current user: public

If you have questions about the server, please let us know.

Query: gi|15607149|ref|NP_214521.1| hypothetical protein (Rv0007) [Mycobacterium tuberculosis H37Rv], from M.tuberculosis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst MTAPNEPGALSKGDGPNADGLVDRGGAHRAATGPGRIPDAGDPPPWQRAATRQSQAGHRQPPPVSHPEGRPTNPPAAADARLNRFISGASAPVTGPAAAVRTPQPDPDASLGCGDGSPAEAYASELPDLSGPTPRAPQRNPAPARPAEGGAGSRGDSAAGSSGGRSITAESRDARVQLSARRSRGPVRASMQIRRIDPWSTLKVSLLLSVALFFVWMITVAFLYLVLGGMGVWAKLNSNVGDLLNNASGSSAELVSSGTIFGGAFLIGLVNIVLMTALATIGAFVYNLITDLIGGIEVTLADRDLast
1 -11.300IDP91949 pneumococcal histidine triad protein E [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100007099 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  10  803ILEKENQTDKPSILPQFKRNKAQENSKLDEKVEEPKTSEKVEKEKLSETGNSTSNSTLEEVPTVDPVQEKVAKFAESYGMKLENVLFNMDGTIELYLPSGEVIKKNMADFTGEAPQGNGENKPSENGKVSTGTVENQPTENKPDSLPEAPNEKPVKPENSTDNGMLNPEGNVGSDPMLDPALEEAPAVDPVQEKLEKFTASYGLG----------------------------------LDSVIFNMDGTIELRLPSGEVI-------------------------NL-SDLIA.......... 1039
2 -9.450IDP91521 C2 domain-containing protein [Toxoplasma gondii ME49] TGME49_040910 [Toxoplasma gondii ME49]  ali follow..  1779.DFAETRAKADALRARLQAAQARLAAARETEVSSSETESSETSEASFLSSDGEWDALWQSQRAAAMERQQRLQKMVSGVKAAYRRLEEENTRLAATRRRDDKLQRQVEAERERAVELLKEATRRAKEEKDLIARQPPPARDWSDTVVLSTPQIFVNSQAACAPFADSGRDEGGRDEWYEVSDACSRRAESSNESRTTAGAKLRQQ--LDLA............................................................................................. 1987
3 -8.470IDP06427 gene: B21R; B21R [Monkeypox virus Zaire-96-I-16] NP_536609 [Monkeypox virus Zaire-96-I-16]  ali follow..  10  624.KPDPLYSTVKKTTKSLSTGVDIVTKQSDYSLLPDVNTGSSIVSPLTRKGATRRRPRRPTNDGLQSPNPPLRNPLPQHDDYSPPQVHRPPTLPPKPVQNPTQLPPRPVGQLPPPIDQPDKGFSKFVSPRRCRRASSGVICGMIQSKPNDDTYSLLQRPKIEPEYAEVGNGIPKNNVPVIGNKHSKKYTSTMSSTKFDKSTAFGAAMLLTGQQAISQQTRSTTL-QMSKEEKIFEAVTMSLSTI-------GSTLTSAGMTGGPKLMIAGMAITAITGIIDTIKDIYYMFNNKMG-TLIYIAYRN 956
4 -6.520IDP91524 hypothetical protein TGME49_046110 [Toxoplasma gondii ME49] TGME49_046110 [Toxoplasma gondii ME49]  ali follow..  2..SYFSARGPAKTLPFTPPHGLPPAPLSAPSQRAVPPGSKGILVRPMGVVRARQNLTSVLPGSPAIQPLTWAGGRGEDGEVLPQASPSAPTQRPSTSVVPAVTSRPAAPCPSAYGPGSPGATELSGGTNATALVRAGTIQELSAHQSGKHFDVSPPVPLQEGNHFARGQNGSNLYMSKKPCPALSSPVLKSKMDLLQ--NSVRTLLLKCKEKGEVAIMSNATIHRTVNELRI-TALVQMLLDFAGRHANQKLSVMTIGSQFGRDSHPKCIKYVVTKQTAIFIELLDQFADD--SGTYLMEQDS. 376
5 -6.340IDP04070 gene: sdhD; succinate dehydrogenase hydrophobic membrane anchor protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0073 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  7..........................................................................................................................................................................................AVISLTSSGIKDFFVQRVTAVIIAVYFGYLILEALYL------------------------HIGALNYDSWRGLFTDGMFFRVATLMAYLAMAWVG--IWIICGDYIKFAWASAL... 99
6 -6.190IDP06012 membrane-attack complex / perforin domain-containing protein [Toxoplasma gondii ME49] EEB00555 [Toxoplasma gondii ME49]  ali follow..  3LSAIGGIGPTESRLQHIPFSTTRYLPIRSHVLQSTVERIESPEALNEVPTKVERNEFTEKGDKTEQVLTAQADHKSLLEGRSVRLESTSTAPDDDFDFLFEDDTPKKPKSRVNKGTSSDETSPGDRSSGEGSSDSDSLLSVVHRTKGNATQANKNQTRITHPKSKAQHQKKVTKKQGIPGSDSLGTSSAD.................................................................................................................. 192
7 -6.110IDP91728 gene: BIN1; myc box-dependent-interacting protein 1 isoform 1 [Homo sapiens] NP_647593 [Homo sapiens]  ali follow..  12  303.SPAATPEIRVNHEPEPAGGATPGATLPKSPSQLRKGPPVPPPPKHTPSKEVKQEQILSLFEDTFVPEISVTTPSQFEAPGPFSEQASLLDLDFDPLPPVTSPVKAPTPSGQSIPWDLWEPTESPAGSLPSGEPSAAEGTFAVSWPSQTAEPGPAQPAEASEVAGGTQPAAGAQEPGETAASEAASSSLPAVVVETFPATVNGTV---DLPPGFMFKVQAQHDYTATDT----DELQLKAGDVVLVIPFQNPEEQDEGWLMGVK--------------KCRGVFPENFTERV............ 592
8 -6.080IDP90138 ankyrin-like protein [Monkeypox virus] MPXV_ZAI1979_005_181 [Monkeypox virus]  ali follow..  13  5.................................................................................................................................................................................................SRVKQWDTLNGIMMVCVGTGLRFMINNQIMYDIINSVAIILANERYRSAFNDDRIYIRRTMMDKLYEYASLTTIGTI----------TGGVCYYLLMHLVS.......... 116
9 -6.080CPX_91661_91743 Complex of CCL21_HUMAN with VA41_VACCW [Undefined organism]  ali follow..  10  91.........................................................................DKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGPXMYSLVFVILMCIPFSFQTVYDDKSVCDSDNKEYMGIEVYVEATLDEPLRQTTCESKIHKYGASVSNGGLNISAKFASLDPWTTEPINSMTHDDLVKLTEECIVDIYL-VDKTKDFMKTNGN-RDFKTVPPSNVGSMIELQS---------CVNDV------TTYVKIYDECGNIKQHSIPTLRD.. 334
10 -6.080IDP92137 DNA gyrase subunit B, putative [Toxoplasma gondii ME49] TGME49_097780 [Toxoplasma gondii ME49]  ali follow..  11  28..SPAGASPPLSSQPSSPETTSSLSSSSRSSSSRSSSPRSSSSSRSSSSSRSSSSRSSSRSSSSRSSSRSSSSSWSSTLCQAVWIPRSCSL-PKSPLFPPPFSHSLSSSPSLSSLSSSLSSRSSSFDPALLPSSSPPVPSASSGSTSLLSLPSPAVYASLPSYAFSAFSPSSSPSSPSPSSSPSSSRSFASPSSAYTSDSIRVLEGLEPVRM-YIGSTDSEGLHHL-----VWEAIDNAVDEVENGHADRRVTVADDGRGIPCDV-LSALETVF-TKLHAGGKF-YAFAGGLHGGSSVV..... 374

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 8 9 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.