLKKV------ANSGVLDSLKRFADHKADLMLKKSDGGRRSRMNNPKLTDANRAGTKDGYKCTLILTEGESAKGLAMAGRGADLFGVYPLRGKMLNVRDASFDQISKNEEIQSIKNFMGLQHKKEYDTKGLRYGHLMIMTDQDHDGSHIKGLLINFLEAQFPSLLKIPEFLIFITPIVKVWKGDKQHSFFTIQEYNAWKEKHGHEGWEHKYYKGLGTSSTEEAQEYFLDRHLKEFHVMQDKEHELIELAFSK---KKVEERKEWLRQYNPD...... 763
134 0.000e+00UniRef50_D8M8A6 DNA topoisomerase 2 n=2 Tax=Blastocystis TaxID=12967 RepID=D8M8A6_BLAHO  ali  21  8.TPITEESEKIGDVYQKLSQRDHILKRPDTYIGSVYNPGLIKIFDEILVNAVDNKQRCPMTTIKVSVDKKNTISIYNDGDGIPVAIHPEYNVYIPSMIFGQLLSGTNFDDNSKKVTGGRNGFGAKLTNIYSTEFRVETVSNEKRFIQVFRNNMTEEEKPKVTKATRSKQYTEIVFKPDLARFGMKELDDDTIAIMKRDVAGVTDDSVKVYWNGEKLNVRSFNDYVKLFERDFVEQNNDALQHIDIQMAYGASPRWQFAVIPTPITGITPFSVGSYFFSLNGKM-SFVNGVFTNRGGKHLTYLTDHIVAQLQPAIERRLKRSVKPSLI-----RQHLCVFCNCLIENPTFDSQTKECLTTNSKDFGSLPELSPSFLSKIERSGI-----VDLVSTSMHLKDIQTLKKSSGTKVNRLLNIPKLDDANNAGTKKSGQATLIITEGDSAKALAVGGLGRDNYGVFPLKGKVMNVRDATEKQCSENEEIQNLVRILGLKYGKEYDTSSLRYGHLLIMTDQDYDGSHIKGLVLNLFETFWPSLLKLDFVSQFITPIVKVTRKKEEHTFFTVKEFQDWNKEKDLKSWKIKYYKGLGTSTAKEGKEYFLDRHVLPFAPLTSSESNLIDMCFKR---SRCEERKEWIDGFDPE-SYID. 680
135 0.000e+00UniRef50_A0A0Q3LVI7 DNA topoisomerase 2 n=4 Tax=Amniota TaxID=32524 RepID=A0A0Q3LVI7_AMAAE  ali  24  16..................................TFVPGLYKIFDEILVNAADNKQRDKMTCIKVTIDENNTISIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDNEKKVTGGRNGYGAKLCNIFSTKFTVETCREYKKLFRQTWTDNMGKAGEMKLKYFDGEDYTCVTFQPDLSKFKMTILDKDIVALMSRRAYDIAGSTKKVFLNGQRLPVKGFRSYVDLYLKDKVDETGNALKIVHEEV------------------NSRWEVCLTLSEKGFQQV-SFVNSIATTKVKNH-------------------------------------MWIFVNALIENPTFDSQTKENMTLQAKNFGSTCKLSEKFIKGAIACGIVESILNWVKFKAQNLLN----KKCSAVKHTKIKGVPKLDDANDAGSKNSLDCTLILTEGDSAKTLAVSGLGRDKYGVFPLRGKILNVREASHKQIMENAEINNIIKIVGLQYKKNYEDRELRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHNFLEEFITPIIKASKNKEEIAFYSIPEFEEWKNRTNYNSWKIKYYKGLGTSTSXEAKEYFMAKHRIGFKYTGPEDDAAITLAFSK---KKVEERKEWLTNFMEDRR.... 579
136 0.000e+00UniRef50_L1LG32 DNA topoisomerase 2 n=1 Tax=Theileria equi strain WA TaxID=1537102 RepID=L1LG32_THEEQ  ali  39  110...ESSSGVYSSDDIVILEGLNAVRKRPGMYIGNTGEGGIHQLLYEVLDNSVDEYLAGVCNRINVTLKSNGFVEISDNGRGIPCDISEKTKKSGLETVLTVLHSGGKFTDISFKYSSGLHGVGLSVVNALSEILSVEVYKGDKKYHMELSKGKITSPLT--STDSIRRFGTVVKFIPDYAIGCNNAFNLDSIKERVRELSYLNPGLFIKIRDERILKENNEVYHNAGGIRSFLQEATKDNTPLYKPINIIT--------IKGKSHGLELEVSFSWSMSFPARIKGYANNVSTT-GGTHIDGFKTAITRSVNLCLKNNGHFKGNVIPLSGEFIREGLTAIISVKLSGAEFDGQTKTKLGNSLAKTVVERIVTSQLTEILDRHPQFLLLIHNKSQTAKKAFDAAKMAKEMVRQKTANVITSSLAKLYDCTSNDIECNEIFIVEGESAAGNAKQARKRQFQAVLPLKGKILNIERISDNKVLENDEIKLLMTSLGLSIDPTTWRHDLRYGKIILLTDADVDGAHLRALLLGLLFRLCPKLYEDGRIYIACPPLYRITDVRKNTYVWSEKKMQKFVKKANIKRYTIQRFKGLGEMMPQQLWETTMDPERRLLSNISVSDAKQASDLLGLLFGRDIQSRREYIFKNTDSIGDLDI 831
137 0.000e+00UniRef50_L2GVJ4 DNA topoisomerase 2 n=2 Tax=Pleistophoridae TaxID=35232 RepID=L2GVJ4_VAVCU  ali  22  2......EKKTIEQLYQKKTPIEHILLRPETYIGSTYVPGLYKIFDEILVNAADNKIRDPMSKLCVDVVDD-RISVWNNGKGVPIQMHKKEKVYVPELIFGQLLTSSNYDDKEKKVTGGRNGYGAKLCNIFSSEFIIETADSKENMYQRYTDNMSKREEPVITKQRVRESFTKITFVPDLKRFKMEHLDEDIVSLLKKRVYDMCATIKKVFLNGEQIPIVSFKQYVSLYLADDVK-------------------------VVHEVVNERWEVAVVLS-DEQFQQVSFVNSICTIKGGTHVNHVLDQLVDPVIERVQK----KDKSLVIKPFFVRNSVFVFVNALIENAAFDSQTKETLTLRVSSFGSRCTLSDDFVKQ------TVAILSDRVLSQALAKMSKQLKKTDGSKSSKITGVEKLSDANLAGTKNSHKCSLILTEGDSAKTLAISGLSRDHYGVFPLRGKLLNVREANHKQIMENEELNNLKKILALQHHKEYTTESLRYGHVIIMTDQDHDGSHIKGLIINFFDHFFPSLLREGFLKEFITPIVRVTKKKRVIDFFTIPEYEDWKNSTPDKNWSVKYYKGLGTSTSKDAKQYFLDKHIKSFTLLTTEDKSLIDLAFNK---KKADDRKLWLKN.......... 659
138 0.000e+00UniRef50_A0A1C7MXD3 DNA topoisomerase 2 (Fragment) n=5 Tax=Eukaryota TaxID=2759 RepID=A0A1C7MXD3_9FUNG  ali  21  104......EAKTVEEIYQKKTQLEHILIRPDTYIGTTYVPGLYKIVDEILVNAADNKIRDPMNTIKVIIDEQNLISIHNNGRGIPITEHKEEKVYVPELIFGHLLTSSNYNDDEKKVTGGRNGYGAKLCNIFSTEFIVETADKERKYKQVFKDNMSVIGKPKITANARGEEYTRITFKPDLAKFNMTEMDADFEALIKKRVYDLAGCLENVFLNGTKIAIKGFNKYCELYTKSMEIRNAEGKKP-----------------IILGNTDNPRWQVNFAVSDGQFNQISFVNSICTAKGGTHVNHVADQIVKAILPDIQKKTNNKN----IKPFQIKNHMCLFINCLIENPSFDSQTKENMTLRVSSFGSSYKLSDKFLKDIMKSGI-----VDNIVKWVKFKEDMQMTKADVGKMARNLKIPKLEDANLAGIRHNKDCTLILTEGDSAKALVLSGLSRDKFGVFPLRGKVLNVRDATNSQIMNNAEITNIKAILGLKHGKTYTSVDLRYGRLMLMTDQDHDGSHIKGLLINFIDSMFPSLLDPGFLLEFITPIIRCKHKKEEICFYTIPEYEQWAEQHNRTKWEPKYFKGLGTSDKADARRYFLDVHKKEFEVASKEERELVDMAFNK---KRAVDRKNWLAGY......... 749
139 0.000e+00UniRef50_P06786 DNA topoisomerase 2 n=98 Tax=Fungi TaxID=4751 RepID=TOP2_YEAST  ali  23  1MSTEPVSA---SDKYQKISQLEHILKRPDTYIGSTIVPGLFKIFDEILVNAADNKVRDPMKRIDVNIHEEHTIEVKNDGKGIPIEIHNKENIYIPEMIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFILETADVGQKYVQKWENNMSICHPPKITSYKKGPSYTKVTFKPDLTRFGMKELDNDILGVMRRRVYDINGSVRNVYLNGKSLKIRNFKNYVELYLKSLEKKRQLDNGED-------GAAKSDIPTILYERINNRWEVAFAVS-DISFQQISFVNSIATTMGGTHVNYITDQIVKKISEILKKKKKKSVKSFQIK-----NNMFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCEIPLEYINKIMK-----TDLATRMFEIADANEENALKKSDGTRKSRITNYPKLEDANKAGTKEGYKCTLVLTEGDSALSLAVAGLGRDYYGCYPLRGKMLNVREASADQILKNAEIQAIKKIMGLQHRKKYDTKSLRYGHLMIMTDQDHDGSHIKGLIINFLESSFPGLLDQGFLLEFITPIIKVKPTKNTIAFYNMPDYEKWREEESHKTWKQKYYKGLGTSLAQEVREYFLDRHLKIFHSLQGNDKDYIDLAFSK---KKADDRKEWLRQY......... 657
140 0.000e+00UniRef50_A0A167QMG2 DNA topoisomerase 2 n=2 Tax=Mucoromycotina TaxID=451507 RepID=A0A167QMG2_PHYB8  ali  21  11.STSNAPDRAVEEIYKKKSQLEHILLRPDTYIGTVYVPGLYKIVDEILVNAADNKIRDPMNTIKVVIDAQNFISIQNNGKGIPILIHKDEQVYVPELIFGHLLTSSNYDDTEKKVTGGRNGYGAKLCNIFSTEFTVETADKKKKYFQVFKNNMSVKSEPKITANTRGEEYTRISFKPDLSKFGMTEMDEDFTALIKKRVYDMAGTVDNVYYNGTKIPVKGFKQYVELYTDSMEIRNAEGKKP------------------IIHDIPSERWQVSFAVSDGQFNQVSFVNSISTPKGGTHVNHVADQLVKGLMADVQKKTGNKN----IKPFQIKNHMCIFVNCLIENPTFDSQTKENMTLKTSAFGSTYQASEKFISAVSKSGI-----IDNIVKWVKYKEDTQMIKADSGKMTKRLNIPKLEDANWAGVKPKNKCTLILTEGDSAKALVMSGLSRDEYGVFPLRGKLLNVRDASATAIMSNAEITNVKSILGLKHGQKYTSSDLRYGKLMIMTDQDHDGSHIKGLLINFIDQMFPSLLDPGFLLEFITPIIRCTHKKARKTFFTIPEYENWALENNVNKEWIPYFKGLGTSDRNDAREYFGDLHVKEFQTADEDDRKLIEMAFAK---KKVTDRKEWLSTY......... 659
141 0.000e+00UniRef50_A0A146VL51 DNA topoisomerase 2 n=6 Tax=Bilateria TaxID=33213 RepID=A0A146VL51_FUNHE  ali  21  3..........................................LFIEVIVNAADNKQRDKMSCIRVNIDENNTISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYNDDQKKVTGGRNGYGAKLCNIFSKKFTVETCKESRKVFKQTWYDNMGRAGDTCIKPFEGEEYTCITFRPDLSKFKMSVLDKDTVALMTRRAYDIAGSTKKVFFNNKRLPVTGFRSYVDMYVKDKVDELGGALTVVHEVV------------------NDRWEVCLTMSEKGFQQV-SFVNSIATTKGGRHIDYVADQVVGKLIEVVKKKNKAG---VAVKPFQVKNHMWLFVNCLIENPTFDSQTKENMTLQQKSFGSTCPLTDKFIKQATGCGIVESIMNWVKFKAQC----QLNKKCSAVKHSKIKGVPKLDDANDAGGKNSIGCTLILTEGDSAKTLAVSGLGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKILGLQYKKNYSDPSLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKASFKKTQLSFYSIPEFDAWKEQANHKSWKIKYYKGLGTSTSQEAKEYFMQRHRIPFKYAGPEDDEAITLAFSK---KKVDERKEWLTNFMNNRR.... 597
142 0.000e+00UniRef50_R1C6H3 DNA topoisomerase 2 n=2 Tax=Emiliania huxleyi TaxID=2903 RepID=R1C6H3_EMIHU  ali  22  7.KPAAAQRGTVEQTYQKLTQREHILQRPDTYVGSTYVPGLYKIFDEILVNAADNKQRDSMSEIRVEIDAAGRISVQNNGKGVPVVMHQEHGIYVPELIFGHLLTSSNYNDNQKKVTGGRNGYGAKLANIFSSEFVVETSDEGKRFKMKWSDNMTAQSKPEI-KAAAKEDFTKISWVPDLAKFGMSAMDEDIVALMERDMAGCTHSSVKVYLNGKKLPVADFKSYVDL--------------------FLGPKQAADAVPRVFEKVGDRWEVAVAASEDGFAQV-SFVNSIATSKGGTHVNHVADQV--------------------LKPNHVKGHLRVFINCLIENPAFDSQTKENMTLKQSAFGSKCQPSDKFFKDALNCGV-----LESILSFAQSKQSKDLKKTDGTKKSRLTGIPKLDDANEAGGRNGSKCTLIITEGDSAKALAVAGLSRDHYGVFPLRGKLLNVRDAAHSTIMANKEISELKQILGLQQGKSYDDESLRYGKLMIMTDQDHDGSHIKGLVINFLHCYWPALLKRAAPARFVTPIVKASKGRQAIAFFTLKEYENWREEQGASGWQIKYYKGLGTSSAAEAKAYFLDLHELSFKWTGDADREGIVRAFSKSMAD---ARKEWLRGYDADA..... 688
143 0.000e+00UniRef50_A0A101GN46 DNA gyrase subunit B n=11 Tax=root TaxID=1 RepID=A0A101GN46_9EURY  ali  50  1..............................................................................................................................................................................................MLDHRLRELAYLNSGLTISLRDERTGDSVTHRF--EDGIRQFVAHIGEGKESLHDDIIYFQKRDPESKV--------EVEVALQYNDSYAETIYTYVNSVNTREGGTHLEGFRSALTRAINSAAHRNNLLKNNDAQVKGEDVREGLASVISTRVANPQFEGQTKMRLGNSNVRGIVDSLVYSSLTEYFEEHPKTLQVIVDKAMTAARAREAARNARELARRKSTLESTGLPGKLADCQERDPAKSEIYIVEGDSAGGSAKQGRDRKFQAILPLRGKILNVEKASEHKSLKNAEIQALISAIGTGIGDSFDPERARYHRIILMTDADVDGAHIRTLLLTFFYRYMTGLVEHGYIYIAQPPLFRVARGKQERYVYREEEMREITAEWGEKGVSIQRYKGLGEMNAGQLWSTTMDPANRILKQVKIEDAIYANDIFEKLMGENVDARKDFIRRHAKEVNNLDI 450
144 0.000e+00UniRef50_A0A0M3KAJ9 DNA topoisomerase 2 n=1 Tax=Anisakis simplex TaxID=6269 RepID=A0A0M3KAJ9_ANISI  ali  22  59.TSTSTATNVKKEKYQRISPLKHVLLRPDTYVGSTYVPALIKIFDEVLVNAADNKQRDPMTSIRVNIDKDNEVSVWNDGEGIPVEIHSEEGVYIPSLIFGTLLTSSNYDDSEIKIIGGRNGFGAKLCNIFSKKFTVETRSAGNHFEQTWRNNMSECDTAIVKSEDGGTDFTKVTFEPDLKRFSLSALNDATIQLMQRRVVDVAGTLKGV-------EVHGFRDYIRLYTASENEESDVEMPVNNEKRVVFS------------EVNDRWQVAVARSDCGFEQI-SFVNNIATVKGGRHVDYVCDQLIARIKQELETRFENGRKSVRP--LQIKNRLCVFLNSFIENPTFDSQTKEYLASAPKTFGSKCQLSEAFFSELFTRTDIVECIIGDLNKREMVKEHRSLNRSAAVGGRELSDLPKLEDAGNAGTVRSSECTLILTEGDSAKALAVAGLGRKNFGVFPLRGKLTNVRGLSEKLSLQNAEVSALVRILGLRFGEDYSRKELRYGHLMIMTDQDEDGAHIRGLIINFLHSFWPSLIRTDFIHYFMTPLLKARRGAEVIPFFSNAEFERWKQENNAKKYSVKYYKGLGTSSAEEAREYFMRKHRIEYEYGGQEDDENIEMAFDK---NRADDRKAWIIAKASNV..... 738
145 0.000e+00UniRef50_A0A1D1VTD4 DNA topoisomerase 2 n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1VTD4_RAMVA  ali  22  68.....KQAQTVEEQYVKLKLDEQILLRPDTYIGSIYVPGLYKIFDEIVVNAADNKQRDPMDRLEITIEENNVISVFNNGRGIPITKHAKEKVWIPTMIFGHLLTSSNYQDDDKKVVGGRNGYGAKLCNLFSTKFTVETACKKKIFKQTWEQNMKVGEENQILANEDRKEYTKVTFQPDLRRFNMEKLDDHIAGLMARRAFDLAGTCKKVKLNTKEIKVNGFEDYVKFLVKDAKDEYDN---PIEKIAFARSDPIKVTNEDGKEISQVRWEVACVPSTNGEFQQVSFVNSIATTKGGQHVNYIADQIADHLITVAKKKNKSG---TELTRNHIKQHMWVFVNCLIENPTFDSQTKEYMTLAKKSFGSTFKLPEKFCKTVASLSIAESAVAMMNLKA-----EAKLQRAGGTKTSRLKGIVKLMDANQAGSKHSKECTLILTEGDSAKCLVEAGFGRDRYGVFPLRGKLLNVRDATSKQLTENKEIEHLVKILGLDYRRQYDFKRLRYGRLMIMTDQDQDGSHIKGLLINFLHAKFPHLLRNAFLEEFITPIVKVTRKEEEQSFYSLPEFEQWLDEKERKGWKEKYYKGLGTSTAKEAKEYFNNRHRIKFGYSGANDDDNIDMAFSK---KRADDRKNWLTEGMRQRTEL.. 751
146 0.000e+00UniRef50_B8C9P0 DNA topoisomerase 2 (Fragment) n=9 Tax=Eukaryota TaxID=2759 RepID=B8C9P0_THAPS  ali  22  1........KTIEETYQMKTQLEHILLRPDTYIGSTYTPGFLKIYDEIIVNAADNKQRDPMDRLDVDIDEGGVISVCNNGKGIPVVIHKDQGCYVPTMIFGHLLTGSNFDDDEMKTTGGRNGYGAKLANIFSTEFIVECVDEGLKFKQVFRNNMHKTEEPKIKKCSASEDYTKITFKPDFEKFSMTRLNEDAVGLLAKRAYDIAGTMGSVYLNGKKLSVKGFKSYLALF-------------------------DGINPPAAYEKVGDRWEVGISVS-DGSFQQISFVNSISTTKGGGHVDHIAEMVVTRLKDLVKKKN---KGGAHVKPAQIKNHLSIFVNCLVENPKFDSQTKENLTTKKSTFRSEVQLSEKFLKQVDKCGV-----VDSIMAYAKFKEGQALKRKGGTKKNKLTGITKLDDANHAGTAKSKDCTLIITEGDSAKSLAVSGLSRDFYGVFPLKGKPLNVRDATHFQIMKNEEISNLVAIMGLKFDTTYNIKSLRYGHLMIMTDQDHDGSHIKGLIINFLHKFWPSLLDPDFLMQFITPIVKCTKGKKFHTFFTLPEYEEWKEGTGNKGWTIKYYKGLGTSTSSEAKEYFSNLDIHEIIFNEISDSALIDMAFSK---SKVEERKKWLNR.......... 654
147 0.000e+00UniRef50_A0A2P6NAU5 Uncharacterized protein n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6NAU5_9MYCE  ali  22  84..........IEEEYQRLDHIEHALRRPDMYIGASFVPGLYKIFDEILVNAADNKQRDSMTYIHVTIDEEGRITVANNGDGIPVVVHEKEQIYVPELIFGTLLTGSNFEDNNKKVTGGRNGLGAKLANIFSKEFTVETVDSEKLFKQTFNNNMGKRSKPSVTS-SRVKSYTKISFVPDLERFGMESLDDDIVALMTKRVYDIAGCNPKVTLNDEKITVKSFKNYCDLYIKD------------------------PAAPRIYCKPHDRWEIFVTSSPEQEFQQVSFTNSICTSKGGTHVKHVSEKIIKAVLEAVMK----KEKGSQIKPNHVKNHLWVFVNCLIENPAFDSQTKETLQTPVKDFGSKCDIPEDIMKKILKCGIVQTILSFSKMHQMALLEKKTKGKKKV----RLTGIAKLDDANKAGTKESKYCTLILTEGDSAKAMASNGLDRDLYGIFPLRGKLLNARGATTKELADNAEINAIRQIIGLQHGKKYDSLDLRYGRIMIMTDQDQDGSHIKGLIINFIHCFWPELLKHGFICEFITPIVKARKSNQVVMFFNLPQYQEWKEKRGEKGWKLKYYKGLGTSDDVEAREYFLDKHEKVFKWDGQDDGELIDMAFKK---DRAEDRKEWMRGF......... 720
148 0.000e+00UniRef50_P41001 DNA topoisomerase 2 n=45 Tax=Eukaryota TaxID=2759 RepID=TOP2_PLAFK  ali  22  1MAKNK----TIEERYQKKSQIEHILLRPDTYIGSTYVPGLYKIFDEIIVNAADEKSENPMTCIKIEINKENRISVYNDGEGIPVDIHKEMNIYVPHMIFGELLTSDNYDDAEDRITGGRNGFGAKLTNIFSKEFIVQCGDSRKKEFKMTWSDNMSKFSEPHIKNYNGKDYVKVTFKPDLNKFGMTEMDDDIESLLFKRVYDLAGTCSVVYLNGQRLAVKDFKSYVDLYXXXXXXXANQNNDTPTKXXXXXXXXXXXXXIVKIHEKQHRWEIVVSKSDGSQFQQVSFVNSICTTKGGSHVNYIVEQLLSSL---SKKANAKNKGGMEIKSGHIRNHLWVFVNCLIVNPTFDSQTKETLTTKPVKFGSKCILSDKTINNVLKSPILSNILLWAQAKAQVELKKKMKA-GSSKARERIIGIPKLEDANDAGSKYSQECTLILTEGDSAKTSCLAGLSRDKYGVFPLKGKLLNVRDASFKQLMDNKEIQNIFRIMGLDIKNKDDIKGLRYGSLMIMTDQDYDGSHIKGLLINMIHKFWPSLLKKGFLSEFVTPIVKVQKGSQEYSFFTIAEYEQWKENTNLLGWKIKYYKGLGTSTDREFKQYFSDIHKIMFLWTGDRDGDSIDMAFSK---KRIEDRKLWLQNF......... 704
149 0.000e+00UniRef50_A0A261XZ95 Serine hydroxymethyltransferase (Fragment) n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261XZ95_9FUNG  ali  22 1044..SSQSQARTVDEIYQKKTPLEHILLRPDTYIGSVEVPGLYKIFDEILVNAADNKQRDPMSMVKVSISPSNTISIYNNGRGIPTAMHQKEQVPVPELIFGHLLTSSNYDDTDKKIVGGRNGYGAKLCNIFSHEFIVETSEEGKKYWQKFEKNMSVIGTPKFTKAA-KKDFTRITFKSDLAKFGMAELEADVVSLMEKRVYDMAGILPGVYLNDEAIMIPDFKRYVDMYLDPFNDEPNTAMEVMPSEEAQATTTPSMNKPKVFYYRVNPRWEIAFVTSDDQFQQVSFVNSIATTKGGTHVNYISDQIVDKIMETIEKKT-SKLGKGHIKKFQIKNYMWLFINCAIDNPTFDSQTKENLTLGVSKFGSRCVIPDDFMNKILKQSG----IVDIVEAHARFRSEMALAKTDGKKRSRISGIPKLDDANNAGTRLASDCTLILTEGESAKALAVCGLSRDYFGVFPLRGKLLNVRDASTKAIHENAEITQLKQIIGLQHGKVYNTDGLRYGHIMIMADQDHDGSHIKGLVINLLDHFWPSLLRPGFLLEFITPIVRVTKGRTKTDFFTIPEYDVWKRANDEKGWIVKYYKGLGTSTPADAKAYFLSLHRKTFAPCKDADRELIDLAFGK---KRANDRKTWLGQF......... 1768
150 0.000e+00UniRef50_J9FD77 DNA topoisomerase 2 n=3 Tax=Onchocercidae TaxID=6296 RepID=J9FD77_WUCBA  ali  22  81............EKYQRLTPLKHILYRPDSYIGSAFVPGLLKIFDEILVNAADNKRRDPMTTIAVNIDKENTISIWNNGRGIPVEIHPTEGIYVPTMIFGTLFTSSNYDDSELKIVGGRNGFGAKLCNIFCTEFSVETCQSGLRFFQCWRNNMNDVDDPIISDASTNSDYTCVTFKPDLSKFKLSTLDEDTIQVMIRRIVDIAGTLDNVFLNGTKIEVSGFEDYVKLFST------------------YTGGNFENSTVPFYCSVNDRWQIAVARSNAG-YNHISFVNNINTLKGGRHVDYIVNQIVSRLKQEI---SQCCGCEKSISAHQIKNRLHIFVNSLIENPAFESQSKEYLTTSVKNFGSTCIIPESFYENFLKDSDIIHHLL-------CDISQQHATSLNRSMNRSLWDLSKLEDAADAGTKNGYNCTLIITEGDSAKALAVAGLGRKQYGVFPIRGKLTNVRGMDAKMAVQNAEISALVRILGLKFGENYSNDSLRYGRLLIMTDQDPDGSHIKGLIVNFLHVYWPSLLKANYVSYFITPLLKAKRGSDVKSFYSTADYEKWRAENPDSKYSIKYYKGLGTSSAKEAREYFNDRHTINFIYDGKASDESIELAFAK---NKADDRKVWIAE.......... 717
151 0.000e+00UniRef50_A0A174WAQ5 DNA topoisomerase (ATP-hydrolyzing) n=183 Tax=root TaxID=1 RepID=A0A174WAQ5_9FIRM  ali  33  1MAKSNSPKNYGNDSISSLKGADRVRKRPAVIFGSDGLEGCEHAVFEILSNAIDEAREGHGSLITVTRYEDHSIEVEDFGRGCPVDWNEKEQKFNWELVFCELYAGGKYDGDNYEYSLGLNGLGSCATQYASAYFDAVIHRDGFEYTLHFEKGENVGGLKK-EPYSGKKTGSRFRWKPDLDVFTDINIPVEYYTDVLKRQAVVNAGVTFRFRNQVGGKFETTDFQYENGIEDYVKELAGENSL--TLPVFWQTERRGRDRADKPEYKVKLSVSFCFSNTV-QIIEHYHNSSWLEHGGSPEKAVKSAFVNGIDAYLKAQGKYQKSESKITWADVEDCLVLVSNNFSTQTSYENQTKKAINNKFVQEAMTEFLRAQLEVYFIENPLDAGKIAEQVLINKRSRENAERTRLNIKKKGSVDIANRVQKFVDCRTKDTTRRELYIVEGDSALGSVKLSRDAEFQGIMPVRGKILNCLKADYAKIFKSEIITDLLKVLGCGVEVHFDLMNLRWNKVVICTDADVDGFQIRTLILTMLYRLTPTLIQRGYVYIAESPLYEITYKDKTWFAYSDAEKNEIVSELAGRKCSINRSKGLGENEPDMMWLTTMNPETRRLIKVMPEDVERTAAVFDLLLGDNLQGRKDHIAENGYKYLELDI 662
152 0.000e+00UniRef50_A0A0C3DBB7 DNA topoisomerase 2 n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A0C3DBB7_9PEZI  ali  22  8.AKGASSKKSATEQYQRLTHLQHIIKRPDTYIGSVFVPGLYKIFDEILVNAADNKQNDPMKVIKVVMDEKGDISVENDGSGIPVEIHDKEKMYIPEMIFGHLLTGSNYDDEQQKTTGGRNGYGAKLCNIFSSQFTLETQDRGKRYKQTWTDNMANMGK-PKISSSKSSDFTRVTFTPDYKRFKMDGIDDDFEALVKRRVYDMAGTVKGVKVYLNGTEIKNFKKYVEMYASAIKKERG---------VEDSSEPAAASVIIEDEKAHACWKVGFAVS-DGSFQQVSFVNSIATTSGGTHVNYIADQICDKLQEVVKKQN---KKGAALKVNQIRNHIFLFVNCLITNPAFTSQTKEQLTTKVKQFGSTCVLSEAFLKKISQTDA-----VKNILDFAQAKADQQLAKSDGNKRSRMSN-PKLVDANLAGTRRGHECTLILTEGDSAKGLAVAGRDPDRIGVFPLRGKLLNVRDASIDQISKNVEIQNIKQFLGLKHKQIYNNTQLRYGHLMIMADQDHDGSHIKGLLINFLQVQFPSLLKLPDFFEFITPIVKIWKGPNTKYFFSMPQFEEWREGHSDRSWKQKYLKGLGSSSPEDAMIYFLDDHLREFETMKPEEEEMFDLAFSK---KKADARKVWLGNFLP-GTYLD. 673
153 0.000e+00UniRef50_A0A151Z7T4 DNA topoisomerase 2 n=1 Tax=Tieghemostelium lacteum TaxID=361077 RepID=A0A151Z7T4_9MYCE  ali  21  106IAKSVKSGKTIEEIYQKKELLDQILLRPDTYIGSIFVPGIYKIFDEILVNAADNKQKDAMKYIKVDIDATGSVTISNDGHGIPVVKHKEHKIYVPELIFGNLLTSSNYDDSEERLTGGRNGFGAKLANIFSNKFIVEVGDNGKLFKQTFTKNMKQKEDPVITSYSKSTNYTTITFFPELKRFGMTHFDDDLLEKRVYDIAGTNAGL-KVSYNGKNISFSSFEKYIELYIDNNDEE--------------------NPIKVHYEKVSDRWEIAIALSTEGQFNQVSFVNSICTTKGGTHVTHALQNIISAISEKVKKAS----KTADLRAQTIKNYLFVFVKSMIINPQFDSQTKESLTTKKDKLGSTCEPSEKFIKKVCDPKTGIVSSIVDYVKLMDQN---KFIKKFSGKKTGRPYFPKLDDANLAGSKSSADCTLILTEGDSAKSIATAGISRDLYGAFPLKGKIENVSDLSNSKVVANEEITAIVEIMGLQYGKEYTSVDLRYGHLMIMTDQDHDGSHIKGLLINLIKHFWPSLLQPGFLVEFITPIVCFKKGQKTLSFYTLPEFLEWKEKNPGKGWHIKYYKGLGTSKPEEGKEYFIDKHKIDFEW-DSEAEENIDKAFNK---KRADDRKKWMAEH......... 753
154 0.000e+00UniRef50_A0A074ZAX9 Uncharacterized protein n=1 Tax=Opisthorchis viverrini TaxID=6198 RepID=A0A074ZAX9_9TREM  ali  22  106.AHPQNKRLSVERIYQKKTQLEHILLRPDSYIGSTFSPGLYKIFDEIL-------------GI-----EQNMIKIWNNGKGIPVVQHKVENVYVPTLIFGHLLTSSNYDDTERKVTGGRNGYGAKLCNIFSKKFIVETKDYKKSFRQVWTDNMTKTSDPKI-SPDKGDDFTCITFYPDLQRFGMTELDSDTVALFVRRAYDLAATTVKVFLNGKRLAIKSFMDYVDLYVKA-----NKDNETATKVVF--------------EGVNPRWQVAVAPSSSGFQQV-SFVNGIATTKGGKHVDYIADQLNNKLIEIVKKKS--GKSGVQIKPFQIRNHMWLFVNCLIENPTFDSQTKENMTLQPKSFGSTCTLSEKFVTQASKCGIVESVLSWVRFKAMEKLDKQCHKAKHVKLK----GIPKLDDANNAGTKHSSQCTLILTEGDSAKSLAVAGLGRDNYGVFPLRGKLLNVREASSKQIMDNAEINALIKIMGLQYKHKYENPDLRYGKIMIMTDQDQDGSHIKGLIINFVHCNWPNLLKHNVLEEFITPIVKVFKGKDELSFYSLPEFEEWQRSTNWHTWRIKYYKGLGTSSGKEAKQYFSDRHRIRFRYTGSEDDASIQLAFDR---SRASERKNWLTSWTMERK.... 739
155 0.000e+00UniRef50_D5GF28 DNA topoisomerase 2 n=1 Tax=Tuber melanosporum (strain Mel28) TaxID=656061 RepID=D5GF28_TUBMM  ali  24  43...SSKEKKSFADAYQKLTQLEHILKRPDTYVGSTMVPGLYKIFDEILVNAADNKIRDPMDTLKVTVDKTNTISVYNNGRGIPIEIHSKEKVYVPELIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTVETGDKKQKYKQTWTDNMGKMGKAKITANPKGEQFTKITFKPDLAKFHMEEMDDDFEALVKRRVYDMAASVKKVFLNGERIKLN-FRKYCEMYVNALHEEAGCEEKLVITW----------------EVVNDRWEVAFAAS-GGNFQQVSFVNSIATTSGGTHVNYIADQLCTHLQGALKKQNKSG---AAVKNAQMRNHFFIFVNCLIENPAFTSQTKEQLTTRAGAFGSKCALSDTFIKNILKNTPVISNIIDYANMKAD-----KQLKKTDGSRRSRINNPKLIDANRAGTKDSQECVLILTEGDSARSLAVAGISRDRFGVFPLRGKLLNVRDASHDQIMKNAEIQNIKQILGLQHKKVYESRKLRYGHLMIMTDQDYDGSHIKGLLINFFETQFPSLLN----------------------FFTMPEYEYWKENNAEKGWEHKYYKGLGTSGERDAKLYFSDRHVKEFHVMEAEGQRLIELAFSK---KKADERKEWLR........... 663
156 0.000e+00UniRef50_A0A0G4EI17 DNA topoisomerase 2 n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4EI17_VITBC  ali  22  2.....PKEKSIEERYQKKTPIEHILLRPDTYVGSNYVPGIYKIFDEILVNAADNVQRMKMTAIRVNIDAKNTISVWNDGRGIPVEIHREHQMYVPELIFGHLLTSDNYDDTEKRVTGGRNGYGAKLTNVFSTEFTVECLDNGRRFKMTWTDNMTKHSEPEIEDTDEEKDFVLVTYKPDLKKFNMTKLDDDVLSLRVWDVAGVHAGNLKVYLNKTKLKCSSFQEYVDKYIPEKQAEL-----------------------PKIHEKGPRWEVVVTLSEGSFGQV-SFVNSIATIKGGTHVAYVVDQLCTAI---SKKVSQKNKNGVEVKNMHIKNHLWVFINCLIENPAFDSQIKETLTTKPAKFGSTFTISDKALKQVCNSGIVDNVLLWAEGK-KTLDLQRKMKTGGTKGQKQLTGIPKLEDANDAGGRYAEQCTLIITEGDSAKTSCIAGLSRDRYGVFPLRGKMLNVRECKNNQVTANQELTNLLKVMGLQIGKRQETPKLRYGSIMIMTDQDTDGSHIKGLLINLFDHYWPELLQRGFLKEFVTPIVKVTRSSDEVSFFTLPEYEQWKEENNDKGWKTKYYKGLGTSTDREFKEYFIDEHQLTFKWTGGEDSELIDMAFSK---KKADERKEWILKY......... 646
157 0.000e+00UniRef50_B8C9L4 DNA topoisomerase 2 n=4 Tax=Eukaryota TaxID=2759 RepID=B8C9L4_THAPS  ali  23  41..........IEETYQKKTQLEHILLRPDTYIGSTYTPGLYKIFDEIVVNAADNKQRDPMDRMEVTVDAEGTISVLNNGKGIPVVMHKEHNCYVPTLIFGHLLTGSNFDDDEKKTTGGRNGYGAKLANIFSTEFIVECVDEGMKFKQVFRNNMHVKEDPKVKKCTAAEDYTKITFKPDLNRFNMTSLDTDTVGLLSKRAYDIAGSMANVYLNGKKLPVKDFKSYLALF-------------------------DGITPPAAYEKVGDRWEVGISVS-DGSFQQISFVNAIATTKGGGHVNYIADQVAKSLQASVKKKN---KGGTEIKPNQIKNHLSVFVNCLVENPTFDSQTKENLTTRPSAFGKEGQLSDKFMKQVEKCGV-----VDAIMSYAKFKQNQALKRKGGTKKTKLTGITKLDDANNAGTAKSKDCTLIITEGDSAKSLAVSGLSRDFYGVFPLKGKPLNVRDATHSQIMKNEEIMNLVEIMGLKFGTTYNIKSLRYGHLMIMADQDHDGSHIKGLIINFIHHFWPSLLDPDFLMQFITPIVKCTKGKKSHTFFTLPEYEEWKEGTGNKGWTIKYYKGLGTSTSSEAKEYFSNLDIHEIL---DNDAILIDMAFSK---SKVEERKKWLNR.......... 682
158 0.000e+00UniRef50_A0A2P8Z8C0 DNA topoisomerase 2 n=1 Tax=Blattella germanica TaxID=6973 RepID=A0A2P8Z8C0_BLAGE  ali  21  28.KKPANKKLTVEKIYQKKSQLEHILLRPDTYIGSTYVPGLYKIFDEILVNAADNKQRDPMDSIKIEINPENLISIWNNGKGIPVVEHKDEKMFVPTMIFGHLLTSSNYNDEEEKVTGGRNGYGAKLCNIFSTMFTVETCKEYKKCFKQVWGSNMGKASEPKVKEFAGEDFTKISFSPDLSKFKMQNLDNDIVALMSRRAYDVAATTRKVYLNGKKLPVKGFKDYVELYLKEKKDFVGN------------------PLKCVYDNVNPRWEVAIAMSEDSQP--VSFVNSIATTKGGRHVDHVAEPIVKKLIELVKKKN---KGGLQIKPAQVKNHLWVFVNCLIVNPTFDSQTKEHMTLQAKNFGSKCNLSEKFLNSVTKC----------GIVEALLTFAKSKADSQLQKQCSGKKQNKLKD---------------SAKTLAVSGLGVVGRDK--YGVFPLRGKLLNVREATHKQITENQEINNVVKILGLKYNKKYDLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLKLSFLEEFITPIVKATKGNEEFSFYSLPEFEEWKASKNWHTYKIKYYKGLGTSTSKEAKEYFMQRHRIKFKYAGPQDDHCINMAFSK---KCAEQRKEWLTTWMEDTK.... 654
159 0.000e+00UniRef50_Q55BP5 Probable DNA topoisomerase 2 n=3 Tax=Dictyostelids TaxID=33083 RepID=TOP2_DICDI  ali  23  93IASSAKKGKSIEEIYQKKELLDQILLRPDTYIGSTFVPGIYKIFDEILVNAADNKQRGNMKFIKVVIDEKGFISVTNDGAGIPIQVHSEHKIYIPELIFGNLLTSSHYDDSEKRLTGGRNGFGAKLANIFSTKFIVECADSKKLYKQTFTNNMRSKEDPKITSYQNKTDYTKITFYPELDRFGMVEFDDDLVALRVYDIAGCNPTLKVSLNDE------------ELGIRSFEKYIN-----------LYFPDEENAPKVYYEKVSDRWELAVTLSKESQFNQVSFVNSICTVKGGTHVTHALSNIVTAIQEQVNKKN---KGSADIKPAFIKNHLSVFVNCLIENPHFDSQTKETLTSKISSFGSRCEPSEKFIKRVLDSKSGIVASILEF--AQFKDQSALKRSTSSGGKKGKVSIPKLDDANLAGGTKSEDCTLILTEGDSAKSLATAGISKDHYGAFPLKGKLLNVRD-QSTKVINNDEINNIVTILGLKYGKVYETSDLRYGHLMIMTDQDHDGSHIKGLIINMVHHFWPTLLRPGFLVEFITPIVKVFKNNQKISFYTMPEFLKWRETND-KGWDVKYYKGLGTSTPGEGKEYFSDLERHKIDFEWDEGADNIELAFSKSRADD---RKKWMAEHIE....... 737
160 0.000e+00UniRef50_Q7YZS4 DNA topoisomerase 2 n=1 Tax=Physarum polycephalum TaxID=5791 RepID=Q7YZS4_PHYPO  ali  23  311..DNNGQPVSVEEMYQKKTPVEHILLRPDSYIGSIYVPGLYKIFDEILVNAADNKQRDHMNVLQVTIDPNNIISILNNGKGIPVQLHEKEKVYVPELVLGTLLTGSNFDDKIAKVTGGRNGFGAKLTNIFSTSFEVETADRHKLYRQSWSENMSQRTEPSIESGPKGSDYTRITFSPDLAKFNMQSLNGDILRLMKRRIYDMAACLPSVQVSLNGIPIPSFDAYVSMYQPKDAQPLSNAEDGAEGTEGEQPGKQPTKHPFVYAKINDRWQVAVGLTMEGQFSQVSFVNSIATSKGGTHVNHVAEQVVKAIHERITKKYP----DLDTRPAHIRNNLFVFVNCLIENPAFDSQTKDTLTTRPAHFGSACDLPDSFLKRIVAQVPIIDKVVGWAKLKQMAEFEKSSTRKPKD-KAGIKAIPKLDDANFAGGPRSSECTLIITEGDSAKSLAVSGLSRDKYGVFPLRGKLLNVRDQSPKRVMENEELKHLRMILGLTPGKEYDRAELRYGKVMLMTDQDHDGSHIKGLFVNFMIQFWPSLLEQGFLEQFITPIVKAFHGAEVQTFYTTSEYEIWRSQLPDDKWRIKYYKGLGTSSSQEAREYFKDRHRIEFKW-DDTTTTKMDMAFGK---DETAQRKTW............. 992
161 0.000e+00UniRef50_A0A2B7YPL4 DNA topoisomerase 2 n=3 Tax=leotiomyceta TaxID=716546 RepID=A0A2B7YPL4_9EURO  ali  22  128.SSEPASKGTATERYQKLTQLEHIIKRPDTYVGSVYVPGLYKIFDEILVNAADNRHNDKMDEIRITVDASGEISVWNNGRGIPIEIHSKEGVHIPELIFGHLLTSSNYDDDQQKVTGGRNGYGAKLCNIFSTEFTIETSRKKKKYKQTWTDNMSKVGKAKITDCK-GDDYTKVTFKPDFKKFGMEGMDDDFEALAKRRVYDLAGTSKVVKLNGSRIPVRNFKKYMEMYTKAIKQE-------------RGEEAAKDKTDILTDSTSPRWEIGFAVS-DGSFQQVSFVNSIATTSGGTHVNYITDQICNRLLDHLKKKN---KGGAQLKAAQIRNHIFIFINCQIVNPAFTSQTKEQLTTKHTQFGSKCVLPDEFLKKILKTQVM-----ENIIHFAQQKADQILKKSDGSRRSRM-NNPKLTDANKAGTREGHHCTLILTEGESAKGLAMAGRGPDHFGIFPLRGKLLNVRDASIDQISKNTEIQNIKNFLGLQHKKEYDTKGLRYGHLMIMTDQDHDGSHIKGLLINFLQVQFPSLLKIPEFLIFITPIVKVWKGDPKKSFFTLPEYEAWREIHGHDRWEKKYYKGLGTSTTDDAQIYFLDKHLKQFHVMQEHEPALIDLAFSK---KKADERKEWLRQF......... 781
162 0.000e+00UniRef50_Q9Y8G8 DNA topoisomerase 2 n=349 Tax=Eukaryota TaxID=2759 RepID=TOP2_PENCH  ali  22  55.SNNQDKDTNVSEKYQKLTQLEHIIKRPDTYVGSTYVPGLYKIFDEIVVNAADNKQNDKMDEIRVTIDESGEISVWNNGRGIPIEMHSKEKMYVPELIFGHLLTSSNYDDTQMKVTGGRNGFGAKLCNVFSTEFTIETQRQKKKYKQTWTENMTKMGKAKITDAKGA-DYTKVTFKPDYAKFGMTGMDDDFEALVKRRVYDLAGTAKVVKLNGSRIPIRNFKMYMEMYTKAIRRE-------------RGDMGPAGKNEIITCSPDPRWEVGFAVSDGAFQQV-SFVNSIAITSGGTHVNYIADQICSKLAEQVKKKN---KNGATLKPAQIRNHIFIFVNALIVNPAFTSQTKEQLTTKQSQFGSKCVLEEDFYKKILK------TEVMTNILHFAQQKADQMLKKTDGGRRSRMNNPKLTDANKAGTKEGHHCTLILTEGDSAKGLAMAGRGPDLFGVFPLRGKLLNVRDASFDQIAKNQEIQNIKNFIGLQHKKEYDTRGLRYGHLMITTDQDHDGSHIKGLLINFLQAQFPSLLKIPEFLIFITPIVKVWKGDKQRSFFTMPEYEAWKEEHGHEGWEHKYYKGLGTSTTEDAQIYFLDRHLKEFHTMQDNEVELIELAFSK---KKADERK............... 702
163 0.000e+00UniRef50_A0A066WCV9 DNA topoisomerase 2 (Fragment) n=1 Tax=Rhizoctonia solani AG-8 WAC10335 TaxID=1287689 RepID=A0A066WCV9_9HOMO  ali  23  87.ATIQRKDKGASDMYEKLTQLEHILKRPDTYIGSIFVPGLFKIVDEILVNAADNKINDAMDTIKVEIDEEGLISVHNNGKGIPVEIHSKEKIWIPEMIFGHLLTSSNYDDDEKKLTGGRNGYGAKLTNIYSTEFTIETADKKQKYKQTWTNNMSKPGKAKITKNSRGEEFTKVSFRPDFKRFGMEGIDNDMASLLRRRVYDMAGTVKKVFLNGERIKIKNFKQYIEMYVNSXXXXXXXXXXXXXXXXXXXXXXXXXXXX-----------------SDGSFQQISFANSIATTKGGTHVNMLADQISKNLIAGIEK----KNKGAKVKPQTIRNHMWIFVNSLIENPTFDSQTKEWLTLPSSKFGSRPHVSEDFMKKVAKSGI-----IDNVLSWAKFKADQENKKTDGTKRTRLTGIAKLSDANNAGGKQAAECTLILTEGDSAKSLAEAGLSRNNFGIFPLRGKLLNVREATHDQVMKNAEIQAIKQIMGLKHNAVYDVKSLRYGSIMIMTDQDHDGSHIKGLLINFLDYFYPSLLKIPFLVEFVTPIVRVSKGNQKINFFTIPEFQTWNEENNKDKWYVKYYKGLGTSKDTDAREYFMEKHMIPFAKTEEGERELIDMAFNK---KKADDRKDWLRQF......... 734
164 0.000e+00UniRef50_A0A2P6NVQ0 DNA topoisomerase 2 n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6NVQ0_9MYCE  ali  23  53..SAKGITTSVESTYQRKTPVEHVLLRPDTYIGGVDPPGLFKIFDEVLVNAADNRQRDSMQNIHVEIDKKGIISVFNDGRGIPVQKHKTENLYVPELIFGNLFTGSNFDDQQAKVTGGRNGYGAKLANIFSKKFTVQTCANGLSYTQSWSENMSVKGEPIIEEAKGAAEWTKITFQPDLEKFKMQSLNEGDIARRVYDIAGSNEGLT-VKLNGQTLPS---------GFSAYLSLYNWSSQT------KSSGESSEISIPAITKINARWQVGVEVSQTGTFNQISFVNSINTSRGGTHVNYVTDQVVRYLSDELRK----KDKEFRYSPAQIKNHLNVYINCLVENPAFDSQTKETLTTRASVFGSKCHLSERWLSDMAQRTG----IVDEILNWARMKQQSELSAKSGRMSSKIVGIPKLYDANLAGTPRSNECTLIITEGDSAKALAVSGLSRDTYGVFPLRGKLLNVAEATHAQLMGNVEVANLVTILGLNYEKEYVDRDLRYGRVMLMTDQDHDGSHIKGLVINLFHHFWPSLLKDDFLEEFITPIIKATKGKNKKVFFTLPEYSKWYNSTAEPSWTSKYYKGLGTNTAEEAKEYFIDQHRIPFRW-TEDSSNLIEMAFHK---EHVGDRKNWLLKF......... 706
165 0.000e+00UniRef50_Q9HGH4 DNA topoisomerase 2 (Fragment) n=6 Tax=Saccharomycetales TaxID=4892 RepID=Q9HGH4_CANDU  ali  23  10..................................TIVPGLYKIFDEILVNAADNKIRDPMKNIRVKIDENNIIEVMNDGKGIPVEMHTKENMYIPELIFGNLLTSSNYDDNEKKVTGGRNGFGAKLCNIFSTQFEVETADMGKLYKQSWTNNMSNVSKPKITTLKTKKEYTKITFRPDLSKFDMDCLDNDLLSVLRRRVYDLCGTVKNCYLNEKRLNISSFKSYVEMYVKAIKE--------RSPEPEPQDGTIKNFTTIVHEVFNDRWEVAFAVS-DGSFNQVSFVNSIATTSGGTHVKYVSDQIINKLVETL-SKKEKGKKKLMIKPQEVRDNMFLFINCLIENPAFTSQTKEQLTTKVSQFGGKDKF---VANDNLINRILKTSIVEKIRAIANANEDKALQKADGSRKSRIKGQVNLVDANRAGTKDGHNCTLILTEGLSAMNLAVAGLSRDYYGCFPLRGKLLNVREASADQIAKNAEINSLKQIIGLQHKKVYNIKSLRYGHIMIMTDQDQDGSHIKGLIINFLETSFPGLLDPGFLLEFITPIVKVTVGKRVIPFYTMPEFEHWRDEGKQCRWTQKYYKGLGTSTPMEAREYFLDRHLKRFHALQGEDKNYIDLAFSK---KKADERKEWLQGFLP-GTHLD. 629
166 0.000e+00UniRef50_A0A1B2J8D7 DNA topoisomerase 2 n=5 Tax=Saccharomycetales TaxID=4892 RepID=A0A1B2J8D7_PICPA  ali  23  55..SSTANNVNVSDQYQKLSQLEHILKRPDTYIGSVEVPGLFKIFDEILVNAADNKIRDPMKNIEVTIKPENLIEVKNDGKGIPVQIHDKEHIYIPELIFGNLLTSSNYNDDQKKVTGGRNGYGAKLCNIFSTEFIVETYDKGKLYTQRWSQNMGKTDKPIIKSMKKATEYTKVSFRPDLAKFNMTELDEDILGVLRRRVFDLCGSVRSVKLNGEKLKIRNFKQYVEMYVKA-LEHKNDPVKTEDNXXXXXXXXXXXXQTIVYQTLNDRWEIAFAVSDS-TFNQVSFVNSIATTSGGTHVNFIADQIVKK----IEKEIKTKNKKAMIKPFQIKNNMFLFINCLVENPAFTSQTKEQLTTRASQFGGKK--TEVPDDFIKKILRTGIVDAILDIAAMNAD--KALKKNDGSRKNRITGYPKLEDANKAGTKEGYKCTLILTEGDSASSLAVAGLGRDYYGVYPLRGKMLNVREASADQIMKNAEIQAIKQIMGFQHKKNYNINSLRYGHIMIMTDQDHDGSHIKGLIINFLESSFPGLLKPNFLLEFITPIVKVTIKRKVIPFYSMPEYEAWREQ-NTESFKQKYYKGLGTSLAEEMRQYFLDKHMKTFHALQDVDPGFIDLAFSK---KKADDRKEWLRGFEPGV-HLD. 729
167 0.000e+00UniRef50_A0A0C2N7A0 DNA topoisomerase 2 n=1 Tax=Thelohanellus kitauei TaxID=669202 RepID=A0A0C2N7A0_THEKT  ali  22  38MTTKKKN---VEEIYQKKTQIEHILIRPDTYIGSTFCPGLYKIFDEILVNAADNKQRDPMTTIKIDFDQANSITIYNDGKGIPIVIHKEENVYVPTLIFGHLLTSSNFDDNDKKVTGGRNGFGAKLCNIFSHRFTVETASCGKKKFIQIWQNNMGGVVDPMITDYKGPDYTRVTFCPDLKRFNMTELDSDFVSLLKKRAYDLAGTIPKVYLNGELLNVPSFEKYAALYSRADTQEQATS---------------------LYRRVNDRWEVCVMPS-DGAFQHVSFVNNIATTKGGTHVNHVCNKIVAKLIEDAQKK--IKNSKVQLRPQQVKQHLWLFINSKIENPSFDSQTKENLTLNEREFGSTCDFQDKFLKQISDLLCENIVSWYNI-----KLKSDLNKKGATVKRSKLHGMAKLDDANDAGTGKSLDCTLILTEGDSAKSLAVAGVSRDKYGVFPLRGKVMNIRETSMSNVIKNKEVESLVKIIGLDFKKKYEDRSLRYGKVMFMTDQDYDGSHIKGLLINFFHFLWPNLIKHNFLEQFITPIVKVRKGHDVKAFFSIPEYEEWKNETDFKSWKVKYYKGLGTSKDIEAKEYFEDRHRIKFQYTGAPCEDAIVLAFSKA---KVDSRKMWLDNF......... 681
168 0.000e+00UniRef50_D3B7U7 DNA topoisomerase 2 n=1 Tax=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) TaxID=670386 RepID=D3B7U7_POLPP  ali  22  128.TNITKNVKSVDETYKRMELLDQILLRPDTYIGSTYVPGLYKIFDEILVNAADNIQRKKMKQIKVEIDPENRIMVWNDGPGVPVEMHKKEQMYVPEMIFGHLLTSSNYDDSEKRLAGGRNGFGAKLANAFSTEFLVECADSGKLFKQTFKANLKNREKPEITTYSKATDYTQITFYPDLSKFGMDDDNVALLTKRVYDIAGCNPSL-KVTLNGEDLNIKSFQSYIQLYFKSLEK----------------------APEIYYERVSERWEIAIALSHEGQFNQVSFVNSICTPKGGTHVTH---ALNDVLAEIGKAVQKKHKSKAEIKPAFIKNHLFVFVNSLIENPAFDSQTKENLSTKITSFGSQCHPSEKFLKKIVESKSGIVDQIISYAKHKEEMAMLRNT-TATTKKGSRLNIPKLDDANLAGTSHSEDCTLILTEGDSAKTLAVSGISWDHYGCFPLRGKLLNVRESDARTMMTNEEIVNIINIMGLQHGKQYDVKSLRYGHLMIMTDQDHDGSHIKGLLLNFIHHFWPSLLREGFLVEFVTPIIKATKGNKTIAFYTIPEYLAWRENNNGKGYEIKYYKGLGTSTEEEAKEYFLVNHKIDFEYDNGAD-DAIDKAFNK---KRANDRKTWMDQY......... 778
169 0.000e+00UniRef50_A0A1Q9CVC3 DNA topoisomerase 2 n=1 Tax=Symbiodinium microadriaticum TaxID=2951 RepID=A0A1Q9CVC3_SYMMI  ali  22  797..................................NYVPGLYKIFDEILVNAADNYVRDNQTYIKVTINEEGCISIENNGRGLPVEEHKEHQMYVPEMVFGHLLTSDNYDDSEKKVTGGRNGYGAKLTNIFSTKFEIECGDERRKKYQQTWEENMRKKQKSKISAHLGESFTKITFWPDLSRFGMKKLDKDIVGLMCRDVAGTTPAKCKVHLNGKRLEINSFKDYISLY------------------------TGTEDVQIVHEKCHERWEVAMTVS-DGQFQQVSFVNNIATTKGGTHVVHVADQLVEAIT---QKVNKQNKGGMEVKPYHVRNYLWVFVNAQIENPSFDSQTKETMTLKQSKFGSACAIPDKMINSVLKTGIVDMVLQWAKAKEEIDLGKTLKGGSSAPNKKTKRNIPKLEDANLAGSKDGRECTLILTEGDSAKSLAVAGLGRDRYGVFPLRGKILNVRDANFAQTMSNAEIANITKIIGLEPRKEYSTNGLRYGSIMVMTDQDYDGSHIKGLILNFVQHWWPSLFKPGFMTEFVTPIVKVSRRSFTQQFFTMQEYEKWKEENNNRGWHLKYYKGLGTSTMAEAKEYFINEHSLSFEYTGQNDDEAFDMAFNK---KRADDRKEWINE-ADDEEFVD. 1395
170 0.000e+00UniRef50_A0A068X3B0 DNA topoisomerase 2 n=5 Tax=Bilateria TaxID=33213 RepID=A0A068X3B0_HYMMI  ali  21  136.AQTAKKRLSVERIYQKKTQLEHILIRPDTYIGTTYTPGLYKIYDEILVNAADNKIRDPMSCIKIDIKPENLIRIWNNGAGIPVVHHKVENMYVPSLIFGHLLTSSNYDDTEQKVTGGRNGYGAKLCNIFSKKFIVETKDHKKCFKQTWVDNMTKTSEPKI-KPSIGEDYTCISFYPDLERFGMTELDADTVALFERRAYDVAASTRKVFLNGERVPIKSFKDYIDLYLKD-------------------KGEDGTNVPVVYEVVNPRWEIAVAPS-SVGFQQVSFVNSIATTKGGRHVDYIADQVVSKLVDIVKKKS--GKSGVAIKNFQVRSHMWVFINCLIVNPTFDSQTKEFMSLESKNFGSTCLLNDKFIVQVSKSGIVESILSWVHYKAQ----EKMDKQCHKQKHSKLKGIPKLDDANDAGTKNSIKCTLILTEGDSAKTLAVAGLSRDRYGVFPLKGKLLNYKNKYETQESLS---------------------NLRYGKVMIMTDQDQDGSHIKGLLISFVHHNWPNLLRHNFLEQFITPIVKAFKGKQELAFYSIPEFEEWQKTTNWHTFRVKYYKGLGTSSSKEAKEYFMDRHRIRFNYSGPEDDSGIMLAFNK---NKINDRKQWLTSWME....... 761
171 0.000e+00UniRef50_W9IMY8 DNA topoisomerase 2 n=19 Tax=Dikarya TaxID=451864 RepID=W9IMY8_FUSOX  ali  23  181...KPGKKKTATEMYTKLSQLEHILKRPDTYIGSVFVPGLYKIFDEILVNAADNKQRGSMTYMKINIDENGVISVENNGKGIPIVIHEKEKIYIPELIFGHLLAGSNFDDDEKKTVGGRNGYGAKLCNVFSTEFNLECQDHGKRYKQTWRNNMQTMEKAKITSSKTS-DFTRVTFKPDFKRFGMEDIDDDLESLLHRRVYDMVGTIRKVFLNGEQIKIKDFKAYCDLYAKSIAKERSTEE----------GGAPTCTVEMDKDKSHPRWEVGFAVSDGTFQQV-SFVNSIATTSGGTHVNYIADQVTEALLKALNK----KRKGHALKQSHLKNHIFIFVNCYINNPAFTSQTKEQMTTKPSQFGSKCKLGEDFLKKIAK-----SDALQNILDFAEKKADKMLAKGDG-NKRSRVNNAKLVEANFAGTRRGHECTLILTEGDSAKGLAVSGRDPDRIGVFPLRGKLLNVRDASVDQIMKNAEIQNIKQFLGLKHKQTYDTKNLRYGHLMIMADQDHDGSHIKGLLINFLQVQFPSLLKIPDFFEFITPIVKVWQGQRLKSFFTQPEYEEWKEDHKNERWHSKYFKGLGTSSNEDAQVYFLDDHLKEFDTMKPEEADLLELAFSK---KKADARKEWLGNF......... 838
172 0.000e+00UniRef50_A0A1C3KX05 DNA topoisomerase 2 n=53 Tax=Apicomplexa TaxID=5794 RepID=A0A1C3KX05_9APIC  ali  23  1MAKNK----TIEERYQKKSQIEHILLRPDTYIGSTYVPGLYKIFDEIIVNAADEKSDNPMTCIKIEISKEHRISVYNDGEGIPVEIHKEMNIYVPHMIFGELLTSDNYDDAEDRITGGRNGFGAKLTNIFSKEFVVQCGDRKKEFKMIWSDNMSKISEPLI-KNYNGKDYVKVTFKPDLDKFGMTQMDDDIESLLYKRVYDLAGTCSVVYLNGTRLGVKDFKSYVDLYLRDNNPANASSKNGANANKDDNNGNAEVSGNEGAENMDHRWEIVVSKTDGSQFQQVSFVNSICTTKGGSHVNYIVEQL---LNSLSKRANAKNKGGMEIKSGHIKNHLWVFVNCLIVNPTFDSQTKETLTTKPMKFGSKCILSEKTINNVLKSPILSNILLWAQAKAQVELRKKMKA-GSSKARERIIGIPKLEDANDAGSKHSQECTLILTEGDSAKTSCLAGLSRDKYGVFPLKGKLLNVRDASFKQLMDNKEIQNIFKIMGLDIKNKEDIKGLRYGSLMIMTDQDYDGSHIKGLLINMIHKFWPSLLKKGFLSEFVTPIVKVQKGNQEHSFFTIAEYEQWKENTNLVGWKIKYYKGLGTSTDKEFKQYFSDIHKIVFLWTGDRDGDSIDMAFSK---KRIEDRKLWLQNFIL....... 712
173 0.000e+00UniRef50_U6GMC9 DNA topoisomerase 2 n=2 Tax=Eimeria TaxID=5800 RepID=U6GMC9_EIMAC  ali  23  31....KRAKKTIEERYQKKSQLEHILLRPDSYIGSTFPPGLYKIVDEILVNAADVKAREKMTAIKVSVDQQGYIRVWNDGEGIPVAIHKEHKVYVAELIFGQLLTSDNYDDTEARVTGGRNGFGAKLTNIFSSHFEVECADSKRKQKIKWTDNMSKQEPPVITPFNGAGDFVSVKFKPDLRRFGMSALDDDLVSLLRKRCFDLAGTATAVYWNGTRLPVRSFVDYVDLYLGEGAGKKRENGTEPKEDEDKENETPPEKQIIKIHEKMHRWEVVISQTDGSSFSQVSFVNSICTTKGGHHVTHVIEPLLAAL---VKKANAKNKGGMEIKAPHVKQHLWVFVKCLIENPAFDSQTKETLTTTVSRFGSKCTLSERTINAVAKSPILEGVLLWAQTKAQVEL-RRQMSVGKTKGRERLTGISKLEDANEAGGRYAQECTLILTEGDSAKTSCLAGLSREKYGVFPLRGKLLNVREASFKQLKENREIQNILRILGLQINDKQDTRGLRYGSLMIMTDQDYDGSHIKGLLINMLHHYWPQLLQCNHFTEFVTPIVKVSKGSVEKAFFTLVEYDMWRKQQGNAGWKIKYYKGLGTSTDREFKDYFLDKHRIRFRWTGEGDGELIDMAFSK---KRAEDRKRWLQGY......... 760
174 0.000e+00UniRef50_M2ZV72 DNA topoisomerase 2 n=4 Tax=Fungi TaxID=4751 RepID=M2ZV72_PSEFD  ali  22  4..PVEQKAKKGSEQYEKLTQLEHILKRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDKMNELRVWVDEKGVISVKNNGKGIPIEMHTKEGIWIPEMIFGHLLTSSNYDDNEAKTTGGRNGYGAKLTNIYSTQFELDTVDSKKQRYRQTWRKNMSVMEKAKIDKVKVDDYTQVTFRPDFSKFGMEKMDADFEALVKRRVYDMAGTAKKVYLNGERIKISKFKQYMEMYTKAIKTENIVNDGTAPEQVI------------LTDNPHERWEIGFAVS-DGSFQQVSFVNSIATTSGGTHVNYIADQICDKLEEIVNKKNKGGVK---LKKAQLKNHIFLFVNALIVNPAFTSQTKEQLTTKVSAFGSRPQVSEKFLK------DIAKTEVVNNILHFAQQKADKVLAKSDGGRRQRMNHSKLTDANKAGTKDGHRCTLVLTEGDSAALLALAGRNPDLFGVFPLRGKVLNVRDASVDQISKNQEIQNIKKFIGLQHKKEYDTRGLRYGHIMIMTDQDHDGSHIKGLLINFLQVQFPSLLKPGFLLEFITPIVKVWKGKAKHDFFTMPEYEAWREQPGHKGWDHKYYKGLGTSDTRDAQIYFLDKHLKTFHAMQDHEPELLEMAFSK---KKADARKTWLQNF......... 658
175 0.000e+00UniRef50_G4KQF7 DNA topoisomerase (ATP-hydrolyzing) n=125 Tax=root TaxID=1 RepID=G4KQF7_OSCVS  ali  32  1MASKK---DYGNESISSLKGADRVRKRPGVIFGSDGLEGCEHAVFEILSNAIDEAREGHGALITVTRYLDRSIEVEDLGRGCPLDWNEKEGRWNWELVFCELYAGGKYDNNSYEYSLGLNGLGSCATQYASQYMDVTVRRDGKKYTLHFEKGENIGGLHNEPTDRGKKTGTIIRWLPDLDVFTDTAIPAEYFTDVMKRQAVVNAGVTFRFRNEVPGHFETEDFFYKDGIVDYVTELAG--EGSLTAPIFWETERRGRDRADKPEYKVKLSAACCFSNRVN-IIEHYHNSSWLEHGGSPEKAAKSAFVSAIDQYLKQNGKYQKTESKITWNDVEDCLVLVSNNFSTATSYENQTKKAITNKFVQEAMTDFLRSNLEVYFIENPFDAEKIAEQVLINKRSRESAEKARLNIKKKGNIDIANRVEKFVDCRSKDVTRREIYIVEGDSALGSVKMGRDAEYQGIMPVRGKILNCLKADYARIFKSEIITDLMKVLGCGVEVKFDVGNLRWNKVVICTDGDVDGFQIRTLILTMLYRLTPTLIREGYVYIAETPLFEINCGEKTWFAYSDKEKNDIIRDLSGKKMKVDRSKGLGENEPEMMWLTTMNPETRRLIRVQPSDVAETARVFDLLLGDNLQGRKDHIAENGKYLEMADI 660
176 0.000e+00UniRef50_A0A0B2W309 DNA topoisomerase 2 n=5 Tax=Chromadorea TaxID=119089 RepID=A0A0B2W309_TOXCA  ali  22  70............EKYQHISPLKHVLLRPDTYVGSVYIPALLKIFDEVLVNAADNKQRDPMTAIRVTIDRDNEVSVWNDGEGIPVEMHSEEGVYVPSLIFGTLLTSSNYDDSEVKIIGGRNGFGAKLCNIFSTEFTVETSNSGKRFRQTWHNNMSKCDEAVEVIPEGTSDFTKVTFKPDIEKFHMKELDEVAIGLMQRRVIDVAGTLKGVFLNGQKIDVHGFRDYVRLYIGKN---------------DMAATDSEKGETYVFSEVNDRWQVAVALSDIGFEQI-SFVNNIATTKGGRHVDYVCDQIVSRIKEEVELRCGTKK---SVRPLQVKNCMRLFLNSFIENPAFDSQTKEYLSSAPKAFGSKCVMSDAFFKELFARTDIVESI-------MRDINKRELRSLNRSNGRELSDLHKLEEAGDAGTNRSRQCTLIVTEGDSAKALAVAGLGRKYFGVFPLRGKLTNVRGLDEKTSLQNAEVSALIRILGLKFGEDYSRNELRYGHLMIMTDQDEDGAHIRGLIVNFLHSFWPSLIRSDFIQYFITPLLKVRSGSEVIPFYSNAEFERWKRDCDSTKYSLKYYKGLGTSSAQEAREYFMDRHRMQFVYGGKEDDENIELAFDK---NRADDRKIWISSNSRE...... 713
177 0.000e+00UniRef50_A0A1E7F6K6 DNA topoisomerase 2 (Fragment) n=1 Tax=Fragilariopsis cylindrus CCMP1102 TaxID=635003 RepID=A0A1E7F6K6_9STRA  ali  21  1........KTVEETYQKKSQLEHILLRPDTYIGSTYTPGLYKIFDEIIVNAADNKQRDNMDRLDVTIDEDNSISVKNNGKGIPVVRHGEHDCYVPTLLFGNLLTGSNFDDNEKKTTGGRNGYGAKLANIFSTKFIVECVDNGKKFQQTFTKNMGHASEPIIKNITANEDYTQITFSPELSRFKMTSLDKDTVGLLSKRAYDIAGSMANSK------------------GKKLSVTLNGKKLPIKSFQDYIKIFRGVNPPCAFERVDDKWEVGVSHSEDGSPMQISFVNAICTSKGGTHVSFVADKIAMSLAKAVEKKNKGGTK---ISNNQIKNHLCIFVNALVENPTFDSQTKDHLTNRKNCYKDECELSDKFLKAAC---SAKGEILDSILSFAMFKAKKELKKTGGSKKIKLTGIQKLDDANRAGSKDSLKCTLILTEGDSAKSLAMSGLSRDHYGVYPLKGKPLNVRDASHTQVMKNEEIKNVIEILGLKHGVVYDETNLRYGHLMIMADQDHDGSHIKGLIINFLHTFWPSLLDPGFLQQFITPIVKVTKGKKSETFFTIPQYEEWKEETGNKGWKIKYYKGLGTSTAADAKEYFLDLHEVGFERISLDSDGLIDMVFNK---KRANDRKDWLQQFEKD...... 655
178 0.000e+00UniRef50_A0A1X7QYU6 DNA topoisomerase 2 n=1 Tax=Kazachstania saulgeensis TaxID=1789683 RepID=A0A1X7QYU6_9SACH  ali  23  2....SRAQKTATERYQKISQLEHILKRPDTYIGSVEVPGLFKIFDEILVNAADNKVRDPMKKIEVTITEENLIEVKNDGKSIPIEIHQKEKIYIPELIFGHLLTSSNYDDEEKKVTGGRNGYGAKLCNIFSKEFILETADKGKKYVQKWENNMNVCNPPTITSYKKGPSYTKVSFKPDLSRFNMEVLDNDILGVMRRRVYDINGSVRSVYLNGKSLKIRNFKNYVELYLKSLEKMKQINN--------NQDASKQDTPTILYERISDRWEVAFAVS-DISFQQISFVNSIATTSGGTHVNYVTDQIVKKVGDY------FKKKKKRIKPFQIKNNIFIFVNCLIENPAFTSQTKEQLTTRVKDFGSRCEISNDYINKILK-----TDLATRIFDAADENDAKALKQSDGSRKSRITEYPKLEDANKAGTKDGYKCTLILTEGDSALSLAVLGLGRDHYGCYPLRGKMLNVREASADQILKNAEIQAIKKIMGLQHRKKYDTKSLRYGHLMIMTDQDHDGSHIKGLIINFIESSFPGLLDPGFLVEFITPIVKVTIKKQSIAFYNMPDYEKWREEESYKSWKQKYYKGLGTSQGSEVREYFLDKHLKTFHALEGNDKDLIDLAFSK---KKADDRKEWLRQY......... 655
179 0.000e+00UniRef50_A0A1V4JQM5 DNA topoisomerase 2 n=1 Tax=Patagioenas fasciata monilis TaxID=372326 RepID=A0A1V4JQM5_PATFA  ali  23  27......KGLSVEHIYQKKTQLEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDKMSCIKVTIDENNTISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDNEKKVTGGRNGYGAKLCNIFSKKFTVETCREYKKLFKQTWTDNMGKAGEMKLKYYDGEDYTCVTFQPDLSKFKMTILDKDIVALMSRRAYDIAGSTKKVFLNGQRLPVKGFRSYVDLYLKDKVDETGNELKVIHEEV------------------NSRWEVCLTLSEKGFQQV-SFVNSIATTKGGRHVDYVADQLVTKIIEVVKKKN---KNGVGVKPFQVKNHMWIFVNSLIENPTFDSQTKENMTLQAKNFGSTCKLSEKFIKGAVGCGIVESILNWVKFKAQ----SQLNKKCSAVKHTKIKGVPKLDDANDAGSKNSLDCTLILTEGDSAKTLAVSGLGRDKYGVFPLRGKMLNVREASHKQIMENAEINNIIKIVGLQYKKNYEDQELRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKVSKNKDEISFYSIPEFEEWKSNTNYNSWKIKYYKDNERS........................................................... 620
180 0.000e+00UniRef50_A0A067H7B6 DNA topoisomerase 2 (Fragment) n=2 Tax=Eukaryota TaxID=2759 RepID=A0A067H7B6_CITSI  ali  22  21....TAPNKTIEEMYQKKSQLEHILLRPDTYIGSIYVPGLYKIFDEILVNAADNKQRDPMDAVKVVIDQEHLISVHNSGDGVPVEIHQEEGVYVPELIFGHLLTSSNYDDNVKKTTGGRNGYGAKLTNIFSTEFIIETADGKKKYKQVFTNNMGKKSEPNISKCKEGDNWTKVSFKPDLAKFNMTHLEDDVVALMKKRVVDLAGCLVKVELNGHRVPVKSFAEYVDMYPKS--------------------------VTRFHERVNERWEICVTLS-EGQFQQVSFVNGIATIKGGTHVDYVANQVANHVMA----VVNKKNKNANVKAHNVKNHLWVFVNALIDNPAFDSQTKETLTLRQSSFGSKCELSEE----FLKKVTAKSGIVETLLSWANFKQSKDLKKNDGTKTEDVRGISKLEDANLAGGRNSEQCTLILTEGDSAKALAMAGLSRDRFGVFPLRGKLLNVREASSNQVLNNSEIGNIKKILGLKQGVEYNNVKLRYGHLMIMTDXDHDGSHIKGLLINFIHSFWPSLLKIPFLVEFITPIVKATKNGKVLSFYSMPDYEAWKESLGGNSWSIKYYKGLGTSTSKEGKEYFQNIHKKDFVWEDDQDGEAIELAFSK---KKIEARKKWLLQF......... 687
181 0.000e+00UniRef50_Q8J2S1 DNA topoisomerase 2 (Fragment) n=25 Tax=Eurotiomycetidae TaxID=451871 RepID=Q8J2S1_TRIRU  ali  24  1.............QYQKITQLEHILKRPDTYIGSVFVPGLYKIFDEILVNAADNKQNDPMSEIRVTLDKEGEISVWNNGRGIPVEIHKKEQIYIPELIFGHLLTSSNYNDMQEKVTGGRNGYGAKLCNIFSKEFTVETADQKKKFKLTWTNNMSTMGKAKITECK-GDDYTKVTFKPDFAKFGMDGMDDDFEALVKRRVYDMAGTCTAVKLNGTRIPIKSFKKYMEMYTKAIKAERGEDPT-----------SASDKNDIITESPDRRWEIGFTVS-DGSFQQVSFVNSIATTSGGTHVNYISDQICNKLADALKKKNKTG---ATLKATQIKNHIFLFVNSQIVNPAFTSQTKEQLTTRPSQFGSKCVVSDDFLKKVMK------TRVMDDILHFAEKKADQILKKTDGNRRSRMNNPKLTDANKAGTKDGHHCTLILTEGDSAKGLAMAGRGPDLFGVFPLRGKLLNVRDASVDQISKNAEIQNIKNFIGLQHKKEYDTRGLRYGHLMIMTDQDYDGSHIKGLLINYLQVAFPTLLKPGFLIEFITPIVKVWKGDHTKSFFTLPEYEEWKEAHAHKKWQKKYYKGLGTSSTEDAQIYFLDRHLKQFHTLQDKEAELIELAFSK---KKADERKEWLRQF......... 644
182 0.000e+00UniRef50_D8MBJ7 DNA topoisomerase 2 n=2 Tax=Blastocystis TaxID=12967 RepID=D8MBJ7_BLAHO  ali  22  34.ASQRRKSLTVEEKYQKLDPREHVLKRPDMYIGSTYVPGFYKIFDEILVNAADNKHNDPMDTIRVDIDRDGRITVWNNGKGIPVVIHKEEKVYVPSLIFGLLLTGGNFDDNEKKVTGGRNGLGAKLTNIYSLEFSVETADEGKEFKQVWFDNMSRCNDPVIKK-YRGKEYTKISYVPDLKLFQMDSIDDDTLEKRVYDIAGVTDSSLKVYLNGERLNVKNFESYIKMYQNEGATETKENK-------------------VVYCNAGERWEVGVGVS-DGHFQQVSFVNSICTSKGGKHVDYIAQKVSDYLLPVFKKKLKKDIKLTMVKQY-----LYIFVNCKIENPTFDSQSKETLTKVSKGWGSLPVLSEQFLKKVEKCGIVDAVSVFSRFK-----EDQMLKKQSGKKTARKLNIPKLDDANFAGTRHSKDCTLIITEGDSAKSLVVGGLSRDYYGVFPLRGKMLNVRDVSRAAVIKNEEIHNLVQILGLKFDTVYDDSSLRYGKLVIMADQDYDGSHIKGLVINFFQVFWPSLLKLNFLQQFITPIVKATKGRQSFMFFTLQQYKNWLQTHNEKGYYIKYYKGLGTSTPQEGKEYFLSRHLVPFKSITDDESSHLDMLFRK---KRVAERKEWINQY......... 676
183 0.000e+00UniRef50_A0A0L6WS77 DNA topoisomerase 2 n=1 Tax=Termitomyces sp. J132 TaxID=1306850 RepID=A0A0L6WS77_9AGAR  ali  22  94......KKKTASETYVKLSQLEHIMKRPDTYIGSIYVPGFLKIVDEILVNAADNKINDPMDTLKVSIDENCTISVYNNGRGIPIEIHSKEKIYIPELIFGHLLAGSNYDDNEKKLVGGRNGYGAKLANIFSHEFTIETADKNQKYKQTWTNNMSVCGKAKVTKNTKGDEWTRITFRPDLARFGMETIDEDTASLLRKRVFDLSGTVKKVFLNDDRLKIKNFKQYVELYLQSTQAEAAENS----------GGAAFVKPSVIYEQIGNRWEVAFAVS-DGTFQHVSFANSISTTKGGTHVACIADQIAKNLITGIAK----KNKAATVKPAQLKNHMWIFVNALIENPTFDSQSKETMTLPASKFGTKPQLSEEFMKKIAKSTI-----VDQVLNWAKFKADQQAKKTDGSKRNRLTGMTKLSDANNAGD---------SAKALAVAGLGVVGRDN--FGVFPLRGKLLNVREARHDQIMKNEEIQNIKKIMGLQHNKDYNTSSLRYGRLMIMTDQDHDGSHIKGLLINFLDYFYPSLLKLPFLVEFITPIVRVRKGGQKIDFFTLPEYEKWLEETGSHKWDPKYFKGLGSSNDADAREYFMQKHMIPFATIQEGDKELIDLAFSK---KKADERKEWLRQY......... 728
184 0.000e+00UniRef50_K5Y6A9 DNA topoisomerase 2 n=2 Tax=Agaricus bisporus TaxID=5341 RepID=K5Y6A9_AGABU  ali  23  93.........TVSETYTKLSQHEHILKRPDSYIGSIYVPGFLKIVDEILVNAADNKINDSMDTIKVNIDEENTISVYNNGRGIPVEIHSKEKIYIPELIFGHLLSSSNYDDDEKKLTGGRNGYGAKLANIYSHEFTVETADKNQKYKQIWTENMTNCGKAKITKNSKGEEWTRITFKPDLQRFGMDSIDEDTASLLRKRVYDVAGTVRKVYLNDERLKIKNFKQYVEMYVDS----------VQAEAAEASGGAAQPKSQVIYERLSERWEIAFTVS-DGSFQHVAFANSISTIKGGTHVNYIADHLSKHIMTAVSK----KNKGAPVKPFQIRNHMWLFVNALIENPMFDGQTKETLTLPSSKFGSKPTIKEDFIKKVLKTAI-----VDNVLHWAKAKADQQIKKTDGSKRNRLVGLTKLSDANNAGTRLAKDCTLILTEGDSAKALAVAGLGRDYFGVFPLRGKLLNVREAKHDQIMKNEEIQNIKKILGLQHNKDYDVSSLRYGRLMIMADQDHDGSHIKGLLINFFDHFYPSLLKLPFLVEFVTPIVRIIKGKHRRDFFTLPEYEKWLLEAPDHKWESKYYKGLGTSNDADARDYFMAKHMIPFAPTQHGDRDLIDLAFSK---KKADDRKEWLRQF......... 738
185 0.000e+00UniRef50_L8H0X6 DNA topoisomerase 2 n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8H0X6_ACACA  ali  21  108...........EEVYQRKTPVEHVLLRPDSYCG--YVPALYKIFDEILVNAADNKQRDPMTTIKVWIDEQGSIRILNDGQGIPVHVHKQEGLYLPELLFGHLLTGSNFDDSVAKVTGGRNGYGAKLANIFSKEFTVETVDCKRKFVQTWRDNMSTTDGPRVQQEQEAKDYTVVTFKPDLSRFGMQTLKDDDINMRVYDVAGCNETL-KVYLNERPLPGSFKDYLSLYYGPEVVEEA-----------------------FVFDKINDRWQVGVGISDSGQFSSISFVNSINTRRGGTHVNYIADQVVKYVVDKINK----TDPDLKVQPAHVKNHLTVFVNALVENPSFDSQTKETLTTRPRNFGSDCQLSTQLLDNILERTRIVDTVSRWMYMKQSSDLARKAASGRSGTR--IYGIPKLDDANLAGSANSKDCTLILTEGDSAKSLAVAGLSRDHYGVYPLKGKLLNVRDATHRQLLENKEINEITTILGLNHERTYSDDGLRYGKVMLMTDQDHDGSHIKGLFINFLHRFWPSLLEKGYVEEFITPIVKATKKKEEKVFFAIPEYQRWKEELDPSKWRIKYYKGLGTNTTEEGKEYFLGKHRIGFEWQGEQDGRQIDMAFSK---DQVEQRKQWLMAFYEE...... 762
186 0.000e+00UniRef50_I2H4V9 DNA topoisomerase 2 n=16 Tax=Eukaryota TaxID=2759 RepID=I2H4V9_TETBL  ali  23  1MTEVKSA----SDRYQKISQLEHILKRPDTYIGSVEVPGLFKIFDEILVNAADNKVRDPMKKIEVNINPENLIEVKNDGNGIPIEIHKKEKIYIPELIFGHLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFTLETADSGKKYIQKWENNMNVCHDPKITTYKKIQSYTKVSFKPDLKRFGMENLDEDILGVYRRRVYDINGSVRNVYLNGKSLKIRNFKNYVELYLKSLEKKRQLEN--------GEDSTSQQSPTILYEKLNDRWEIAFAVS-DISFQQISFVNSIATTSGGTHVNYIVDQIVRKVSD------LLKKKKKNIKPFQIKNNIFIFINCLIENPAFTSQTKEQLTTRVKDFGSRCDISPEYINKIMK-----TDLATKIFEIADENANNALKKSDGSRKSRITEYPKLEDANKAGTKEGHKCTLILTEGDSALSLAVAGLGRDYYGCYPLRGKMLNVREASADQILKNAEIQAIKKIMGLQHRKRYDTSSLRYGHLMIMTDQDHDGSHIKGLIINFLESSFPGLLDPGFLVEFITPIIKVTITKQTIVFYNMPDYEKWREEESHQTWKQKYYKGLGTSTGQEMREYFLDKHLKQFHALEGNDKDLIDLAFSK---KKADDRKEWLRQH......... 654
187 0.000e+00UniRef50_A0A221KIM0 DNA topoisomerase 4 subunit B n=41 Tax=Betaproteobacteria TaxID=28216 RepID=A0A221KIM0_VITFI  ali  34  1....................MEPVKQRPGMY---TRTDNPLHIVQEVIDNAADEALAGHGQRIAVTLHADGSVSVDDDGRGIPFGLHPEEGVPVVEIVFTRLHAGGKFDKGAYSFSGGLHGVGVSVTNALATRLQVSVWREGQMAQLAFSGGDVIEPLGVRKTAGERKHGTSVRVWPDAQYFDAPELPRNELIHLLRSKAVLMPGVTVTLTTEKTGDVQTWR-----YDAGLRDYLGQALSAEPLIPLFEGAHFIAAGDTDTFAEGEGAAWCVAFTEEGGLLRESYVNLIPTVAGGTHEAGLKDGLFNAVKGFIELHALLP-KGVKLMPDDVFGRASFVLSAKVLDPQFQGQTKERLNSRDALRLVSASVRPAFELWLSQHVEHARKLAELVIKQA---QSRQRASQKVEKKKGSGVAVLPGKLTDCESRDLSLNELFLVEGDSAGGSAKMGRNKETQAILPLRGKVLNAWEVERDLLFKNNEIHDIAVAIGVGPNDSPDLSGLRYGKVCILSDADVDGSHIQVLLLTLFFRHFPRLVENGRVFIAKPPLYRIRKPAVKLYAMDEGELDAALDKLRKDGWSISRFKGLGEMSAEQLWDTTLNPDTRRLLRAEWGGLSFADTVFAQLMGKEAQARRDLMELHGDAV-EVDV 638
188 0.000e+00UniRef50_A0A267FFW3 DNA topoisomerase 2 (Fragment) n=3 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267FFW3_9PLAT  ali  22  30.....KQRVSVEKIYQKKTQLEHILLRPDTYIGSTFVPGLYKIFDEVLVNAADNKQRDPMSCIRITISEDNLIEVWNNGKGIPVVEHKKEKLYVPTLIFGHLLTSSNFNDSEKKTTGGRNGYGAKLCNVYSSQFTVETSCKGKRFQQTWTDNMGKAGEAKIMKNA-AEDYTKVSFKPDLTKFGMTELDDDTIALFSRRAFDIAGTCSGVFLNGEKLPVTSFKDYYRLYLTEKED------------------------KEVAIIKSGRWELAVCLSNDGFKQV-SFVNSIATTKGGRHVDFVCDLLLKRLVDAIDGKCKADKKKGSIKPAFVKNHLWIFCNCLIENPSFDSQTKEFMTLQAKKFGSAPELDDKFFKKLLSEDCGIVRCVLEYADF--------KTNKALNQRTKASKKTFHEKLDHANNAGKGECVLILTEGDSAKSLAVAGASRDRFGVFPLKGKLLNVREASKDQLMNNKEIKVIQDAVNLQYGKKYDLKSLRYRHIMIMTDQDQDGSHIKGLIINFIHFFWPELLRHDFLQEFITPIVKVTKRDQVKAFYSMPEFDEWRQTPDWHKWHVKYYKGLGTSTAKEGREYFMRRHCVRFIRRDQTDEESILMAF----GKNADMRKDWLLKFMDDRK.... 675
189 0.000e+00UniRef50_A0A1U7LU04 DNA topoisomerase 2 n=6 Tax=Fungi TaxID=4751 RepID=A0A1U7LU04_9ASCO  ali  22  127.AKKPSGSKNATEQYQKLSQLEHVLKRPDTYIGSTIVPGFYKIFDEILVNAADNKQRDPMTQIKVTFDEKNEISVMNDGKGIPVEIHAKEKIYIPELIFGNLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSTEFIVETKKSGKKYKQIWTDNMTVKTKPKISENKKGEEYTKITFKPDLAKFDMEVMDDDIIKRRVYDIAGCVKGI-KVYLNGTLLKINSFKKYIDLYVNSKTAE-----------------EGGTERKVYHEIVSDRWEVAVTHS-DGQFNQVSFVNSIATTRGGTHVDMVTDQIVKKLAEIIKKK-----KAHPIKNFQIKNQMWVFVNSLVENPAFDSQTKETLTLKNSAFGSKCVLSEEFIKKVSKSAI-----VENIMNFSLVRADKELQKSDGSKRSRITGIPKLEDANNAGTKNAHRCTLILTEGDSAKTLAVAGMSV--VGRDNFGGKMLNVRDASAAQVSANAEIQAIKRIMGLQHAKAYTSTELRYGHLMIMTDQDHDGSHIKGLIINYFEKFYPSLLKIPDFLIFITPIVRCTKKKQTIDFFTLPEYEHWKENNGGAGWDQKYFKGLGTSKAEDAKRYFLDRHLKYFHAMQEGDRILVDLAFSK---KKADERKDWLRDFIP-GTYLD. 776
190 0.000e+00UniRef50_D7G0Y6 DNA topoisomerase II n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0Y6_ECTSI  ali  23  40........QTVEQRYQKKTQLEHILLRPDTYIGSTFVPGLYKIFDEIIVNAADNKQRDNMSKLKVTVDAEGKISVWNDGAGIPIQMHKEHHIYVPELIFGNLLTGSNFDDDQKKTTGGRNGFGAKLANIYSTEFVVETRDAGKHYRQVFRNNMQEKEAPEIDCDYEGPDFTCITFTPDWKRFHMTGMEADTIALLRKRVYDMAGCMVKVYLDNRRVKVSGFKDYMSMY-------------------------EGMETPVIFESIGDRWEVGVAVSADSVFQQVSYVNAICTVKGGTHVECVANQVINKLLPVLKRKHKAEVKGHFVK-----NHLCVFVNGLVENPAFNSQSKEALTSKDTLFGSVPKISDAGLKKLEKSEI-----VDRVLSWAKHKQNQQLNKKSGKKSSKLTGITKLDDANHAGTAKSQDCTLILTEGDSAKTLAVSGLGRDRYGVFPLKGKLLNVREATGPQVLKNEEIQNVVKILGLKFNHTYDDTKLRYGHLMIMTDQDHDGSHIKGLLINFVHHYWPSLLKDGFLQEFITPIVKVSKGRNELSFYTVPEYTVWKEGHANKGWNAKYYKGLGTSTAKEAKEYFLDTHQLEFEWDDDRDDDLIDMAFSK---KRVEDRKEWLRGF......... 677
191 0.000e+00UniRef50_A0A163FG40 ATP binding n=4 Tax=Eukaryota TaxID=2759 RepID=A0A163FG40_DIDRA  ali  22  836..............YQMLSHLEHIMKRPDTYIGSTYVPGLYKIFDEILVNAADNKQNDKMSEIRVTVDETGEVSIKNDGKGIPVEIHHQHGIYVPEMIFGHLLTSSNYDDDQQKVTGGRNGYGAKLCNVFSREFTVETVDQKKKYKQTWTDNMSKMGKAKITDIK-GDDYTKITWRADYNKFGMDGIDDDFEALIKRRTHDMAGTLRKVYLNGDRVKVTSFAKYMEMYTKAISRE-------------QGNTEDGEERKDVIITDKHDRWDIGFAVSDGAFNQVSFVNSIATTSGGTHVNFIADQIIDKLMAIVNKKNKAAVK---LKPAQIKNHLFLFVNCSIVNPAFTSQTKEQLTTKASQFGSKPVLSDKFLKAIEK------TEVIQNIMHFAQQKADQLMKKTDGNKRNRINNAKLTDANKAGTKDGHLCTLILTEGESASVLALAGRNQDLFGVFPLRGKLLNVRDASMDQIMKNAEIQNIKKFLGLQHKKEYDMKSLRYGHLMIMTDQDHDGSHIKGLLINFLQCQFPSLLKPGFLLEFITPIVKVWKGKGLKSFFSMPEYEEWKEQHKQKGWDHKYYKGLGTSDIKDAQVYFLDTHMKRFHTMRAEEEKLIELAFSK---KKADARKEWLRDF......... 1480
192 0.000e+00UniRef50_A0A2H5N9X7 DNA topoisomerase 2 n=4 Tax=Embryophyta TaxID=3193 RepID=A0A2H5N9X7_CITUN  ali  22  21....TAPNKTIEEMYQKKSQLEHILLRPDTYIGSIYVPGLYKIFDEILVNAADNKQRDPMDAVKVVIDQEHLISVYNSGDGVPVEIHQEEGVYVPELIFGHLLTSSNYDDNVKKTTGGRNGYGAKLTNIFSTEFIIETADGKKKYKQVFTNNMGKKSEPNISKCKEGDNWTKVSFKPDLAKFNMTHLEDDVVALMKKRVVDLAGCLVKVELNGHRVPVKSFAEYVDMYPKS--------------------------VTRFHERVNERWEICVTLS-EGQFQQVSFVNGIATIKGGTHVDYVANQIANHVMA----VVNKKNKNANVKAHNVKNHLWVFVNALIDNPAFDSQTKETLTLRQSSFGSKCELSEE----FLKKVTAKSGIVETLLSWANFKQSKDLKKNDGTKTEDVRGISKLDDANLAGGRNSEQCTLILTEGDSAKALAMAGLSRDRFGVFPLRGKLLNVREASSNQVLNNSEIGNIKKILGLKQGVEYNNVKLRYGHLMIMTDXDHDGSHIKGLLINFIHSFWPSLLKIPFLVEFITPIVKATKNGKVLSFYSMPDYEAWKESLGGNSWSIKYYKGLGTSTSKEGKEYFQNIHKKDFVWEDDQDGEAIELAFSK---KKIEARKKWLLQF......... 687
193 0.000e+00UniRef50_S9RKM7 DNA topoisomerase 2 n=3 Tax=Ascomycota TaxID=4890 RepID=S9RKM7_SCHOY  ali  24  57.AEANETRLNASSQYQRLSPREHVLRRPDTYVGSIDVPGLYKIFDEIIVNAADNKVRDPMNTLKVTIDPENVISVFNNGKGIPVEIHDKEQIYIPELIFGHLLTSSNYDDNQKKVTGGRNGYGAKLCNIFSSEFTVETADKYKKYKQVWTDNMSEKKDPIVTDLKRPEEYTKITFKPDLQKFGMPMIDADMVAILKRRVYDMAGTVPKVFLNDERLKVSGFKKYVDMYLSS------------------STPSDTESPTVIYERVNDRWEIAFAVS-DEEFNQVSFVNNIATIRGGTHVNYIADHIVKAVNEDVQK----KNKGAPVRPFQIKNFIRIFVNCQIENPSFDSQTKETLTTKVSNFGSTCTPSANFMNRVKKSEIIEK----VLDLARSRADKQLSQTDSRGSRSRITGLPKLEDANKAGTKESHKCVLVLTEGDSARSQALSGLSRDYYGIFPLRGKLLNVREASHTQIMNNKEIQAIKKIMGLVHKKNYDTKELRYGHLMIMTDQDPDGSHIKGLIINYLESTYPSLLQPGFLIQFITPIVKCKRNRQVIPFYTLSEYEYWKENNDGRGWDIKYYKGLGTSDANEMKSYFLDRHMKYFHEIKEADKGLIEMAFAK---KKADSRKEWLRTY......... 703
194 0.000e+00UniRef50_A0A2A9NWX0 DNA topoisomerase 2 (Fragment) n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NWX0_9AGAR  ali  23  104.....SKKKTASETYTKLTQLEHILKRPDSYIGSVFVPGFYKIVDEILVNAADNKINDPMDTIKVTIDEECTISVFNNGRGIPIEMHSREKIYIPELIFGHLLSSSNYDDDEKKLTGGRNGYGAKLANIYSLEFTIETAHKQQKYKQSWTNNMSSCGKPKITKTKGEE-WTRVTFKPDLKRFGMSRIDEDTANLLRKRVYDLAGTAKKVFLNDERVKIKNFRQYVEMYLDS----------ARIAAEDISGGAAQPKQSVIYEQVSPRWEVAFAVS-DGFFQHVSFANSIATTKGGTHVLYIADQISKSLMTSISK----KNKAAAVKLAQIKNHMWIFVNSLIENPTFDSQTKETLTLPASKFGSKPVLSEEFMKKVLKSSI-----VDNILNWAKAKADQQIKKTDGTKRSRLLGLTKLSDANNAGTRYAKNCTLILTEGDSAKALAVAGLGRDNFGVFPLRGKLLNVREARHDQILKNEEVQNIKKIMGLQHNKDYDISSLRYGRLMLMTDQDHDGSHIKGLIINFLDYFYPSLLKLPFLVEFVTPIVRVTKGKQRRDFFTIPEYEKWLEETPDKKWDSKYFKGLGTSSDADARDYFMSKHMIPFAPAQDGDKELIELAFSK---KKADERKEWLRQF-KAGTFLD. 759
195 0.000e+00UniRef50_K0RJM3 DNA topoisomerase 2 n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0RJM3_THAOC  ali  41  167..STATSDAYSATQITVLEGLDPVRKRPGMYIGSTGPDGLHHLVYEVLDNSVDEALAGHASLITCTITDDGRGIPTDHGVGINVDRKPGGNKPI-ERKMMRFQTGVPVGGLQDVDLEEIHNWDSVTFQTNEKKSTALGDDDGKKVSKAKSSPRKYKSTLLEKLSKGRKTGTSVTFKPDISVFKAIEFDASKLAVRMDEMAYLNAGLVLTLQDKRSSSIKRTIFHHAGGLSEYADLLCRGKAPLFSSPKKVKKTATRKSAQVDPKTPIAIDAALRYSNTYNEQILSFVNNIRTKDGGTHVEGLKSCLTRTLNQAAKRSGKLKDGDSNLSGDFVREGLTAIISVSVSEPEFEGQTKGRLGNPEVRPAIETALGQELTKLFDFHPDILNAIFENASRAQAAANAAKAAREVVRKKTLLSSTVLPGKLADCSSRDFSETEVFIVEGDSAAGSAKQGRDRRTQAILPLRGKILNIERAAPERIYQNNELQGLISACGLGMGSELEESALRYGKVIIMTDADVDGAHIRVLLLTFFFRYQRELVERGYLYIAQPPLYKIVTGSGEKYTFSDEEKDEHLREMLNIKKDIQRFKGLGEMMPKQLWETTMDPERRSLLQVSVKDCSLADQTLDILMGDAVAPRRNFISENAESLTDLDV 955
196 0.000e+00UniRef50_A0A1V8TFQ7 DNA topoisomerase 2 n=1 Tax=Rachicladosporium antarcticum TaxID=1507870 RepID=A0A1V8TFQ7_9PEZI  ali  22  345...SAGKKGTSSDQYQRLTQLEHILKRPDTYIGSTFVPGLYKIFDEILVNAADNRQRDKMNEMRVVVDREGLISVRNNGHGIPIEMHAKEGIYIPEMIFGHLLTSSNYDDEEAKITGGRNGYGAKLTNIYSTEFTLETVDSKQKYRQTWRKNMSVMGEAKITSAGKSEDYTQITFKPDFAKFGMDEMDDDFEALVKRRVYDMAGCVVKVWLNDNRIKISKFKQYMEMHTNAIKTENIADNGKAPEQVI------------LTDNPHERWEIGFAVS-DGSFQQVSFVNSIATTHGGTHVNFVADQIIDKLEEIVNKKNKGGVK---LKKAQIKNHIFLFVNCSIVNPAFTSQTKEQLTTKASAFGSKPQVSDKFLKEIAKTEAV------NNIIHFAQQKGDKLLAKSDGNRRQRMNNSKLTDANKAGTKDGWKCTLILTEGDSASLLALAGRNPDLFGVFPLRGKMLNVRDASIDQISKNAEIQNIKKFMGLQHKKDYDTKGLRYGHLMIMTDQDHDGSHIKGLLINFLQVQFPSLLRPGFLLEFITPIVKVWKGDQKKDFFTMPEYENWKLQPGHKGWDHKYYKGLGTSDTTDAEIYFLDKHLKQFHTMQDGEPELLDLAFSK---KKADARKGWLAAF......... 999
197 0.000e+00UniRef50_A0A2G9SC87 DNA topoisomerase 2 n=2 Tax=Tetrapoda TaxID=32523 RepID=A0A2G9SC87_LITCT  ali  23  30..........VERIYQKKTQLEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDPMSCIKIVIDPNNTVSVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDQKKVTGGRNGYGAKLCNIFSTKFTVETCREYKKVFKQSWTNNMAKASESKIKPFDGDDYTCITFQPDLSKFSMQILDKDIVALMARRAYDVAGSSKKVFLNGKKLPVTGFRSYVDMYVKDKVDETGNSLKVIHELV------------------NDRWEVCLTMSEKGFQQV-SFVNSIATTKGGRHVDYIADQIVAKIIDVVKKKN---KGGVAVKPFQVKNHMWIFVNALIENPTFDSQTKENMTLQSKSFGSKCALSEKFIKSATSCGIVESVLNWVKFKAQ----NQLNKKCSAVKHTKIKGIPKLDDANDAGSKLSNRCTLILTEGDSAKTLAVSGLGRDRFGVFPLRGKLLNVREASHKQIMENAEINNIIKIVGLQYKKNYEDESLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHCFLEEFITPIIKVSKNKQEISFYSIPEFEEWKNTESHKSWKIKYYK----------------------------DDAAITLAFSK---KKVDDRKEWLTNFMENRR.... 643
198 0.000e+00UniRef50_A0A1X6NZU3 Uncharacterized protein n=1 Tax=Porphyra umbilicalis TaxID=2786 RepID=A0A1X6NZU3_PORUM  ali  23  49.........TIEETYQKLSQLEHILLRPDTYIGSTYAPGLYKIFDEILVNAADHKHRDRMTALKVDIDENGRVAVWNNGAGIPVAMHAKEGVYVPELIFGHLLTSSNYDDGEKKVVGGRNGYGAKLANIFSTRFVVETADAGQTYKQTFRRNMMERGAPSIRKSARAADWTRITFEPDLAKFHMTHLDADAVAMRVVDMAGVVPGIG-VYLNGVRLKVRNFSQYVDLHLAD-----------------------APDAPRIHDAAPERWEVVVSLS-DGQMAHTSFVNSIATTKGGTHVAHVADQLVARIQEHIAKKHKTLK----VKPFQIKSQLSIYVKCLVENPAFDSQTKEMLTSRASTFGSKWVCPDKVAKDLIK-----SGVVENVLSLAESRQSKELAKTDGGKRARVTGIGKLDDANKAGTRESTKCTLILTEGDSAKALAISGLSRDYYGVFPLRGKLLNVREATHKQIMDNVEVTNLKKIIGLQHGKKYDIKSLRYGHILIMTDQDHDGSHIKGLLVNMFHHFWPSLLQPNFLEEFITPIVRCTRKGSARTFYTLPEFHSWVEATGISGWKVKYYKGLGTSTAAEAKVYFLDRHQLSFQWSGAGDAEMIDLAFSKL---KVSDRKTWLAAY......... 698
199 0.000e+00UniRef50_A0A2X0LVM3 BQ5605_C013g07129 protein n=1 Tax=Microbotryum silenes-dioicae TaxID=796604 RepID=A0A2X0LVM3_9BASI  ali  24  181.ATKKTKAKSASETYVKLSQLEHVLKRPDTYIGSTFVPGLYKIFDEILVNAADNKAKNAMSYIKVTINEDKKIVVENDGPGIPIEEHKTEKVWIPEMIFGTLLTSSNYDDEEEKVTGGRNGYGAKLANIYSTEFVVETSNDMKTYKQTFKNNMGTKGKPIVKDITKAQDYTRITFYPDLARFGMTEFDDDTVALLTKRVYDMAGIIKNVYLNGKKLSLKNFKQYVEMYTAAIEAASKPSTKKSGENEDMVESLDAGKKNSVIYGQFGQWEVAFALS-DGQFTQVSYCNSIATTKGGTHVNYIADQIVSGLVDLIKK----KNKAAPVKAFQIKNHLSVFINCKIPNPSFDSQTKENMTLSVSKFGFKCVLDDDFLKKVAR-----SGVIDNVLNWAKFKQDQMLKKTDGHKRSRITGLVKLEDANNAGTRNGSKCTLILTEGDSAKALAVSGLGRDNYGVFPLRGKLLNVREAAGKALLDNAEIQAIKQILGLQQGKVYDVDSLRYGKLMIMADQDHDGSHIKGLIINFLDYWFPSLLKKGFLLEFITPIVKATKGNKELSFFTIPQYEHWKEETDDRGWRIKYFKGLGTSDARDAVKYFMDKHRLPFRPSTQEERELIDMAFNKKKADN---RKEWLRGF......... 867
200 0.000e+00UniRef50_Q8X1U1 DNA topoisomerase 2 (Fragment) n=12 Tax=cellular organisms TaxID=131567 RepID=Q8X1U1_TALMA  ali  23  9.ASEAPTQTGAGDKYQKLTQYEHIIKRPDTYIGSTFVPGLYKIFDEIVVNAADNKQNDKMDEIRITIDESGVISVWNNGRGIPIEIHSKEKIYVPELIFGHLLTSSNYDDGQMKVTGGRNGFGAKLCNVFSTEFSIETCRQGKKYHQTWTDNMSKVGKAKITSSK-SDDYTKVTFKPDYQKFGMDGMDDDFEALVKRRVYDLAGTAKVVKLNGSRIPVRNFKKYMEMYTKAIKKE-------------RGEEAVNDKSEIVTASPDPRWEVGFAVS-DGSFQQVSFVNSIATTSGGSHVNYIADQICNRLAEAVKKKNKQG---ATLKASQIRNHIFIFVNALIVNPAFTSQTKEQLTTKPSQFGSKCILDDDFYKKVLK------TEVMTNILHFAEKKADQLLKKTDGGRRSRMNNPKLTDANKAGTKDGHHCTLILTEGDSAKGLAMAGRGPDLFGVFPLRGKLLNVRDASVDQISKNAEIQNIKSFIGLQHKKEYDTRGLRYGHLMIMTDQDHDGSHIKGLLINFLQVQFPSLLKIPEFLIFITPIIKVWKGDKSKSFFTMPEYEQWKEENKNDSWQHKYYKGLGTSTTEDAQIYFLDRHLKEFHTMQDHEAQLIDLAFSK---KKADERKEWLRQY......... 662
201 0.000e+00UniRef50_A0A165IPE3 DNA topoisomerase 2 n=1 Tax=Xylona heveae TC161 TaxID=1328760 RepID=A0A165IPE3_9PEZI  ali  23  128............DRYQMLSQLEHILRRPDTYVGSIFVPGLYKIFDEIVVNAADNKQNDKMDAIKVTIDEKGEISVWNNGKGIPIEMHKKEKIYIPEMIFGHLLTSSNYDDNQQKVTGGRNGFGAKLCNIFSTEFNLETADSGKKYKQTWTNNMTNMEKAKITSCK-GDDYTKVTFKPDFAKFGMDGIDDDFEALVMRRVYDLAGTSRKVHLNGERIKIRNFEQYMKMYTKAIQKE---------------NGEDGEAVKIITESPDPHWEIGFTVS-DGSFQQVSFVNSIATTSGGTHVNYICDQIANRLLETVKKKN---KNGANLKSHQIRNHMFLFVNSLIVNPAFTSQTKEQLTTKSSQFGSKCVITEEFLKKV------AKTDVVNRILHFAQQKADQLMKKTDGSRRSRMNNPKLIDANLAGTKDGHRCTLILTEGDSAKGLAVAGRGPDLFGVFPLRGKLLNVRDATIDSIAKNAEIQSIKNFLGLQHKKEYDTKGLRYGHLMIMTDQDFDGSHIKGLLINFFHHQFPSLLKEGFLIEFITPIVKVWKGDKSQTFFTMPEYEVWKEAHKHENWEHKYYKGLGTSTTQDAQVYFLDRHLKQFDKLKEEEEQYIDLAFNK---KKADDRKEWLRRH......... 769
202 0.000e+00UniRef50_A0A2K8KXE7 DNA topoisomerase (ATP-hydrolyzing) n=11 Tax=Zetaproteobacteria TaxID=580370 RepID=A0A2K8KXE7_9PROT  ali  35  2......SADYDIDSIKDLDGISHIQLRPNMYT-DTGTEGCHHIAQEVLDNCGDEAIGGYCSRIIVELESENVVSISDNGRGIPVKQNQD-GMSGVELVLTKDKAGGKFDHDAYKVSGGLHGVGITVTNALSSWLEATVKRDGGEWFIRLENGRTVEKLRKVAECGPRTHGTKIRFSPNPKYYERAKFRVQQLRQQAMDKAILIPGLEVVF---KAPGQADEIFCFKNGLSEFMTS-------------RMEESPMFEFSGQLGDMEKVHWYFASFAETTPIYTKSYVNTVPTPRGGTHEKGFESGLLKAVREYIDMRPELKKKKTRIAASDVMTNSQLGLSVYIQDISFEGQTKQKLTSAEATKFVGGVINDSAALWLNRDGEISDAWMKLIIERATTRTAAESKAKKVDRKSFTGRTPLPGKLLDCRSNDIEETELYLVEGDSAGGSAKQANDRDLQAVFPLKGKILNCEGVTSTDAGNSEAVADLITAIGTGIGDECDIEKRRYGKIVVMTDADIDGSHIQTLLFTFFWRQMRPMVEAGRVYIVQPPLYGVTVGKQKHYAQDEEELDGLRAMALAEKKKIERFKGLGEMNPPELKETCMDVENRVLVQVSPEDAQRMDALVTKLMGDDAGQRRDLLM........... 623
203 0.000e+00UniRef50_A0A0W4ZTQ2 DNA topoisomerase 2 n=8 Tax=Opisthokonta TaxID=33154 RepID=A0A0W4ZTQ2_PNEJ7  ali  24  81......ATKTTSEIYQKLSQLEHILKRPDTYIGSIEVPGLYKIFDEILVNAADNKIRDPMDTIKVEFSEKNVISIYNNGRGIPIEIHNKEKVWIPELIFGHLLTSSNYDDEEKKVTGGRNGYGAKLCNIFSTEFIVETADRKKTYKQVFLNNMTKKKDPVIKENKKDEEYTRITFKPDLERFGMKEIDSDLESVFKRRVYDLAGSVKKVFLNGERIKVKSFKQYIEMYLNSDDSENNLKPTIIHEVV------------------NDRWEVAFTVS-DGQFNQVSFVNSIATTRGGTHVNYVSDQIVLKLIEAV----KKKNKNIPIKPFQVKNHIWVFINSLIENPSFDSQTKETLTLKQTAFGSKCILSDDFIKKVLKTPIM-----EKILDTAQKKADQLMKKTDGSKKMRITGLPKLEDANKAGTKEGHKCTLILTEGDSAKSLAMSGIGRDYFGVYPLRGKLLNVREASHEQISKNAEINAIKQIMGLQHKKVYTSTSLRYGHLMIMTDQDHDGSHIKGLIINYLESSFPSLLEPGFLIEFITPIVKATKGTQEKTFFTIPEYEYWKESVDNKGWKIKYYKGLGTSYGNDVKKYFLDTHLKEFHSIREGDKELIDMAFSK---KKADERKEWLR........... 725
204 0.000e+00UniRef50_A0A1Y1V514 DNA topoisomerase 2 n=2 Tax=Fungi TaxID=4751 RepID=A0A1Y1V514_9FUNG  ali  23  116.....NSKKSVTEIYQKKTQLEHILLRPDTYIGSTIVPGLYKIFDEILVNAADNKIRDPMDTIKVTINEENEISVFNNGKGIPVEIHEKEKVYIPELIFGHLLTSSNYDDNEKKVTGGRNGYGAKLCNIFSTEFIVETSDKGKKFKQVFNDNMSKKSKPKLT-NATKDDFTKITFKPDLKKFGMEKMDEDFEALLLKRVYDIAGCVVKVYLNDERIKIKNFKDYCQMYINSTKKESEENDLGNMPN---------QNQNIIYERVNERWEVAFSMS-DGQFQQVSFVNSICTVKGGTHVNYVADQITSKLID----SLKKKNKNISIKPFQVKNHLWVFINSLIENPAFDSQTKETLTLRASSFGSKCPVSDNFITKVLRCGV-----IDNILSWAKYKQSQMLKKTDGHKRSRISGIPKLDDANNAGTKYSKDCVLILTEGDSAKTLAISGLGRDNYGVFPLRGKMLNVRDASHKSIMDNAEISAIKQILGLQHGKVYNTDSLRYGHIMIMTDQDTDGSHIKGLLINFLDHFWPSLLKPGFLLEFITPIVKVTKGRASISFYTLPEYERWKEDNNDKGWKIKYYKGLGTSSAAEAKEYFMQHHCKVFSEIEQDDRKLLDMAFSK---KNADKRKDWLKDYTPDI..... 770
205 0.000e+00UniRef50_A0A132ALV4 DNA topoisomerase 2 n=4 Tax=Ecdysozoa TaxID=1206794 RepID=A0A132ALV4_SARSC  ali  22  28..KSTKKKLSVERIYQKKTQLEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDKMNCIRIDIDDDNEIVIFNNGKGIPVIEHKTEKCYVPTLIFGHLLTSSNYNDEEKKVVGGRNGFGAKLCNIFSTSFKVETSCKKKSFTQTWTDNMKNSKEAKISVNS-AEDFTRITFKPDLSKFKMDRLDNDIVALFSRRAYDVAGSTKKVYLNGKKLPISGFKEYVEMF-------------------------VGNTIKMVYESVSNRWEIAATVSDRGFQQI-SFVNSIATTRGGKHVDHVSDQIVNKVTEVIKKKNKVG---VAVKPFQIRNHLWVFVNCLIENPTFDSQTKETMTSQVKSFGSTCSPTEKFFNSVFKVGIVEAVLSWAKFKAQNELSKKCHAKKHAK----LTGIPKLEDANDAGTRNSIDCTLILTEGDSAKSLVVAGLGRDKYGVFPLRGKILNVREASHKQILENAEINNIIKIVGLQYKKQYDLKTLRYGKLMIMTDQDQDGSHIKGLLINFIHHNWPSLLKLNFLEQFITPIVKATKGQEVNSFYSLPEFEEWKKSTNWRNYKIKYYKGLGTSTSVEAKEYFMERHRIKFTYSGNDDDHFVQLAFSKKM---VEQRKDWLTNSMDERK.... 673
206 0.000e+00UniRef50_A0A0M0J6P9 DNA topoisomerase 2 n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0J6P9_9EUKA  ali  23  33.......NATIEDTYQKLTQHQHILQRPDTYVGSTYVPGLYKCFDEIVVNAADNKVRDSQTYIKIKVERDGRLSVENDGKGIPIVMHKEHQVYVPTLIFGHLLAGSNFNDGEKKLTGGRNGYGAKLANIFSTEFIVETADNGKLFRQVFKDNMKDVGKPTITDKEGATDFTRITWTPDLAKFGLSELDEDHCALFERRAYDLAGARVKVHLNGKQLAVKSFSNYVDL--------------------FLGSKSVPGALPRVFERVSDRWEVAIAPSDDGFQQF-SFVNSIATTKGGKHVDHVAEQVVDRLLEFIKKKHKGMDK--VLKPMHVKNHLKLFINCQIENPAFDSQTKEFMTLKQSAFGSKCAPSDKFFKDVQSCGV-----IDSILAFAQSKQNKELKKTDGAKKARLTGISKLDDANEAGGRNGHMCTLIITEGDSAKALAVSGLGRDYYGVFPLRGKLLNVRDAPHSTIMNNKEISELKQIIGLQQGKDYSDPTLRYGHLMIMTDQDHDGSHIKGLIINFLHVYWPSLLHSGDFLEFVTPIVKVSRNRQSTPFFTLMEYEAWRRSLGASAYTIKYYKGLGTSTSQEAKEYFSDRHELTFEWEGEVASELIERAFAKSKADE---RKEWLRGYNPAV..... 680
207 0.000e+00UniRef50_A0A0N4ZUS8 Uncharacterized protein n=1 Tax=Parastrongyloides trichosuri TaxID=131310 RepID=A0A0N4ZUS8_PARTI  ali  22 1089.KTDKSGKISIEQMYQKKSQLEHILLRPDTYIGSVYVPGLYKIFDEILVNAADNKQRDKMNLIKVDINKENTISIFNNGKGIPVAHHGVEKMYVPELIFGTLLTSSNYNDDEKKTTGGRNGYGAKLCNIFSTEFTLETCKEYKKQFKQTWINNMTKDKEPEVTKATGDDFTKVTFKPDLKKFKMKQLDDDIIGLMARRAYDIAGTSQKVYLNGKCLPVKSFKEYAEKYVESIVSD------------------DGEKPKIIYEKVNDRWEVALTVSERGFQSV-SFVNSIATSKGGRHVDYIADQITSNLVDTIKKKAGGVKSGVSVKPFQIKNHMWVFVNCLIENPTFDSQTKENMTLQSKSFGSKAELTEKFYKEATKCGIVEAVLSWVRFKQQEQADKKCSTKKSTKIK----GIPKLEDANEAGTKNSFKCTLILTEGDSAKTLAVSGLGRDYYGVFPLRGKMLNVRDCAMKQINDNQEIGHMIKILGLQYRLKYETEDLRYGRVMIMADQDQDGSHIKGLLINWIHCNWPALMKNNFIEEFITPIVKASKGNTTLSFFSLPEYMEWRQNTDNWKFKIKYYKGLGTSTSKEAKEYFMDRHRIPFTYSGPECGQAVEMAFSK---KKIEARKAWLSQWMREKKE... 1747
208 0.000e+00UniRef50_A0A1Y1W267 DNA topoisomerase 2 n=2 Tax=Kickxellaceae TaxID=4862 RepID=A0A1Y1W267_9FUNG  ali  23  55.TSASARREKVEDIYKKKTPLEHILLRPDTYIGSTYTPGLYKIVDEILVNAADNKVRDPMRKIEVTINKEGEISVLNDGKGIPVEIHKEEKVYVPEMIFGHLLTSSNYNDDQKKITGGRNGYGAKLCNIFSTEFTVETADEKKKYKQLFTDNMKTINKPSITKYNNKSEYTKISFKPDFAKFNMTHLDDDTVALITRRVYDLAGTIPGVLLNGEVIPIRNFKSYVELYLL--------------PPVNSEEPGGIKSQDIVYKRFNDRWEVAFAVS-EGQFNQVSFVNNINTVRGGTHVNYIADQIVKNFIATNKKN------KVNIKPHQVKNNIWLFVNSHITNPAFDSQTKETLTLRVSAFGSKCEITDDFMKGVAKSDLKDMVEMMVR-----RREERDLKKTDGSRTSRITGIDKLDDANMAGTAKSKECTLILTEGDSAKALAVAGLGRDKFGIFTLRGKPLNVRDASARQIGDNQEFTNIKRIMGLKHGAKYSSDQLRYGHILIMADQDVDGSHIKGLLLNMFDSMYPGLLENGFMQQFITPVVRATNKKLIHNFYTEAEYKKWFESEPNKNWTIKYYKGLGTSKEADAREYFLDFHRKTFAPAQSEDRRLLDMAFNK---KKADDRKEWLASY......... 706
209 0.000e+00UniRef50_A0A2V8J7U6 DNA gyrase subunit B (Fragment) n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8J7U6_9BACT  ali  45  1...................................................VDEALAGFCTEVHVVIHIDNSVTVIDNGRGIPTEVMPKEGKPAAEVVLTKLHAGGKFDNAAYKVSGGLHGVGVSVVNALSEWLNLEIWRGGKVYVQGYKLGVPTGPLEM--TGHTDRRGTKVSFKPDDKIF------FDVLSQRLRELAFLNSGLLITIEDERDEKKHEF--HYTGGIVSFVEHLNKNKEPLHDKVIYFE----------GVREGIDLQIAMQYNDSYQEQIFTFANNINTHEGGTHMIGFKSALTRTLNNYALSNNLFKEDKETLSGDDVREGLVAVISVKLSNPQFEGQTKTKLGNSEVKGIVETLVNVGLGDYLNENPSVARKIVNKAIEXXXXXXXXXXXXELVRRKGALDSMSLPGKLADCQERSPELAEIFIVEGDSAGGSAKQGRDRRTQAILPIKGKILNVEKARYDKMLTHQEIVAMITALGTGIGQDFDAAKLRYHKVIIMTDADVDGSHIRTLLLTFFYRQMNELIEKGNIYIAQPPLFKVKKGKSEQYIKDERQMSRFLLKKATENLVIEV--GGQELKGRDL-TSFLEKLIEVFTRVDRHDARIVDHLLSM----DAESR-AFLQQNMKTLAE... 576
210 0.000e+00UniRef50_A0A225B6G9 DNA topoisomerase 2 n=3 Tax=Dikarya TaxID=451864 RepID=A0A225B6G9_9EURO  ali  23  126.TSKPPKDTGAADKYQKLTQLEHIIKRPDTYIGSTFVPGLYKIFDEIVVNAADNKQNDNMDEIKITIDESGQISVWNNGRGIPIEIHSKEKIYVPELIFGHLLTSSNYDDGQMKVTGGRNGFGAKLCNVFSTEFSIETYDRQKRKYQQTWTDNMSKMGKAKITECKGDDYTKVTFKPDYKRFGMEGMDDDFEALVKRRVYDLAGTAKVVRLNGTRIPVRNFKKYMEMYTKAIKKE-------------RGEEAANDKSEIVTASPDPRWEVGFAVS-DGSFQQVSFVNSIATTSGGSHVNYIADQICNKLAEVVKKRNKQG---ATLKASQIRNHIFVFVNALIVNPAFTSQTKEQLTTKPSQFGSKCVLDEDFYKKVLK------TEVMTNILHFAEKKADQLLKKTDGSRRSRMNNPKLTDANKAGTKDGHHCTLILTEGDSAKGLAMAGRGPDLFGVFPLRGKLLNVRDASIDQISKNAEIQNIKNFLGLQHKKEYDTRGLRYGHLMIMTDQDHDGSHIKGLLINFLQVQFPSLLKIPEFLIFITPIVKVWKGDKSKSFFTMPEYEQWKEENVHDRWQHKYYKGLGTSTTEDAQIYFLDRHLKEFHTMQDNEAQLIDLAFSK---KKADERKEWLRQF......... 779
211 0.000e+00UniRef50_A0A1R1WYV0 DNA topoisomerase 2 n=10 Tax=Harpellales TaxID=61421 RepID=A0A1R1WYV0_9FUNG  ali  22  196.SKKSSNGKAIEDIYQKKSQLEHILLRPDTYIGSVYTPGLYKIVDEIIVNAADNKIRDPMDTIKININKEGEISVYNNGKGIPIQIHKDEKCYVPELIFGHLLTSSNYNDNEKKVTGGRNGYGAKLCNIFSTRFEIETADQAKKYKQVFKNNMSEIGKPSLTKFSQKSEYTMVTFIPDFNKFNMSHLDDGIVQLLTRRVYDLAGCVPKVFLNGERIKIKSFKDYIDLYVQPSKVEPTNPDDV---------KPVFNKAEVIYQRISDRWEVGFAIT-DGQFQSVSFVNSVNTVKGGTHVTYVTDQIVSKVIALLKK----KNKGSTVKPYQVKSHIWIFVNCLIENPSFDSQTKETLTLRASSFGSKCDIDDDFIKKVMKTELSSLVMNFVKYKEM-----QGLKKTDGTKSSRITGIVKLEDANQAGTKRSKDCTLILTEGDSAKTLAISGLSRDYFGVFPLKGKLLNVRDASTSQVTNNAEISQIKQILGLKTNTNYSADSLRYGHLMVMADQDVDGSHIKGLIINFLDTHFPSLIRPGFLLDFITPVVKATRRNESISFYSEPEYLEWLNTNGGKDYTIKYYKGLGTSSSKEAKQYFGNHHRKTFLPASEDERKLIDLAFNKARADD---RKEWLNSY......... 851
212 0.000e+00UniRef50_A0A1I7Z5N6 DNA topoisomerase 2 n=3 Tax=Bilateria TaxID=33213 RepID=A0A1I7Z5N6_9BILA  ali  21  288.........TIEEIYQKKSQLEHILLRPDTYVGSVYVPGLYKIFDEILVNAADNKQRDPMNQIKVTIDENNEISVYNNGRGIPVVMHKQEKLYVPELIFGTLLTSSNYNDDERKVTGGRNGFGAKLCNIFSTKFTLETSTKGKRFKQTWVNNMTKDKECEISKAT-GEDFTKITFRPDLEKFKMTTLDDDIIALMSRRAYDVAGTTKNVFLNGKEIPIKGFKQYVEFYMKN-------------------SAESDEAPKMVHELCSDRWEVALAVSDRGFQQV-SFANSIATTKGGRHVDHVTDQIVASIIEVVKKKVAKGGFK--IKPFQIKSHMWVFVNALIENPTFDSQTKETMTLQAKNFGSSCKFSEKFFGAAVKCGIVENVISWVNFK----QLEQQDKKCSGKKTSKLKGVPKLEDANDAGTKNSHLCTLILTEGDSAKTLAVSG---------------LGVVGRDRFGISDNAEVNALLKIIGLQYRLKYDVKSLRYGKIMIMADQDQDGSHIKGLVINFIHNKWPALIRRNFIEEFITPILKATKGREELSFFSIPEYVEWRQNTNWHTYRIKYYKGLGTSTSKEAKEYFSDRHRIKFRYGGPDDDNAVDLAFSK---KKIEERKVWLTRWMETRKE... 940
213 0.000e+00UniRef50_A0A2V0P4K7 DNA gyrase subunit B n=1 Tax=Raphidocelis subcapitata TaxID=307507 RepID=A0A2V0P4K7_9CHLO  ali  40  93................VLEGLEPVRKRPGMYIGSTGPRGLHHLLWEVLDNAVDEVQAGHAAKIDVELDATGRARVIDDGRGIPTGMHPRTGKSALETVLTVLHAGGKFGNADYRVSGGLHGVGISVVNALSEHLKVEVWRGGTAFEQSFSRGAALAPLASRAAAPGEPSGTRVEFEFDRTFAAGVAFDPETVASRMRELAFLNPAATLRLRVIGGGRGRGAAAAQRRRARAGGDESGADSXXXXXXXXXXXXXXXXXDLQVFHFDGGLREYVQWLNRDKQALHQSFTASMDGVEVGAALQWCADAFADVINALAKKNKLLKDGDPSLSGDHVREGLGAVVSVKVPAPEFEGQTKTRLGNPEVRRIVDTLVTREVTEWLEQHPPALSAVVAKALTXXXXXXXXXXXXELVRRKNVLTRSTLPGKLADCTSPDKEATEIFVVEGDSAGGSAKQARDRRTQAILPLRGKILNVERKDDAALYKNAELAALIVALGLGAKGGSDLKALRYGKIILLTDADVDGAHIRTLLLTFLFRYRRELFEAGRVYVAVPPLYRVEFGGRSKWAYDEAQMKALLERAGGASPVVTRFKGLGEMMPDQLWDTTLNPGTRLLRRLTLDDAAEASHTFTLLMGDKVAPRRQLIEQYGLSLEQLDV 817
214 0.000e+00UniRef50_A0A1Y1HP43 DNA topoisomerase 2 n=1 Tax=Klebsormidium nitens TaxID=105231 RepID=A0A1Y1HP43_KLENI  ali  22  136...................................FVPGLYKIFDEILVNAADNKQRDSMDSLKVTIDPENTISVYNNGAGLPVEVHAEEGVYVPELVFGHLLTSSNYDDSQKKTTGGRNGYGAKLTNIFSTEFVIETADGGRKYKQVFSNNMGVKGKPEIKSCKPTDNWTRVTFKPDLSKFNMDHLEADVVALMSKDMAGCLGKTVKVELNGSRLPIKDFSDYVNMFMR---------------PTNNARKEQGQPELDRFYHKTDRWEVVVSQS-GGQFQQVSFVNSICTTKGGSHVNYVTDQVVNHVMDWIKNSKKKDVKSAGVKNFHVKNHLWVFVNALVDNPAFDSQTKETLTTRQAQFGSTCQLPEKILKNVVNSDI-----VHAALSVASAKLQKDLKKTDGAKRTRLVGIQKLDDANDAGGRYSADCTLILTEGDSAKTLAVSGLGRDKYGVFPLRGKLLNVRDASTKQITDNAEISLIKQIMGLQHGKVYDTKALRYGHLMIMTDQDHDGSHIKGLLINFLHSFWPSLLKPGFLLEFITPIVKATHGNQKLSFYTIPEYESWKESLGPKNWSIKYYKGLGTSTPLEAKEYFLDMHQKEFRWTGEQDGDCIELAFSK---KKIEARKAWL-SNCEPGTFLD. 740
215 0.000e+00UniRef50_C5KAQ6 DNA topoisomerase 2 n=1 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5KAQ6_PERM5  ali  22  1MASPPSAGKSVEQIYKKMTQIEHILARPDTYVGSTFCPGLYKIFDEILVNAADNLQRDHMNTIKVDIDENGFIKVYNNGKGLPIQIHKEHHVYVPELVFGHLLTSDNYDDKEKKVTGGRNGYGAKLSNIFSKKFLITTADRKKLYKQQFEKSMQKKKEPVITD-YDKEDFTCVQFWPDLEKFGMTHLDADIVSLMSKRVIDVAGTSCKVYLNGKRVPISSFKDYAELYL--------TGEWVDAPKIYEKVARANVYVSCGHVQVSDRWEVLVTLSDGGQFQQVSFANSINTVKGGTHVNHVAEQI---VNAVLKKAQTKNKGGMELKPFQVKNHMWLFVNALIENPTFDSQTKETLTLKVAKFGSKCVLSEGTMKKVLSSGIVDQVVNWAKFK-QTATLQSKIKVGGTGGQTRIFGVPKLEDANDAGGRYSDRCTLILTEGDSAKALAVAGLGRDKYGVFPLRGKVLNVREASYKQTVDNKEIQAILKIIGLEPRKAYDGVKLRYGSIMVMTDQDLDGSHIKGLLINLVHHWWPGLLQRGFMKEFVTPIVKCVKGRRELSFFTLTEYEEWKRNNNDKGWKIKYYKGLGTSTSKEAQQYFISKHSLSFDYRDGDDGEAIDMAFNK---KRADDRKEWINGYAD....... 675
216 0.000e+00UniRef50_A0A1J0SAP6 DNA topoisomerase (ATP-hydrolyzing) n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1J0SAP6_9ALTE  ali  32  1......MTDYNADAMEVLRDLAPIQKRPGMY---TDTQNPTHTLMEIVDNAIDEAQNGYASQIDITLYQDGRYGVQDDGRGIPVDIHPVEKVSGVELILEIPHSGGKFSNKNYGFSGGLHGVGVTVVNALSKHVLARIKRNGQTHEITYSYAVKNGPLRLVPEGKVNKTGTYLEFIPCEKYFDTVKVDKDKLINLLRTKALLCPGVKINLHDEKQETCKTF--HFENGVVGLIEEQPNFDQMPPDGLFH----TAIDFHFDDEKTSPGHVSLWCYFTETSLLSNSFVNVIPTPQSGTHVNALRSAIFDSINDYATAHELLKKKKFQLSTADVSSTFNFVLSLKMHDPDFAGQTKERLRMPSQKSSVLSRFKDAFVLWLNQNPTVSEAIVAMAVKKANK---RLREQEKIERKSLDGPMALPGKLVDCDSEDPMDSELFLVEGDSAGGSAKQARNRRNQAIMPLRGKIQNTWEVESDVVLSSDEISNIASAIGVDPGSE-DISGLRYGKICILADADSDGLHIASLLTCLFVKHFYPVVESGHLYMAMPPLYRIDIGKETFYALDEAEKDRIISEASRKGPYTQRFKGLGEMNPEQLDETTLNPASRRLIQIQIDDKESLMEHMDMLLAKRSGDRFNWLKDNGDK...... 634
217 0.000e+00UniRef50_A0A2E0RR15 DNA topoisomerase (ATP-hydrolyzing) n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E0RR15_9ACTN  ali  35  31.SNDMSTKSYDAAAISALSGLSHVRHRPLMYLGSVGVNGLHHLIWEIVDNSVDEAMAGHGSTITTTLHADGSVSVDDDGRGIPIDPMKEKGRSALEVVLTETNAGGKFDSDSYKVSGGLHGVGASVVTALSTKLEAEVRRGGKKERKEIVPGVPTGPITASGSIPKSKTGTTIRFWPDLSFHDDQGIPFDRISDRFRHKSFVHPGVTFVLVDERKKEHERFEWCSSGGVADLVTEMTADTSVMGQVV-----------SFQGEDGDVTVDAAMAWTVDGRDTSIGFANGVATPEGGTHVNGFRTAVTEAVQKYIADRELLKEKEGAPNTRDIFSAGLMVVSIMLPGPQFAGNSKSKLMNTEAAGKTRAIVLPAMSRWLEENPDSAKKIADLAISAMRKSNAEQAAVRALLGKGTKSRNGLPAKLRDCTHKTDRPTELLIVEGDSAGGTAIDARDPSFQAVLPLRGKPLNSYRESIERVVRS--LSDLILSMGCGIGEDFDLDKFRYGRIVVVADADTDGLHIRSLIKAFLYTWCPGFVESGRLFYALPPLWTTVHQGERIYLEDDAAKAAFLAENPKHKAHMGRLKGLGEMDAVELREVIGT--GRKIGRVTIDDPAGFAKLAEHLFGSKSELRKTW............. 677
218 0.000e+00UniRef50_A0A1E3Q8A7 DNA topoisomerase 2 n=102 Tax=Dikarya TaxID=451864 RepID=A0A1E3Q8A7_LIPST  ali  23  182.............TYQKLTQLEHILKRPDTYIGSIFVPGLYKIFDEILVNAADNKVRDPMDTLKVSIDKESTIVIYNNGRGIPIEMHENEKMYIPELIFGNLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTEFIVETADKKKKYKQVWTSNMGKVGKPKITENSKGDEYTKISFKPDLKLFGMTKLDDDLIGIMMRRVYDLAGSVRKVYLNNERLKVRNFKQYIEMHVNALSENITTKEEVDEKPAVNVVATAGPKPVVIQEIINDRWEIGFAVS-DGSFNQVSFVNSIATTSGGTHVNYVCDQIVNKLAENIKK----KNKSGNVKPQQIRNNIFLFVNCQIENPAFTSQTKEQLTTRPAAFGSKCILPDEFFKKIQRTSI-----IDNIMDIATRNADKELKKTDGSKRNRITGLVKLDDANKAGTKEGHKCTLILTEGDSAKALAVAGLSRDYYGVYPLRGKLLNVREASHDQIMKNAEIQAIKQIMGLQHKKHYTSTKLRYGHLMIFTDQDHDGSHIKGLLINFLESTFPGLLDPGFLIEFITPIVKVTKHKTIIPFYTMPEYEFWKEEGGNCIWKHKYYKGLGTSSSAEGREYFLDRHLKEFHAIQNGDRDLIDLAFSK---KKADERKEWLR........... 846
219 0.000e+00UniRef50_UPI000C1CF119 LOW QUALITY PROTEIN: DNA topoisomerase 2-like n=1 Tax=Olea europaea var. sylvestris TaxID=158386 RepID=UPI000C1CF119  ali  21  19..PETAAEKTIEQTYQKKXQLEHILLRPDTYIGSIYVPELYKFFDEILVNAADNKQRDPMNSLKVTIDAENCISVYNNGDGVPVEIHQEEGVYVPKLIFGHLLTRSNYDDHEKKTTGGRNGYGAKLTNIFSTEFIIETADGRRQHKQVFCGNMGNKTQPVISKCKDGENWTKATFKPDLAKFNMTHLEDDVIALMKKDMAGCLGKTVKVELNGEDIRVKSFGEYCNLY---------------------------LKYAFRIEEKVDRWEVCVSLS-DGQFQQVSFVNSISTIKGGTHVDYVTNQITNHLAEYV----NKXKKNANLKPHSVMNHLWVFVNCLIDNPPFDSQTKETLTLRQKNFGSECKLSDKFLSKVTNSEI-----VSNIMEWAEFKEKKDLKKTDGTKSKRISGLTKLADANDAGGRNSEKCTLIFTEGDLAATLAIAGLSRDHYGVFPLRGKLLNVRDAGTKQINDNAEIQNIKKILGLQHMVQYDSIKLRYGHLMIMTDQDHDGSHIKGLLINFIHSFWPSLLKIPFLVEFITPIVKATKNGEKRSFYTMPEYESWKESLGDRSWSIKYYKGLGTSTDKEGKEYFKDKHKKDFVWADDRDGEAIELAFSK---KKIEARKNWLRQF......... 656
220 0.000e+00UniRef50_A0A1V9ZH33 DNA topoisomerase II n=1 Tax=Thraustotheca clavata TaxID=74557 RepID=A0A1V9ZH33_9STRA  ali  22  23.TSSTRSGLTVEQIYQKKTQLEHILLRPDTYVGSTFCPGLYKIFDEIIVNACDNKQRDKMDTLKVTFDQEGAISVWNNGRGIPVVEHKEHKVYVPELIFGHLLTGSNFDDNKKKTTGGRNGYGAKLANIFSTEFIVETREDGKRYRQVFKKNMSVKEEPKITSWS-KKDFTCITFTPDFTRFQMTGLDSDIIALRVYDIAGVTDKSLSVYLNEEKIDVKTFPQYVEMY---------------------------NPQEVVFDKPDERWHVGIGISDDGFQQV-SFVNGICTTKGGQHVNYIADQIATKLSATIKK----KNKGDPVKPALIKNHLFIYMTALIDNPAFDSQTKETLTTRANAFGSTFTLSDKFLKQVEKSSLVERILS----FAKFKQTADLKKAAGGGKKKRLQGISKLDDANFAGSAKSHMCTLILTEGDSAKALAMSGLSRDYYGVFPLRGKLLNVREAAHSAIVKNEEVTNIVKILGLEYNKKYESTKLRYGHLMIMADQDHDGSHIKGLVINFIHNYWPSLLLESFVQEFITPIIKATKGNRVQVFYTMPEYETWRQSTNNRGWDIKYYKGLGTSTAKEAKEYFLNTHQIAFTYEKEKDDDAIELAFSK---KRIEDRKEWLRAF......... 660
221 0.000e+00UniRef50_U5H4T9 DNA topoisomerase 2 n=5 Tax=Microbotryomycetes TaxID=162481 RepID=U5H4T9_USTV1  ali  24  138.ATKKTKAKSASETYVKLSQLEHVLKRPDTYIGSTFVPGLYKIFDEILVNAADNKAKNAMSYIKVTINEDKKIVVENDGPGIPIEEHKTEKVWIPEMIFGTLLTSSNYDDEEEKVTGGRNGYGAKLANIYSTEFVVETSNDMKTYKQTFKNNMGTKGKPIVKDITKAQDYTRITFYPDLARFGMTEFDDDTVALLTKRVYDMAGIIKNVYLNGKKLSLKNFKQYVEMYTAAIEAASKPSTKKSGENEDMVESLDAGKKNSVIYGQFGQWEVAFALS-DGQFTQVSYCNSIATTKGGTHVNYIADQIVSGLVDLIKK----KNKAAPVKAFQIKNHLSVFINCKIPNPSFDSQTKENMTLSVSKFGFKCVLDDDFLKKVAR-----SGVIDNVLNWAKFKQDQMLKKTDGHKRSRITGLVKLEDANNAGTRNGSKCTLILTEGDSAKALAVSGLGRDNYGVFPLRGKLLNVREAAGKALLDNAEIQAIKQILGLQQGKVYDVDSLRYGKLMIMADQDHDGSHIKGLIINFLDYWFPSLLKKGFLLEFITPIVKATKGNKELSFFTIPQYEHWKETDDGRGWRIKYFKGLGTSDARDAVKYFMDKHRLPFRPSTQEERELIDMAFNKKKADN---RKEWLRGF......... 816
222 0.000e+00UniRef50_F0WKX4 DNA topoisomerase 2 n=14 Tax=Eukaryota TaxID=2759 RepID=F0WKX4_9STRA  ali  22  63.SKNASQKQTIEQIYQKKTQLQHILLRPDTYVGSTFVPGLYKIFDEIIVNACDNKQRDSMNTLRVTIDPTGEISVWNNGKGIPVVQHKEHEVYVPELIFGHLLTGSNFDDKKKKTTGGRNGYGAKLANIFSTKFIVETADKKKRYKQVFSDNMSQKESPAITSWN-KQDFTCITFRPDLKRFKMDRLDDDIVSLRVFDIAGVTDKSLQVYLNEEKITCKSFPDYISLYTGESAKE-----------------------DVIFDKPTERWQVGFGPSDDGFQQI-SFVNGICTTRGGQHVTYIADQVVNKLVAAVKKR----NKGEAVKPNYIKNMMTIYVSALIDNPAFDSQTKETLTTRPSSFGSTHSLSDKFLKQIEKSGIVERV---VSFAKFKQTAELQRKGAKGGNRSKLTGITKLDDANYAGTAEGRKCTLILTEGDSAKSLTIGGLSRDYYGVFPLKGKLLNVREASHSQILKNEEIQNVVKILGLKYGQVYESTKLRYGHLMIMADQDHDGSHIKGLVINFIHHFWPSLLQEGFMHEFITPIVKCAKGSKKEVFYTMPEYEAWLATNNGQGWRIKYYKGLGTSTTEEAKEYFSDLHQIDFSYKGEEDGDSIDMAFSK---KRVEERKNWLRGY......... 705
223 0.000e+00UniRef50_M5ALA2 DNA topoisomerase (ATP-hydrolyzing) n=1 Tax=Ilumatobacter coccineus YM16-304 TaxID=1313172 RepID=M5ALA2_9ACTN  ali  35  2....NTTNTYEADQIQALSGLSHVRARPLMYLGSVGVAGLHHLIWEIVDNSVDEAMAGHGDRIEATLHRDGSVSVTDNGRGVPVGKMPHKGRSALEVVLCETNAGGKFDSDSYKVSGGLHGVGASVVTALSSKVTAEVRRDGHVHRLVLEATVAVEPIHTVKKCPKSDTGTMIRFWPDLSSFDEPQWSMRIIADRFRHKSFVHPGVTFAVVDDREGAKEQFEWCSNGGVADLVAEMTEDTGLVAPVV-----------SFQGEDGDITLDAAIAWTVDGRDTSIGFANGVATPEGGTHINGFRTAVTESVQKYLVERDMLKDKEAPPNTRDIFAAGLMVASVMLPGPQFAGNSKSKLMNPEATSRTRAIVMPAMSRWLEENPEPAKKIADLAIASMRKSNAEQAAVRALLGKGNKSRNGLPAKLRDCTFKTDRPTELLLVEGESAGGTAIDARDPSFQAILPLRGKPLNSYRESISRVVKS--MADLILSMGCGIGDDFDLDKFRYDRIVVLADADDDGLHIRALILAFLYTWCPGLVESGRLFYALPPLWTTVHRGERIYLEDDAAMREWRADNPTHKAHMGRLKGLGEMDADELRSVMGND--RKIGMVDIDDPARLARLAERLFGSKSELRRTW............. 645
224 0.000e+00UniRef50_F5Y2W7 DNA topoisomerase 4 subunit B n=60 Tax=Proteobacteria TaxID=1224 RepID=F5Y2W7_RAMTT  ali  34  2.................LKGLEPVKQRPGMY---TRTDNPLHIVQEVLDNAADEALAGHGKRIKVTLHADGSVSVEDDGRGIPFGLHPEEKAPVIELVFTRLHAFDKGKGGAYSFSGGLHGVGVSVTNALAKRLEVTSHREGQVATLVFSGGDVIERLRLRKAGEGDRRGTTVRVWPDGKYFESSQLPMAELAHLLRSKAVLMPGVTVSLVNEKAKETQTWQ-----YKGGLRDYLMQTLTADPVIPLFEGEGFADSNETFAEGEGAQWCVA--FTEDGAPVRESYVNLIPTSAGGTHDSGLRDGLFNAVKSFIELHSLLP-KGVKLLPEDVFARASYVLSAKVLDPQFQGQIKERLNSRDAVRLVSSFVRPALELWLNQHVDYGRKLAELAIKAA---QTRQKAGQKVEKRKGSGVAVLPGKLTDCESRDIGHNEVFLVEGDSAGGSAKMGRDKECQAVLPLRGKVLNTWEVERDRLFANTEIHDIAVAIGVGPNDTPDLSGLRYGKVCILSDADVDGSHIQVLLLTLFFRHFPKLIDTGHVYVARPPLFRVDRGKKKQYALDEGELTAILDKLRKEGWSISRFKGLGEMSAEQLWETTLNPDTRRLLPVQLGDFSGTESLITKLMGKEAAARRELMELHGDAV-EIDI 640
225 0.000e+00UniRef50_A0A2N2PLG9 DNA topoisomerase (ATP-hydrolyzing) n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A2N2PLG9_9CHLR  ali  38  1MEFDSVTKQYSGEQIVELEFLDAVRRRPGMYIGNNNLHGLHHILLEVLDNSVDECMAGYASTITVTLEKDGTVEITDDGRGIPIEYKRENKMSTLTQVLIKPHAGGKFDDSAYSSSGGLHGIGLKCTNAFSSFLEVEVRRHGLIFYQRFENGGIPVTPVEIYTKPEQISGTTFRFRPNRAWFNTVPWDAERLSNRFRQIAHLYPGVRIEFTDKTNEDAEALVFFSKRGLTEYIEYLNEGEEPLHKPIVFKE---INELEVEGRKETIEVEVALQY-AGEEVQIYSFVNAIPTPSGGTHVSAFKAGLTKAVKQFATNKKLLKGNMDVRGDDALLGLTAIIKITMTCTPQFLSQTKESLTSPEVHGPVLSTTYAFVSDYLEKNIPTGKLIVNQAVAAARGREAASQARKLVIRKSAMDGEYVLGKLADIQRRGGNHTALYLVEGDSAGGSCKQGRDSRYHAILPLRGKIPNVEKMKINDILKNREIAAIIAAVGTGVGADCDVSGIRYGRISVLVDADVDGSHIATLLATLFYRTMRQIIDEGRFFVARPPLYLVTRSKETRYAYSEEEREEIEKEFGVKNVSIQRYKGLGEMNPDQLRETAGTPAERQLLRMTIEDIHNTRSVISRLMGTEVAPRKEWLMN.......... 730
226 0.000e+00UniRef50_I4EFV6 DNA gyrase subunit B n=3 Tax=Chloroflexi TaxID=200795 RepID=I4EFV6_9CHLR  ali  49  1.............................................................................................................................................................MERIGEIDPAFRGTTVTFLADSIIFQALSYNFDTLVQRFREMAYLTKGLMITARDERAQREMSF--YFDGGIVSYVRHLNRNKQVLQTRPFYVCR----------DVNGSQVEVALQYNDGYGESTHAFANNINTVDGGTHVSGFKAALTRTINDYARRNGFLKESDDNLGGEDVREGLTAIISVKLQEPQFEGQTKGKLGNADIAGIVQSVVNDALAAYLDENPQPARKIVEKCVTASRAREAARKARELVQRKGSLDTFSLPGKLADCSERDPSRAELYIVEGDSAGGSAKQGRDRRFQAILPLRGKILNVEKSRLDRMLQNEEIRVLVTALGTSIGDQFNPSKLRYHRVILMTDADVDGAHIRTLLLTFFFRHLESLIVDGRLYIAQPPLYRLQSGREVHYAYSDEERDQIMSAAGPKKWDIQRYKGLGEMNPEQLWQTTMDPQSRTLLQVTIEDAVRADETFDMLMGNAVPPRKRFIQTHAKEVQNLDV 482
227 0.000e+00UniRef50_A0A1J5WXU3 DNA topoisomerase 2 n=1 Tax=Amphiamblys sp. WSBS2006 TaxID=1866961 RepID=A0A1J5WXU3_9MICR  ali  21  1MSQNTKKNKTVEEMYQKKTQVEHILLRPDTYIGSTFVPGLFKIFDEILVNAADNKMRDRMTTIRVDVGKDGWVSVFNDGEGIPIQIHKEERVYIPELIFGHLLTSSNYNDEEKKMTGGRNGYGAKLCNIFSSEFVVETVDKKKKFRQVYTKNMSEKSEPEI-GPSSEKNYTKISFSPDFSKFGLEGIDSDHFLLFQKRAHDIAGCLPDVFFNGTRIEIGSFKEYVGLY---------------------FPAETDMETSTAYTKDGKRWEVCCAAS-EGQFQQVSFVNNINTYKGGTHISHVADKVIGEITTAIQKR-----KRTAVKAFQVKPHLFLFINCLIENPSFDSQTKENMSLKAGSFGSSFSVSDAFSKRL-----CTLPIIDNTLSWARFKQEQQLKKTDGQKRIRLTGIPKLDDANNAGTKDARDCTLILTEGDSAKALAIAGLGRANYGVFPLRGKLLNVREAMPKQLMENAEVNSIKKILGLQQKKEYTADSLRYGHVMIMTDQDHDGSHIKGLLINMLDYFWPSLLKPGFLLEFVTPIVRCTRRKEEAVFYTIPEYEAWKEETGETGWKVKYYKGLGTSTSEDAKKYFMGKNRKTFRAIREEERLLVDMAFNR---KKADERKEWLRGLTKDV-FLD. 646
228 0.000e+00UniRef50_C4YBE7 DNA topoisomerase 2 n=5 Tax=Eukaryota TaxID=2759 RepID=C4YBE7_CLAL4  ali  24  43...........SEQYQKLSQLEHILKRPDTYIGSTIVPGLYKIFDEILVNAADNKIRDPMKNIKVNVDPNNTISVMNDGRGIPVEIHTKEQMYIPEMIFGNLLTSSNYDDDQKKVTGGRNGFGAKLCNIFSTEFTVETADQGKLYIQTWTDNMSKVGKPKITKVKNKKEYTKVTFKPDLTKFNMDALDEDILAVLNRRVYDLCGTVCNIYLNEKKLAIRNFKGYVEMYVKAIQARS------------PQIAGDVTAPSIVYEQVNERWELAFAVS-DGNFNQVSFVNSIATTAGGTHVKYVTDQIIDKLLAELNKQEKGK-KKLMIKANQIKNHIFIFVNCLIENPAFTSQTKEQLTTRASQFASKQKDKVTITDQFIK-KILKTNIRETIQSIVDANEGKALSKDDGKRRTRIKDQAKLVDANKAGTKEGHKCTLILTEGDSAKSLAVAGIGRDYYGCFPLRGKLLNVRDASTEQIAKNAEITALKQIIGLQHRKHYNIKDLRYGHVMIMTDQDHDGSHIKGLLINFFESSFPGLLNPGFLLEFITPIVKVTIKGNVISFYSMPEFEEWRDTEGTNRWTHKYYKGLGTSTSVDAVEYFLDKHLKEFHALESDEPPLIELAFSK---KKADDRKEWLQGF......... 699
229 0.000e+00UniRef50_A0A015LQG0 DNA topoisomerase 2 n=11 Tax=Rhizophagus irregularis TaxID=588596 RepID=A0A015LQG0_9GLOM  ali  22  331....TQSKKPVEEVYQKKTQLEHILLRPDTYVGSTYVPGLYKIIDEILVNAADNKIRDPMDTIKVDIDESGKISIYNNGNGIPIEIHKEENVYVPELIFGHLLTSSNYNDNEKKVTGGRNGYGAKLTNIFSTEFIVETVDSGKKYRQVFKDNMSVKEPPKISSYSKKEEYTMITFKPDFQKFNMNEFDNDIVALLKKRVYDLAGCVRKVFLNGERLKIKNFKEYSQMYLSGNNDFVD------------------LQSSIIYEEVNQRWEIAFVPSPEGTFQQISFVNSISTSKGGTHVNYVADQIVEKFMAAVTKKAKDVKN---IKKHQIKNHMWLFINCLIENATFDSQTKECLTLKASSFGSKCNPSETYFNKLLKSNVIESILDDVKHK-----QSKELKKTDGRKTGRIMGIAKLDDANNAGGKKCQDCTLILTEGDSAKALAVAGFSRDNYGVFPLRGKLLNVRDGTHNQIMNNAEIQHIKQILGLKQGKVYTSTELRYGHLMIMTDQDHDGSHIKGLIINFLDYFFPSLLKPGFLMEFITPIVKCTRGNTKKSFFTLPEFASWLENNDNKGWKIKYYKGLGTSTAEEAKEYFKDLHKKPFKTIQEGERELIDMAFNK---KKADDRKEWLRNYNHNVKEITI 991
230 0.000e+00UniRef50_P08096 DNA topoisomerase 2 n=11 Tax=Eukaryota TaxID=2759 RepID=TOP2_SCHPO  ali  23  77.............QYQRLTPREHVLRRPDTYIGSTYVPGLYKIFDEIIVNAADNKVRDPMNTLKVTLDPENVISIYNNGKGIPIEIHDKEKIYIPELIFGNLLTSSNYDDNQKKVTGGRNGYGAKLCNIFSTEFVVETADKMKKYKQTWYDNMSRKSEPVITSLKKPDEYTKITFKPDLAKFGMDKIDDDMVSIIKRRIYDMAGTVRKVYLNNERISISGFKKYVEMYLASDTK------------------PDEEPPRVIYEHVNDRWDVAFAVS-DGQFKQVSFVNNISTIRGGTHVNYVANKIVDAIDEVVKKE----NKKAPVKAFQIKNYVQVFVNCQIENPSFDSQTKETLTTKVSAFGSQCTLSDKFLKAIKK-----SSVVEEVLKFATAKADQQLSKGDGGLRSRITGLTKLEDANKAGTKESHKCVLILTEGDSAKSLAVSGLSRDYYGVFPLRGKLLNVREASHSQILNNKEIQAIKKIMGFTHKKTYDVKGLRYGHLMIMTDQDHDGSHIKGLIINYLESSYPSLLQPGFLIQFITPIIKCTRGNQVQAFYTLPEYEYWKENNNGRGWKIKYYKGLGTSDHDDMKSYFLDRHMKYFHAMQEKDAELIEMAFAK---KKADVRKEWLRTY......... 710
231 0.000e+00UniRef50_H3G7M6 DNA topoisomerase 2 n=3 Tax=Eukaryota TaxID=2759 RepID=H3G7M6_PHYRM  ali  22  5..ESGTPKQSIEQIYQKKTQLEHILLRPDTYVGSIYVPGLYKIFDEIIVNACDNKQRDKMNTLKVTIDEENEISVWNNGKGIPIVLHKEHKVYVPELIFGHLLTGSNFDDKKKKTTGGRNGYGAKLANIFSNEFVVETADSKQKYKQVFENNMGKKNPPSITKWA-QKDFTCISFKPDLKRFKLDFLNDDIVSLRVYDVAGVSGKGMNVFLNGEKIPIKSFPQYVALYPG---------------PPAKAKPTNVTKNGVIFEKPDERWQVGVGLSDDGFQQV-SFVNGICTTKGGQHVAYIVDQITNKLVSVLKK----KNKGEAVKANYIKTHMVVYVSALIDNPAFDSQTKETLTTRPNGFGSTFSLSDKFLKQVEKS---GMVEKILSFAAFKQTAELRRKGGGGGKRARLSGIPKLDDANHAGTAKGKDCTLILTEGDSAKTVAVGGLGRDYYGVFPLRGKMLNVREASHSQILKNEEIQNVVKILGLKYGQKYESTKLRYGHLMIMADQDHDGSHIKGLVINLIHHFWPSLVVEGFLQEFITPIVKCTKGRTKEVFYTMPEYESWRERTNQRGWVIKYYKGLGTSTAAETKEYFSDLHQIGFTYEGDGDADVIDMAFSK---KRVEDRKDWLRGY......... 654
232 0.000e+00UniRef50_A0A139AAD1 DNA topoisomerase 2 n=9 Tax=cellular organisms TaxID=131567 RepID=A0A139AAD1_GONPR  ali  23  73.SPRKTGGKKDDRPIEQKTQLEHILLRPDTYIGSVYVPGLYKIFDEILVNAADNKIRDKMTFLKVDIDATNTISVFNNGKGIPIEIHPVEDVYVPELIFGHLLTSSNYDDSDKKVVGGRNGFGAKLCNIFSKEFIVETWDKGKKFKQTFRNNMADKSEPIIASNSSTE-GTKITFKPDFAKFGMVGIDDDLMGLLQKRVFDMCATVRKVYLNGQQIKCKDFKSYCELYLRNRQNIPDNNNKL------------------IYERVSDRWEIAFALS-DGQFQQMSFVNSISTYKGGTHVSYIADQVIKIVGEAVSKKN---KKGAQIKPHQIKQHLWIFINCLVENPTFDSQTKENMTLKVSAFGSKCSLPEDFTKKLMKSGI-----VESVLTFADGAASKQLKKTDGSKKARVSGITKLEDANNAGTRRAAECTLILTEGDSAKALAMAGLSRDNFGVFPLRGKLLNVREAGLKQIMENQEIQALKQILGLQQSAKYDSEKLRYGKIMLMTDQDHDGSHIKGLILNLLDHFWPSLLRPGFLQEFITPIVKVGKDRKQISFFTLPEYERWREDHGGKGWTAKYYKGLGTSTSQEAKEYFMTKHRKSFAPADDQSRELIDMAFGK---KRADDRKDWLRQF......... 723
233 0.000e+00UniRef50_A0A2R5FZT3 DNA topoisomerase 2 n=1 Tax=Aurantiochytrium sp. FCC1311 TaxID=2023137 RepID=A0A2R5FZT3_9STRA  ali  23  103...........SSKYQKKTQLEHIMLRPDTYIGSTYVPGLYKIFDEILVNASDNKQRDPMRNIKVTIDEDGSISVWNDGRGIPVEMHREHNVYIPELVFGHLLTGENFEDTQKRVVGGRNGYGAKLANIFSKEFSVETNDSGYRYKQTWTKNMSVKGEPVLKSATAKE-FTCVTFTPDYARFGMPDLDNDTISLRVYDVAGVTDKSVKVSLNGTPLKVTTFEQYIDLYLPKDVKDEPEDIDNDDDDDDEYSDDNWGPVRKIYERANERWEICIAPSPDGQMQQVSFVNGICTMKGGQHVNYVADQVATLLQPLLKKKS----KGSDLKPHQVKSHLWIFVNCLIENPAFDSQTKETLTTRHPKFG-PKKMLPQLSEKAVKQIEKTPIIDNILFWAKAKEMRELSRKAGGTKKSKIKDVEKLDDANNAGGRNSEKCTLILTEGDSAKTLAISGLSRDNYGVFPLRGKLLNVREASHSQIMKNEEIQNIMKIMGLQPGKNYDTKGLRYGHLMIMTDQDHDGSHIKGLLMNFIHHFWPSLLKPGFLQVFITPIVKATPRAEGRPFYTMPEYQNWLEALAPKRWKIKYYKGLGTSTAKEAKEYFINHHRIDMKWEGDEGGDALDMAFSKR---RVADRKQWLAKF......... 786
234 0.000e+00UniRef50_V8P300 DNA topoisomerase 2 (Fragment) n=7 Tax=Amniota TaxID=32524 RepID=V8P300_OPHHA  ali  21  58..ENSKKRLSVERIYQKKSQLEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDKMSCIKVTIDPNNTISVWNNGKGIPIVEHQVEKMYVPALIFGHLLTSSNYDDDEKKITGGRNGYGAKLCNIFSTKFTVETCKEYKKLFKQTWTENMTKAGETKLKHFVGEDFTCVTFQPDLSKFKMTVLDKDTVALMSRRAYDIAGSAISVFLNGKKLPVKGFRSYVNMYIKDKVDDTGNALKVIHEEV------------------NDRWEVCLTMSERGFQQV-SFVNSIATTKGGRHVDYVADQIVNKLIDVVKKKN---KGGVGVKPFQVKNHMWIFINSLIENPTFDSQTKENMTLQTKNFGSTCKFSEKFIKGAVGCGIVESILNWVKFKAQ----TQLNKKCSAVKHTRIKGIPKLDDANDAGSKNSVSCTLILTEGDSAKTLAVSG---------------LGVVGRDKFGIMENAEINNIIKIVGLQYKKNYDDESLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLKHRFLEEFITPIVKVSKNKEEIPFYSIPEFQEWKNNTNFKNWKIKYYKGLGTSTSKEAKEYFMTRHRIPFKYSGPEDDAAITLAFSK---KKVDDRKEWLTNFMEDRR.... 691
235 0.000e+00UniRef50_A0A258TRV9 DNA topoisomerase 4 subunit B n=4 Tax=Bacteria TaxID=2 RepID=A0A258TRV9_9PROT  ali  35  43.SSPNPLNQYNESSIRVLKGLEPVRARPGMYTR-TDTP--THIIQEVIDNAADEALAGYARTLSVKIHLDGSVSVEDDGRGIPVGPHPTEKEPTVVVVFTRLHAGGKFDKTAYAFSGGLHGVGVSVTNALSTRLAVTVKRDGEISSLEFANGGVAVPLAVTGKCAKKDTGTLVRAWPDASFFDSPRISLNEMERLLRAKAVLLPGVTVKLSIEREGQPDQEWTYPNGLPQYLNELLGGDVNPVETLIPPFGGERYADGEAGGFAKGEGAAWVFTWSEAGVGALESFVNLIHTAQGGTHEAGLKAGVFDAVKSFAEHHGLLPR-GVQLRQEDVCGRMSFVLSARILDPQFQGQVKEKLNSREAVKLVSAMVRDPFEVWLNSHVEHGKALAELAS---RAAAARLKSAQKVEKKKQSSVVVLPGKLSDASGSNPEDLEIFLVEGDSAGGSAKQARDRETQAILPLRGKVLNTWEVEPERLYANNEVHDIAVALGVEFNDSPDMSGLRYGKVVVMSDADVDGSHIQTLLLTLFFKHFPQLVEQGRIHIAQPPLYRVKKPMRRFYALDDDELRLVREGIKQEAIEVGRFKGLGEMNPEQLRETAMSPATRRVLRVTRAEMESAVAMFDMLMGKEASARREWME........... 699
236 0.000e+00UniRef50_A0A1E4TJ76 DNA topoisomerase 2 n=9 Tax=Dikarya TaxID=451864 RepID=A0A1E4TJ76_9ASCO  ali  23  5...TNGNKKTATETYQRLSQLEHILKRPDTYVGSVEPPGLYKIFDEILVNAADNKIRDPMTFIKVTIDQANTISITNNGNGIPVEIHQKEKMYIPELIFGNLLTSSNYDDNQEKVTGGRNGYGAKLCNIFSTEFTLETVDHGLKYHQVWANNMGTVNKPTITKGKSVKDYTQITFKPDLKLFSMQELDEDIISVMRRRVYDLAGTVRGVFLNGNRIKVSNFKSYTELYVKSLMETANEYGTGESSSVLPTDTESGEESKHDPKFPNRRWEIAFAVSKTG-FNQVSFVNSIATTSGGTHVNYIVDQLVTKIGDYIKK----KNKHGMLRPVQIKNSMFVFVNCLITNPSFTSQTKEQLTTKPSAFGSKCVLTDDYIKKVLRTDIVTDLVEMSNLTA-----EKQLKKTDGTKKSRITGIVKLDDANRAGTKDGHLCTLILTEGDSAMGLAVAGLGRDYYGVFPLRGKLLNVRDATPAQIMKNAEIQALKQIIGLQHKTHYDTKGLRYGHLMIMTDQDHDGSHIKGLIMNLLDAAFPGLLDPGFLLEFITPIVKVTRKETVIPFYNMPEFEHWRDTEGQTKWKHKYYKGLGTSQASEMREYFLDRHRREFETLRGNDRDLIDLAFNKRKAD---MRKEWLRTY......... 687
237 0.000e+00UniRef50_F8GHC2 DNA topoisomerase (ATP-hydrolyzing) n=10 Tax=Nitrosomonas TaxID=914 RepID=F8GHC2_NITSI  ali  33  1MTKQT----YDESSIRVLRKLEPIQLRPGMYTRTTDPT---HMVVEAIDNAVDEAMAGHAKNIEVTLYRDGSVAVADDGRGIPVGLHPEENIPTIQVVFQVIHSGGKFADSSYKFTGGLHGVGVSVTNALSTRLEVEVKREGKQHRIVFAGGEVIEPLTVIGTCGVRNTGTALRIWPNAKYFDSPLLHRGELEHLLRAKAMLLPGVKVLLNIETVTGFDVKEWHFEGGIAQYLDQMIAEDEPIAPAFCGEKYLAANESFSDGE--GVQWAMAWVAGSGGGE---SYVNLIPTLGGGTHEAGLRDVVFNSVRTFAEQHGLMQRN-VKLTAEDVWSKLRFVLALKMVDPSFSGQTKEKLSSREAIKLVAAAMKDTLDLWLNEHVAEATKIAEQAIKNAIDRGKTAKTVERRKGSGVAVMPGKLTD----SELTGLNAELFLVEGDSAGGSAKAGRDKETQAVLPLRGKGMNSWEVDQSQILANQEIHNIAVSLAIDPHKDVDMSALRYGKIIILSDADDDGSHIQALLLTLFFRHFPKIIQHGHVYIAKPPLFRVNKPPRKLYALDQVELDILEARLRQEGWTISRFKGLGEMDAVQLWETTLCPDTRRLVRIGLGDVAHAVGTFDTLMGKHASERKELITIHGNEVE.... 649
238 0.000e+00UniRef50_A0A2M8NDX5 DNA topoisomerase (ATP-hydrolyzing) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8NDX5_9CHLR  ali  34  2..SRTKQQNYTAKDLKKIAGVEAVRKNAGMYTDIESDDGHHHIFAEQLDNACDEVINGHASQVVVALESDDMISVLDNGRGMPVDINPDTGLSGVEMIFTELHAGGKFDKKNYNISGGLHGVGAAVTNAMSLWLEVTVYRDGKVWFQAFDRGIPRAPLKTVGSCPKKKRGTMVRFQVDPEMYDHPKFKVDRVRAMVQAKAILLDNCEIIF---RHSDGQEELFRYEHGLREYVYDLSASHFSSSEV------EKLAEMHYESGDEYNKLSFSVIFDSGEESTTRSFVNTIPTIHNGAHDSGFRKGFLKAVQKFAESRRLVGRNQI-VKEQDIFTGVTYAVSLFYEKTKFSSQTKEKLVNREAYNFVEGKTFDAVELWLNENFNNLQPWLQEIARRVAVRSRAESREERIELGESGTPTILPGKLTDCRIKDRSKAELFIVEGESAGGSAKQAIDRLYQAVLPLKGKPLNAEGKSVKDALASEEIRNIIIATGAGYGDECDPSKCRYGKIIWMTDADVDGSHIDCLGLTAQYRLQKPLIDAGLVYFAVTPLYRVAIGKDYYYALDEEERDKYIKEKKKRKASVTRFKGLGEMDPKQLREAVIDPRHRRLIQVNIENEEEFEKLIKQLMGNSAEARRKFLEEF......... 634
239 0.000e+00UniRef50_A0A1M3K0V5 DNA topoisomerase (ATP-hydrolyzing) n=4 Tax=Chloroflexi TaxID=200795 RepID=A0A1M3K0V5_9CHLR  ali  38  2......SKQYSSEQIVELEFLEAVRRRPGMYIGNNNLHGLHHILLEVLDNAVDECMAGYATKILVTIEKDGTVEIVDDGRGIPVDYKAETKMSTLTQVLVKPHAGGKFDSSAYSSSGGLHGIGLKCTNAFSTFLEVEVRRHGLIFYQRFEDGGIPVTPVEIYTHAIRENGTTFRFHPNPNPNSYVPWDSERLSTRFRQIAHLYPGVRIEFLDLRSKEEDPVIFYSKRGLIEYIEYLNEDAEPLHKPILFKEST---EIEAEGSKQSIEVEVAIQY-AGEETQIYSFVNAIPTPMGGTHVSAFKAGLTKAVKQFAANKKLLKGNMDVRGDDALLGLTAIIKLTMTSTPQFLSQTKESLTSPEVHGPVLSTTYNFISDFLEKNIPIGKLIVNQAVAAARGREAASQARKLVIRKSAMDGEYVLGKLADIQRRGGEHTALYLVEGDSAGGSCKQGRDSRYHAILPLRGKIPNVEKMKLNDILKNREIAAVIAAVGTGVGLDCDVSGMRYGRISVLVDADVDGSHIATLLATLFYRTMRPIIEEGKFFVARPPLYLVTRTKATQYAYTEEEREEIEKGWGGRSVTIQRYKGLGEMNPEQLRETTHLPAERILVRMVINDVHRTRSLIQRLMGTEVAPRKEWLMN.......... 724
240 0.000e+00UniRef50_H2Z114 DNA topoisomerase 2 n=31 Tax=Bilateria TaxID=33213 RepID=H2Z114_CIOSA  ali  21  7..........VERIYQKKSQLEHILLRPDTYIGSTYVPGLYKIFDEILVNAADNKQRDKMSTIKININPENLISVWNDGKGIPVVEHKVEKMYVPEMIFGHLLTSSNYNDEDKKVTGGRNGYGAKLCNIFSTKFKVETRDEKKIFSQVWSDNMSKTHERKI-KSYDKSDFTCVTFQPDLAKFHMESLDKDTVALLSRRAFDVAGSTHKVFLNGSKLPVKNFKEYVQLY------------------VAKLHDEGGDPLKIIHEQVNPRWEICLT-SSDKGFQQVSFVNGIATTKGGRHTDYVIDQVAKKLVEVVKRKN---KGGVEVKPFQIKNHCWLFVNCLIENPTFDSQTKENMTLQAKKFGSQCTLTEKFLKSASSSGIVDNIMNWVKFKAQSQ-----LQKKSAGKSNKLKGVPKLDDANDAGTKHSMDCTLILTEGDSAKTLAVSGLSVRDKGVFPLRGKLLNVRDASHKQIMDNAEINNIVKIMGLSFKKKYDSDDLRYGRIMIMTDQDHDGSHIKGLLINFFHSNWPKVLQRRMLEEFITPIVKVTKGSQVLCFYTIPEFEEWQASIDHPKWKVKYYKGLGTSTSKEAKSYFMTRHRIKFRYSGPDDDGCIDMAFNK---KRADDRKEWLTNFMERR..... 647
241 0.000e+00UniRef50_K7F361 DNA topoisomerase 2 n=25 Tax=Eukaryota TaxID=2759 RepID=K7F361_PELSI  ali  23  16..................................TFVPGLYKIFDEILVNAADNKQRDKMSCIKITIDPNNTISVWNNGKGIPIVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETCREYKKLFKQTWTDNMGKAGEMKLKHFDGEDYTCITFQPDLSKFKMTSLDKDIVALMSRRAYDIAGCAKKVFLNGKRLPVKGFRSYVDLYLKDKVDETGNALKVIH------------------EEASSRWEVCLTLSEKGFQQV-SFVNSIATTKGGRHVDYVADQIVNKLIEVVKKKN---KGGVGVKPFQVKNHMWVFVNSLIENPTFDSQTKENMTLQAKNFGSTCKLSEKFIKGAVSCGIVESILNWVKFKAQ----NQLNKKCSAVKHTRIKGIPKLDDANDAGSKNSTDCTLILTEGDSAKTLAVSGLGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKIVGLQYKKNYDDQELRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHRFLEEFITPIIKVSKNKQEFSFYSIPEFEEWKNNTNHKSWKTKYYKGLGTSTSKEAKEYFMARHRIGFKYSGPEDDAAISLAFSK---KKIEERKEWLTNFME....... 610
242 0.000e+00UniRef50_A0A1W5CS19 Dna topoisomerase ii n=4 Tax=leotiomyceta TaxID=716546 RepID=A0A1W5CS19_9LECA  ali  24  676..SKPKKGNGSSDQYQKLTQLEHIIKRPDTYIGSVFVPGLYKIFDEILVNAADNKQRDKMDTIKITIDEKGEISVLNNGRGIPIEIHDKENIYIPEMIFGHLLTSSNYDDEEQKVTGGRNGYGAKLCNVFSTEFTLETSDNKKRYKQTWTANMTRMGTASITANK-GDDFTKITFMPDFKKFKMDGMDDDFEALAKRRVYDLAGTTKKVYLNDKRIMVNNFKKYMEMYTKAIKRERGDEAANDSSDIIV-------------DTPDARWEIGFAVSDGTFQQV-SFVNSIATTSGGTHVNYIADQVCTKLLEIVKKKN---KGGAALKINQIRNHIFLFINCLIVNPAFTSQTKEQLTTKHSQFGSKCTVSDDFLKKIAKTEVVA-----NILHFAQQKADQILKKSDGNRRSQMDN-PKLTDANKAGTKDGYQCTLILTEGDSAKGLAMAGRSPDLFGVFPLRGKLLNVRDASVDQISKNAEIQNIKKFIGLKHKTDYDCKSLRYGHIMIMTDQDHDGSHIKGLLINFLQVQYPSLLKIPYLIEFITPIIKVFKGDKSRSFFTMPEYEAWKEEHKHEGWEHKYYKGLGTSTTEDAQVYFLDKHLKEFHAMQEHEPELIELAFSK---KKADERKEWLRQF-KPGTYLD. 1336
243 0.000e+00UniRef50_A0A251SJ39 DNA topoisomerase 2 n=1 Tax=Helianthus annuus TaxID=4232 RepID=A0A251SJ39_HELAN  ali  22  1MTTENQQKKTIEQTYQKKTQLEHILLRPDTYIGSIYVPGLYKIFDEILVNAADNKQRDPMDSVKVVINETNSISVYNNGDGIPVEVHQEEGVYVPEMIFGHLLTSSNYDDSVKKTTGGRNGYGAKLANIFSTEFTIETADGKRNYKQVFTNNMGKKSEPVITKCKNGENWTMVSFKPDLKKFGMECLEDDVVALMKKDLAGCLGKTVKVELNGKRVPPKTFEDYVKLYLQPSTDTL-----------------------RIYEKVNERWEICVSMADGHFEQV-SFVNNIATIKGGTHVDYITNQIANHLVTVVKKQ----NKHANIKAHNVKNYLWVFVNALIDNPAFDSQTKETLTIKHSSFGSTCELSLEFLKKVAKSDVVKRVMSWVQFKQQNDL------KKTDGNKRGKLNIPKLEEANFAATSNSDKCTLILTEGDSAKALAMSGLSQDYYGVFPLRGKLLNVREASPKQLQENAEIQNIKKILGLQHGKTYDNVKLRYGHLMIMADQDHDGSHIKGLLINFLHSFWPSLLKVPFVLEFITPIVKAKKTKNVISFYTMPEYENWKENLGHKEYKIKYYKGLGTSNGKEGAEYFLEKHKKDFVWADDEDGDAIELAFSK---KKIEARKNWLR........... 648
244 0.000e+00UniRef50_A0A2H9TQS3 DNA topoisomerase 2 (Fragment) n=1 Tax=Paramicrosporidium saccamoebae TaxID=1246581 RepID=A0A2H9TQS3_9FUNG  ali  22  517..........VEEIYQKKTQLEHILLRPDTYIGSVFVPGLFKIFDEILVNASDNKIRDPMDTLKVNIDREGSISIYNNGHGIPIEMHSKEKMYVPELIFGQLLTSSNYDDAEKKVTGGRNGYGAKLCNIFSKEFIVETANSNKTYRQVFSDNMSKRGAPELKKG-GKEDFTQITFKPDLSKFGMSSLDDDIVALLERRVYDIAGCVRKVYLNGERLPVKSFKEYVQLFTPK------------------PEMGTLPSAPVVHEKVNDRWEVCVTVS-DGSFQHMSFVNSICTYKGGAHVSYITDQLTSALQDMIKKKNKDL---TALKPLQIKNHLSVFVNCLIENPSFDSQTKEFMTLRASAFGSKCVLGDGFMKKVA-----ACGVVENVMQFAKFKQNQQLKKTDGAKRNRLSGIAKLDDANNAGTKNASKCTLIITEGDSAKALAVSGLGRDNYGVFPLRGKLLNVREATHKQILENQEINYLKQILGLQHGQVYTSVSLRYGSLMIMTDQDHDGSHIKGLVINFLEHFFPSLLKPGFLVEFITPIVKASKGREEIVFYTIPEYETWKEAHNNGRGW----TGLGTSTAADARKYFMDRHRKVFAPIKEEERQLVDMAFNK---KRTDDRKEWLKT.......... 1147
245 0.000e+00UniRef50_A0A2N2XF02 DNA topoisomerase (ATP-hydrolyzing) (Fragment) n=9 Tax=Bacteria TaxID=2 RepID=A0A2N2XF02_9BACT  ali  47  1.....................................RGLHHLVYEVVDNSIDEALAGHCDTITVFINEDNSISVEDNGRGIPVDIHKKEGVSALEVVMTKIGAGGKFDKDSYKVSGGLHGVGVSCVNALSDHLRATVFRDGKIYEQEYERGKAMY--PVKQIGETTKRGTMVTFKPDTTIFTTIEFSYDTLAARMRELSFLNKGITITMCDKRHLDDKTETFHSKEGLKEFVKFLDGNREPIISHVI----------SMDNEKGEIPVEVALVYNTSYSENIFSYVNNINTHEGGTHLQGFRMGLTRTLKKYADSSGLLDKLKFEISGDDFREGLTAIISVKVQEPQFEGQTKTKLGNREVVSPVSQSVAEMLENYLEENPNDAKIIVQKVILAAQARHAAKKAREMVQRKTVLGGGGLPGKLSDCSEQDPEKCEIFLVEGDSAGGTAKQGRDRAFQAILPLRGKILNVEKAMHHKVFENEEIRNIFTALGVTIGTNEDSEKLRYHKVVIMCDADVDGSHISTLILTFFFRFMKELIEGGHVYIATPPLY................................................................................................... 512
246 0.000e+00UniRef50_L8GML2 DNA topoisomerase 2 n=1 Tax=Acanthamoeba castellanii str. Neff TaxID=1257118 RepID=L8GML2_ACACA  ali  22  43..PKSYDGKTIEQIYQKKTPLEHVLLRPDTYVGSIYVPGLYKIFDEILVNAADNFQRDKMDKIQVTINADNTISVWNNGQGIPVELHAEEKMHVPELIFGHLLTSSNYDDDMNKVTGGRNGYGAKLANIFSKHFSVECLDRKRKFFMEWEHNMTKRHEPVIKSTATKNDYTQVSFTPDLKRFNMKSFDKDIIALRVYDIAGCNPKL-KVYLNEQLIKISSFEKYVELYF------------------------EKKDVPHVFQQINDRWSVCVALSSSGQFQQVSFVNSICTTKGGTHVKYVTDKLTKELTPIINKKN---KGGAEIKGHQIKNYIWVFVNSLIVNPAFDSQTKETLTSQASKFGSKC----EIPTDFVNKVVKKCAIVENVVQFAQFKQKQQLGRKGGSKKTRVSGIVKLDDANEAGGKNADKCTLILTEGDSAKTLAVSGLSRDRYGVFPLKGKPLNVREATHKQIMDNVEFGHIMEILGLKPNIKYESTKLRYGRLMIMTDQDHDGSHIKGLVINFVHHFWPDLLKPGFLTEFITPIVKATKKKETISFYTMTEYETWKEENNNQGWKIKYYKGLGTSSAQEAKEYFLQRHKIDFAWGGDEDGDAIDMAFSK---KRVEDRKTWISKF......... 683
247 0.000e+00UniRef50_A0A1R4ABM6 DNA topoisomerase 2 n=1 Tax=Babesia microti (strain RI) TaxID=1133968 RepID=A0A1R4ABM6_BABMR  ali  40  56.......NSYGSEDILVLQGLDAVRKRPGMYIGDTGTYGLHHLLFEVIDNSIDEHMAGACTKINITLFPNGSIEVEDNGRGIPVDICSQTNKSALETVLTMLHSGGKFVDSDYKFSSGLHGVGLSVVNALCEFLEVTVKRNGKSYIIKLSRGNVVSDLKIDRKCKN--TGTKIVFKPDYRDIFVKNYDADIIVKRLRELSFLNPKLQINLIDNRNDGEKV-TFHSKNGLKDFLQYLMKDNVPIHKQASYIGINETIGGIQVNAAIGWAQD-------SYSTNILSFANNINTLEGGSHIDGFKTAVTKCVNASFKRAGYLKDKLPLYSGEHIREGIYAIVSVKLMNAEFQGQTKTKLGNAEARSAVEKAVMTELSRIFDKQSSLLNALFKKVHATKQANDAAKLTKDMIRDKSSLIASALPTKLSDCTMNDCEKTELFIVEGESAAGNAKQARNRNFQAILPLRGKIMNIEKVSKDRLIENVEIKNLLTAIGIQCDPNKSQNHPRYGKIILLTDADVDGTHLRVLLLGLIFRLCPSLYTNGRVYAACPPLYRVSNAKNEYYLWDESQLEEELSEGKYKNVIIQRFKGLGEMMAHQLWSTTMNPDTRILNKITVSDAKQASDMLELLMGNDIQARKNYIFDHAENIGDLD. 750
248 0.000e+00UniRef50_A0A146VKT1 DNA topoisomerase 2 n=9 Tax=Bilateria TaxID=33213 RepID=A0A146VKT1_FUNHE  ali  21  17.AKKDPKRLSVEKIYQKKTQLEHILLRPDTYIGSTFVPGLYKIFDEILVNAADNKQRDKMSCIRVNIDENNTISVWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYNDDQKKVTGGRNGYGAKLCNIFSKKFTVETCKESRKVFKQTWYDNMGRAGDTCIKPFEGEEYTCITFRPDLSKFKMSVLDKDTVALMTRRAYDIAGSTKKVFFNNKRLPVTGFRSYVDMYVKDKVDELGGALTVVHEVV------------------NDRWEVCLTMSEKGFQQV-SFVNSIATTKGGRHIDYVADQVVGKLIEVVKKKNKAG---VAVKPFQVKNHMWLFVNCLIENPTFDSQTKENMTLQQKSFGSTCPLTDKFIKQATGCGIVESIMNWVKFKAQC----QLNKKCSAVKHSKIKGVPKLDDANDAGGKNSIGCTLILTEGDSAKTLAVSGLGRDRYGVFPLRGKMLNVREASHKQIMENAEINNIIKILGLQYKKNYSDPSLRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFLEEFITPIIKASFKKTQLSFYSIPEFDAWKEQANHKSWKIKYYKGLGTSTSQEAKEYFMQRHRIPFKYAGPEDDEAITLAFS.......................... 650
249 0.000e+00UniRef50_A0A0H4W3S7 DNA topoisomerase 4 subunit B n=1995 Tax=root TaxID=1 RepID=A0A0H4W3S7_9BORD  ali  36  1.............................MY---TRTENPLHIVQEVIDNAADEALAGHGKQIQVTLHADGSISVEDDGRGIPVGLHPEENAPVVELVFTRLHAGGKFDKQAYAFSGGLHGVGVSVTNALAKRLEVVVWREGGVHRLVFSGGEVIEALAPYPEGGRKKSGTRVRVWPDPKYFDSPNIPMGELTHLLRSKAVLLSGVKVVLVNEKTGDSKTWQY--QEGLRGYLSEALGGAELMVP-FFEGEQYAGADHESFAEGEGAQWVVA--WTEDGNVVRESYVNLIPTPAGGTHESGLREGLFGAVKSFAELHSLLP-KGVKLLPEDVFARASFVLSAKVLDPQFQGQIKERLNSRDAVRLVGGFAKSALDLWLHSNVEYGKKLAELAIRQAQARARSAQKVEK---RKSSGVAVLPGKLTDCEASDASRTEVFLVEGDSAGGSAKMGRDKEFQAILPLRGKVLNSWEVDRDRLFANNEIHDISVAIGVGPNDTPDLSGLRYGRICILSDADVDGSHIQVLLLTLFFRHFPRLVEAGHVYVARPPLYRLKRPARKIYCLDDGELEAAQDKLRKEGWSVSRFKGLGEMNPEQLWETTMNPDTRRLLPVGYGDLSPSDRMFDMLMGKESAQRRAWIEEKG-NLAELDI 628
250 0.000e+00UniRef50_A0A0P6XBV8 DNA topoisomerase (ATP-hydrolyzing) n=1 Tax=Levilinea saccharolytica TaxID=229921 RepID=A0A0P6XBV8_9CHLR  ali  36  1......MVKYSADQIIELEFLEAVRRRPGMYIGNNNTHGLHHILLEVVDNAVDECMAGYADLIRVTIFRDGTVTVEDNGRGIPIDFKAESGMSAMTQVLLKPHAGGKFDESAYSSSGGLHGIGLKCTNAFSSLLQVESRRHGLAFRQVFSRKEMATALEVKGKKVPVQTITGQRSGFSLTFRPNRAWDAERLDTRFRQIAHLYPGVRIEFHDQRDVRSEPRVYFSKNGLVDYIAYLNEGLDPLHKPILFRDKSEIDTESG---KQTVEIEVAIQY-AGEETQIYSFVNAIPTPLGGTHVTAFKAGLTKAVKQFAVSKKLFKGEEDVRGDDALLGLTAIVKVTMTGTPQFLSQTKESLTSPEVHGPVLSGTYNYMSDYLEKNIPIGKVIVNQAVAAARGREAATQARRLVIKKSAMDGEYVLGKLADIQRRGGEHTALYLVEGDSAGGSCKQGRDSRYHAILPLRGKIPNVEKMNINEILKNREIAAIIAAVGSGVGADCDISSMRYGRISVLVDADVDGSHIATLLATLFWRTMRPVIEQGRFFVARPPLYLLRKTKEERYAYTETERADCEQEWKSQNYTIQRYKGLGEMNPEQLRETFMDFSQRDL-RMVIEDVHRTRSLIERLMGSEVGPRKDWLMN.......... 712
251 0.000e+00UniRef50_Q4S4N6 DNA topoisomerase 2 (Fragment) n=3 Tax=Bilateria TaxID=33213 RepID=Q4S4N6_TETNG  ali  22  12.TKKDPKRLSVERIYQKKTQLEHILLRPDSYIGSTFVPGLYKIFDEILVNAADNKQRDKMSCIKVSIDENNTIVIWNNGKGIPVVEHKVEKVYVPALIFGQLLTSSNYDDDEKKVTGGRNGYGAKLCNIFSTKFTVETCKESKKTFKQTWYDNMGRAGDANIRSFDGEEYTCITFRPDLAKFKMSILDKDTVALMTRRAYDIAGCCGFTCVDRWCHRKGEFTTSEKMCMIVFIFQVTGFRSYVDLYVKDKVDEMGNALNVVHEVVNERWEVCLTMSEKGFQQV-SFVNSIATTKGGRHVDYVADQVVSKLIEVVKKKNKAG---VAVKPFQVKNHMWLFVNCLVENPTFDSQTKENMTLQQKSFGSTCPLSDKFIKQATASGIVESIMNWVKFKAQ----SQLNKKCSAVKHTKIKGVPKLDDANDAGGKNSIGCTLILTEGDSAKTLAVSGLGRDRYGVFPLRGKMLNVREASLKQIMENAEINNIIKILGLQYKKNYSDPELRYGKIMIMTDQDQDGSHIKGLLINFIHHNWPSLLRHNFIEEFITPIIKASHKKTQLSFYSIPEFSAWKEQANHKSWKIKYYKGLGTSTSQEAKEYFMQRHRIPFKYAGPEDDEAITLAFSK---KKVEERKEWLTKFMINRR.... 712
252 0.000e+00UniRef50_UPI0007D88A24 DNA topoisomerase 2 n=2 Tax=Holometabola TaxID=33392 RepID=UPI0007D88A24  ali  24  31..DNSAKKKTIEGIYQKKSQLEHILLRPDTYIGSVYVPGLYKIFDEILVNAADNKQRDPMDTIKIEINENNIISVWNNGKGIPVVIHKEENMYVPTMIFGHLLTSSNYDDEEEKVTGGRNGYGAKLCNIFSHRFTVETSKEYKKCLKQTWSNNMGSASEPRIKDFSGEDFTKVIFSPDLSKFKMQSLDDDIIALMSRRAYDIAASTRKVFLNGTKIPVKNFKDYVDFYIKGREDDVGN------------------PLKIVYENCGPRWEVAIALSDKGFQQM-SFVNSIATTKGGRHVDHVTELIVKQLTETLKKKNKAG---VTIKPFQIKNHLWIFINCLINNPTFDSQTKENMTLQPKSFGSKCTLSEKFITSVTKIGIVEAVLTWAKFKA----DSQLQKLGPKSKQRKLQGIPKLEDANDAGTNKSLECTLILTEGDSAKTMAVSGLGR