current user: public

If you have questions about the server, please let us know.

Query: gi|15607157|ref|NP_214529.1| transmembrane serine/threonine-protein kinase A PKNA (protein kinase A) (STPK A) (Rv0015c) [Mycobacterium tuberculosis H37Rv], from M.tuberculosis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MSPRVGVTLSGRYRLQRLIATGGMGQVWEAVDNRLGRRVAVKVLKSEFSSDPEFIERFRAEARTTAMLNHPGIASVHDYGESQMNGEGRTAYLVMELVNGEPLNSVLKRTGRLSLRHALDMLEQTGRALQIAHAAGLVHRDVKPGNILITPTGQVKITDFGIAKAVDAAPVTQTGMVMGTAQYIAPEQALGHDASPASDVYSLGVVGYEAVSGKRPFAGDGALTVAMKHIKEPPPPLPPDLPPNVRELIEITLVKNPAMRYRSGGPFADAVAAVRAGRRPPRPSQTPPPGRAAPAAIPSGTTARVAANSAGRTAASRRSRPATGGHRPPRRTFSSGQRALLWAAGVLGALAIIIAVLLVIKAPGDNSPQQAPTPTVTTTGNPPASNTGGTDASPRLNWTERGETRHSGLQSWVVPPTPHSRASLARYEIAQLast
1 -101.000IDP06302 serine/threonine protein kinase [Streptococcus pneumoniae TIGR4] NP_346168 [Streptococcus pneumoniae TIGR4]  ali follow..  28  3...QIGKIFAGRYRIVKQIGRGGMADVYLAKDLILDEEVAVKVLRTNYQTDPIAVARFQREARAMADLDHPHIVRITDIGE-----EDGQQYLAMEYVAGLDLKRYIKEHYPLSNEEAVRIMGQILLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLSPEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQKPLPSENPSVPQALENVIIKATAKKLTNRYRSVSEMYVDLSSSLSYNRRNESKLIDETSKADTKTLPKVSQSTLTSIPKVQAQTEHKSIKNPSQAVTEETYQPQAPKKHRFKMRYLILLASLVLVAASLIWILSRTPATIAIPDVAGQTVAEAKATLKKANFEIGEEKTEASEKVEEGRIIRTDPGAGTGRKEGTK.... 426
2 -51.000CPX_91699_91671 Complex of E2AK2_HUMAN with VK03_VACCC [Undefined organism]  ali follow..  22  265..........MDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYN--------EKAEREVKALAKLDHVNIVHYNGCSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTR--SKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLH--VCDTAFETSKFFTDLRDGI---ISDIFDKKEKTLLQKLLSKKPEDR-PNTSEILR.................................................................................................................................................................. 534
3 -49.400IDP91699 gene: EIF2AK2; interferon-induced, double-stranded RNA-activated protein kinase isoform a [Homo sapiens] NP_002750 [Homo sapiens]  ali follow..  22  265..........MDFKEIELIGSGGFGQVFKAKHRIDGKTYVIKRVKYN--------EKAEREVKALAKLDHVNIVHYNGCSKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNIFLVDTKQVKIGDFGLVTSLKNDGKRTR--SKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLH--VCDTAFETSKFFTDLRDGI---ISDIFDKKEKTLLQKLLSKKPEDR-PNTSEILR.................................................................................................................................................................. 534
4 -44.800IDP91729 gene: MAP2K7; dual specificity mitogen-activated protein kinase kinase 7 [Homo sapiens] NP_660186 [Homo sapiens]  ali follow..  24  118..........NDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMR--RSGNKEENKRILMDLDVVKSHDCPYIVQCFGT-------TNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTR--SAGCAAYMAPEDPTKPDYDIRADVWSLGISLVELATGQFPYKNKTDFEVLTKVLQEEPPLLPGHFSGDFQSFVKDCLTKDHRKR-PKYNKLLE.................................................................................................................................................................. 376
5 -41.100IDP90949 gene: MAPK14; mitogen-activated protein kinase 14 isoform 2 ZZZ_0019 [Homo sapiens]  ali follow..  28  20........VPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPF-QSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEENDVYLVTHLMG-ADLNNIVKCQ-KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDD---EMTGYVA-TRWYRAPEIMLNMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHID-ARNYIQSLTANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHA................................................................................................................................................................. 306
6 -40.300IDP91697 gene: LYN; tyrosine-protein kinase Lyn isoform A [Homo sapiens] NP_002341 [Homo sapiens]  ali follow..  21  245..........ESIKLVKRLGAGQFGEVWMGY----STKVAVKTLKPGTMSVQAFLE----EANLMKTLQHDKLVRLYAV------TREEPIYIITEYMAKGSLLDFLKSDEKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEER-PTFDYLQSVLDDFYTATEGQ...................................................................................................................................................... 507
7 -38.500IDP91686 gene: MET; hepatocyte growth factor receptor isoform b precursor [Homo sapiens] NP_000236 [Homo sapiens]  ali follow..  16 1077...........IVHFNEVIGRGHFGCVYHGTLLDNDGHCAVKSLNRITDIGE--VSQFLTEGIIMKDFSHPNVLSLLGI----CLRSEGSPLVVLPYMKHGDLRNFIRNTHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAVKWMALESLQTQKFTTKSDVWSFGVLLWELMTGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMR-PSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETS........................................................................................................... 1390
8 -38.500IDP90950 gene: MAPK-1; mitogen-activated protein kinase 1 ZZZ_0018 [Toxoplasma gondii]  ali follow..  25  73........VPTRLKFVKKVGSGAYGCVASFEDSGTNKKVAVKKIGDLF-RDLIDAKRIYREIKILKELKHENIINLVEILDPLTPDFEDI-YLVSDLMD-TDLHRVIYSRQPLTPEHHQYFLYQLLLGLSFLHQADIIHRDLKPSNILVNLNCDIKICDFGLARGLNMNPAPPPNLLVVTRWYRPPEILISFCYSKPVDLWSVGCIFAELLGRRALFAGKDHFD-ARRFIESLPEDLFPDASKAALDLLSNLLTFDPAKRITVQEALRHE................................................................................................................................................................. 502
9 -36.500IDP90192 gene: CPXV196 CDS; CPXV196 protein AAM13635.1 [Cowpox virus (Brighton Red)]  ali follow..  18  7...VLTDNCKNQWVVGPLIGKGGFGSIYTTND----NNYVVKI-NGSLFTEQAFYTRVLKEWKKTRHIKHVGVITCKAFGLYK-SINVEYRFLVINRL-GADLDAVIRANNRLPKRSVMLVGIEILNTIQFMHEQGYSHGDIKASNIVLMDKNKLYLVDYGLVSKFMSNG-NPNRMDNGTLEFTPIDSHKGYVVSRRGDLETLGYCMIRWLGGILPWTKALVSATKQKYVNNTATLL-QYAPRELLQYIVNSLTYFEEPNYDEFRRVLMNG................................................................................................................................................................ 297
10 -35.900IDP90136 ser/thr kinase [Monkeypox virus] MPXV_ZAI1979_005_177 [Monkeypox virus]  ali follow..  17  7...VLIDNCKNQWVVGPLIGKGGFGSIYTTNDN----NYVVKIEPKALFTEQAFYTRVLKEWKKSHNIKHVGLITCKAFGLYK-SINVEYRFLVINRL-GADLDAVIRANNRLPERSVMLIGIEILNTIQFMHEQGYSHGDIKASNIVLIDKNKLYLVDYGLVSKFMSNIRNPNKMDNGTLEFTPIDSHKGYVVSRRGDLETLGYCMIRWLGGILPWTKQKYVNNTATLLMTSLQYAPRELLQYITMVNSLTYFEEPN--YDEFRRVLMNG................................................................................................................................................................ 297
11 -35.000IDP91564 gene: ECs0848; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB34271 [Escherichia coli O157:H7 str. Sakai]  ali follow..  15  122.PELPSVDYNRLSVPGNVIGKGGNAVVYEDAE---DATKVLKMFTTSQSNE-----EVTSEVRCFNQYYGAGSAEKI------YGNNGDIIGIRMDKINGESLLNISS---------PAQAEHAIYDMFDRLEQKGILFVDTTETNVLYDRANEFNPIDISSYNVSDRSESQIMQSYHGGKQDLISVVLSK................................................................................................................................................................................................................................................ 292
12 -34.300IDP91568 gene: ECs1814; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB35237 [Escherichia coli O157:H7 str. Sakai]  ali follow..  14  140.........NKSPVPGNVIGKGGNAVVYEDME---DTTKVLKMFTISQSHE-----EVTSEVRCFNQYYGSGSAEKI------YNDNGNVIGIRMNKINGESLLDI--------PSLPAQAEQAIYDMFDRLEKKGILFVDTTETNVLYDRMNEFNPIDISSYNVSSWSEHQVMQSYHGGKLDLISVVLSK................................................................................................................................................................................................................................................ 302
13 -34.300IDP90141 ser/thr protein kinase-like protein [Monkeypox virus] MPXV_ZAI1979_005_186 [Monkeypox virus]  ali follow..  14  6...YCFDNDGKKWIIGNTLYSGNSILYKVRKNFTSSFNYVMKI-HKPLLSEIRFYISVLDPLTRERGIKYLAIPDLYGIGE-----TDDYMFFVIKNL-GRVFAP-------KDSESVFEACVTMINTLEFIHSRGFTHGKIEPMNILIRN-KRISLIDYSRTNKLYKSDYNEDMITSGNINYMCVDNHLGATVSRRGDLEMLGYCMIEWFGGKLPWKNESSIKVIKKEYKQFIATFEGNEPLELVRYIVYMLDYSQTPNYDRLRRLFIQ................................................................................................................................................................. 281
14 -34.100IDP90197 gene: CPXV206 CDS; CPXV206 protein AAM13645.1 [Cowpox virus (Brighton Red)]  ali follow..  14  6...YCFDNDGKKWIIGNTLYSGNSILYKVRKNFTSSFNYVMKI-HKPLLSEIRFYISVLDPLASERGIKYLAIPDLYGIGE-----TDDYRFFVLKNL-GRVFTP-------KDTESVFDACVTMINTLEFIHSRGFTHGKIEPRNILIRNK-RLSLIDYSKTNKLYKSGDGEDMITSGNIDYMCVDNHLGATVSRRGDLEMLGYCMIEWFGGKLPWKNESSIKVIKKEYKKFIATFEGNEPLELVRYIVYTLDYSQTPNYDRLRRLFIQ................................................................................................................................................................. 284
15 -32.700CPX_91697_91752 Complex of LYN_HUMAN with TIP_SHV2C [Undefined organism]  ali follow..  21  245..........ESIKLVKRLGAGQFGEVWMGY----STKVAVKTLKPGTMSVQAFLE----EANLMKTLQHDKLVRLYAV------TREEPIYIITEYMAKGSLLDFLKSDEKVLLPKLIDFSAQIAEGMAYIERKNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCFTIKSDVWSFGILLYEIVTGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCWKEKAEER-PTFDYLQSVLDDFYTATE........................................................................................................................................................ 505
16 -24.500IDP06384 gene: ORF36; ORF36 [Human herpesvirus 8] YP_001129389 [Human herpesvirus 8]  ali follow..  15  85.............DWSKRLGRGAFGIIVPI-----SEDLCVKQFDREFFYEAIANDLMQARERYPMHSGGSRLLGFVQPCIP--------RSIVYPRMKC-NLLQLDWS--QVNLSVMAAEFTGLMAAVSFLNRYGMVHCDVSPDNILATGDGRLVLTDFGSVALHSGSKWTNLTSNLGFKQHCYDFRV--PPKLICKHLYKPSCVLFQCYLSS--LGKMHAQVLDQPYPISPNMGLTIDM--SLGYTLLTCLEL................................................................................................................................................................................ 318
17 -15.600CPX_91686_91680 Complex of A1L467_HUMAN with INLB_LISMO [Undefined organism]  ali follow..  13 1077...........IVHFNEVIGRGHFGCVYHGTLLDNDGKCAVKSLNRITDIGE--VSQFLTEGIIMKDFSHPNVLSLLGI----CLRSEGSPLVVLPYMKHGDLRNFIRNTHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAVKWMALESLQTQKFTTKSDVWSFGVLLWELMTGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAEMR-PSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVDTRPASFWETSXMKEKHNPRRKYCLISGLAIIFSLWIIIGNGAKVQAETITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQNELNSIDQIIANNSDIKSVQGIQYLPNVTKLFLN 1497
18 -14.700IDP02507 gene: ubiB; 2-polyprenylphenol 6-hydroxylase [Francisella tularensis subsp. tularensis SCHU S4] FTT1298 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  14  109IEKAAKKPINEIFKSFESLASASVAQVHAAI-LQNDDKVVVKVLRPDLVREASNASQIRRNFEDSAIHYVPKIYWEYTSST----------VMVMERVGGVRVSDIETDALGVDRRLLAQRGVEIF--YSQVFDDCFFHADMHPGNMFIDVDPKYISIDFGIVGTLNRDDQRYLAGNFRDYRKVAELHIESGWVPSDTRVDVLESAIRTVCE------KEISLGYTLMQLFAVARRFNMNIQPQL-TLLQKTL.................................................................................................................................................................................. 406
19 -14.600IDP90808 gene: ubiB; putative ubiquinone biosynthesis protein UbiB [Yersinia pestis CO92] YPO3779 [Yersinia pestis CO92]  ali follow..  15  109IEIAMGGALETWFDDFDSLASASIAQVHTARLKENGKEVVLKVIRPNLLREAANAIQLRRNFEDSPMLYIPEVYSDYCRES----------VLVMERIYGIPVSDIAAEDQGTNMKLLAERGVQVF--FTQVFRDSFFHADMHPGNIFVSYDPLYIGIDCGIVGSLNKADKRYLAENFRDYRRVAELHVDSGWVPRDTNVEDFEFAIRTVCE------AEISFGHVLLNLFNTARRFNMEVQPQL-VLLQKTL.................................................................................................................................................................................. 408
20 -12.700IDP91191 gene: aphA1; Aminoglycoside phosphotransferase [Acinetobacter baumannii] CAJ77079 [Acinetobacter baumannii]  ali follow..  11  15LNSNLDADLYG-YRWARDNVGQSGATIYRLYGKPNAPELFLKHGKGSVAND------VTDEMVRLNWLTAPTIKHFIR--------TPDDAWLLTTAIPGKTAFQVLEE----YPDSGENIVDALAVFLRRLHS--VTHGDFSLDNLIFDEGKLIGCIDVGRVGILAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF............................................................................................................................................................................................................................... 271
21 -12.400IDP91187 gene: aph(2`)-Ib; aminoglycoside phosphotransferase [Enterococcus faecium] AF207840_1 [Enterococcus faecium]  ali follow..  10  1MVNLDAEIYEHLNK-LRYLSSGDDSDTFLCNEQYVVK----------VPKRDSVRISQKREFELYRFLENCKL-------QIPAVVYQSDRFNIMKYIKGERITY--EQYHKLSEKEKDALAYDEATFLKELHS--LVHNDFSANNMIFRNNRLFGVIDFGFLCLLDCSTDDFGKEFGRKVYY---QHKAPEVAERKAELNDVYWSIDQIIYG-YERKDREMLIKGVSELLQTQAEM.................................................................................................................................................................................................. 296
22 -12.300IDP91870 unnamed protein product [Acinetobacter baumannii] CAA30578 [Acinetobacter baumannii]  ali follow..  12  3LPNIIQQFIGNS---LEPNKIGSPSDVYS-----FNRNNETFFLKRSSTLYTETTYSVSREAKMLSWLSEPELIMTFQ--------DEQFEFMITKAINAKPISALFLTDQ--------ELLAIYKEALNLLNS--FSHGDITDSNIFIDKFNEIYFLDLGRAGLAD--EFVDISFVERCLREDASEETAKIFLKHLKNDRPDKRNYFLKLD........................................................................................................................................................................................................................... 256
23 -11.800IDP95452 set236a-054 [Undefined organism]  ali follow..  12  26...........PVRELRRLDAGDDSEVLLCNGLFVIK----------IPKRPSVRVTQQREFAVYSFLKQYDL-------LIPEVIFQCSEFNVMSFIPGENFGF--QEYALLSEKEKEALASDMAIFLRRLHG--LVHNDFSSSNMVFRHNRLYGVIDFGDVIVGDPDN-DDFGKDFGRKVLRHYGHRNPQLAERKAEINDAYWPIQQVLLG-VQREDRSLFCKGYRELLA....................................................................................................................................................................................................... 300
24 -11.800IDP95447 set236a-049 [Undefined organism]  ali follow..  13  21...............LAFLGEGEHSEAFLVNRDIVVK----------LPKHRQASECLKTEMQVVKGLGTKLNVEIPNV-GAFFHEGEEYTYFGSRKLPGHSLNK--KQFCALPKPILDKNAEIVANFLYRLHSE-LVHGDFSLNHLLFDQNQMVCVLDFGDSHVGDFQE-----DFLYLLDEEDEEEFGANFGREVLENYK..................................................................................................................................................................................................................................... 204
25 -11.600IDP91795 unnamed protein product [Enterococcus faecalis] CAA24789 [Enterococcus faecalis]  ali follow..  15  6ISPELKKLIEK-YRCVKDTEGMSPAKVYK-----LVGENENLYLKMTDSRYKGTTYDVEREKDMMLWLEGPKVLHFER--------HDGWSNLLMSEADGVLCSEEYEDE-----QSPEKIIELYAECIRLFHS--FSHGDLGDSNIFVKDGKVSGFIDLGRSGRADAFCVRSIREDIGEEQYVE--DLLGIKPDWEK------IKYYILL............................................................................................................................................................................................................................ 260
26 -11.500IDP95394 set236a-059 [Undefined organism]  ali follow..  13  22...............IRPLSCGDDSDAYLCDDVYVMK----------VPKRETVKKTQALEFQLYRFLEPFSF-------EIPKVIYQGEAFNMMTYIKGERLAY--ENYHKLSEKEKDRLACDEAEFLKALHS--LTHNDYSADNMLYQKNRLTGVIDFGDAVIGDPDN-DDFGKDFGRRVLRYYGHPHPELAERKAEINDAYWPVQQILLG-HSRKEAQLFEEGIRDLEM....................................................................................................................................................................................................... 292
27 -11.300IDP91188 unnamed protein product [Escherichia coli] CAA24743 [Escherichia coli]  ali follow..  13  11VEKFLIEKFDSVSDL-MQLSEGEESRAFSFD----GRGYVLRVNSCA--------DGFYKDRYVYRHFASAAL-EVLDIGEF----SESLTYCISRRAQGVTLQD-------LPETELPAVLQPVAEAMDAIAARHLVHADFGSNNVLTDNGRITAVIDWSEA-------------MFG---------------DSQYEVANI.................................................................................................................................................................................................................................... 232
28 -11.000IDP91192 gene: neoU; aminoglycoside 3`-phosphotransferase [Streptomyces fradiae] BAD95814 [Streptomyces fradiae]  ali follow..  14  1MDDSTLRRKYPHHEWHAVNEGDSGAFVYQLTGG--PEPQPELYAKIAPRAPENSAFDLSGEADRLEWLHRHGI-RVVERGA-----DDTAAWLVTEAVPGVAAAE------EWPEHQRFAVVEAMAELARALHE--VCHGDLCPNNVLLDPGTCTGVIDVGRLGV--ADRHADIALAARELEIDEDPWFGPAYAERFLERYGA-LAFYQLLD........................................................................................................................................................................................................................... 265
29 -11.000IDP95429 set236a-031 [Undefined organism]  ali follow..  15  26...............IVEIEGGSDHRTFDVNGAL--------VARLRRRPDEGTASAIMREVRLLEVVSRVSPVPV----PDVAGANPDRGLIVVTRLPGVPLLD-------SPPRHPMALIDPLARFLRAVHG--FCHNDLGAEHMLASDDGSTGVIDWSDAAIADPARLRDLGPAVARAIVRQLECAEPHHLLARARFYARCALLEDVSYG-LRTAHHRYAERALDHFRG....................................................................................................................................................................................................... 286
30 -10.900IDP95123 gene: str; putative APH(3``) streptomycin phosphotransferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001338789 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  14  21................LPVRGGESGDFVFRRG---DGHAFAKIAPASRRGE------LAGERDRLIWLKGPEVINWQE--------EQEGACLVITAIPGVPAAD-------LSGADLLKAWPSMGQQLGAVHS--VCHGDPCMPNFMVDPKTLTGLIDLGRL-GTADRYADLALMIANAEENWAAPDEAERAFAVLFNVLGI-LAFYLRL............................................................................................................................................................................................................................ 266
31 -10.900IDP91797 neomycin phosphotransferase [Escherichia coli] CAA23892 [Escherichia coli]  ali follow..  16  25................AQQTIGCSDAAVFRLSAQGRPVLFVKTDLSGALNE------LQDEAARLSWLATTGV-AVLDVVT-----EAGRDWLLLGEVPGQDLLS--------SHLAPAEKVSIMADAMRRLHT--VTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQ-------IALATRDIAEELGGEWADRFLVLYGI-IAFYRLL............................................................................................................................................................................................................................ 260
32 -10.700IDP91186 unnamed protein product [Streptomyces griseus] CAA37605 [Streptomyces griseus]  ali follow..  15  6GPGAVTPELFGVGGDWLAVTAGESGASVFRAA---DATRYAKCVPAADAAG------LEAERDRIAWLSGPRVLDWYA--------GDAGACLVTRAVPGVPADR-------VGADDLRTAWGAVADAVRRLHE--VCHGDLCLPNIVLHPETLSGFIDLGLALLLANARETWVDEERARFADAAFAERYGIAPDPER------LRFYLHLD........................................................................................................................................................................................................................... 267
33 -10.700IDP00063 aminoglycoside phosphotransferase family protein BA_4952 [Bacillus anthracis str. Ames]  ali follow..  11  18.....................GGVT----------GDAYIAQ------NGQQKLFLK-RNTSPFLAVLSAEGIVP-------TRRVTNGDVISAQKWLPGQKLEP----------------LERVAKLLKKIHSSKVCHCDVNHNNWLLSDEDELFLIDWDLGMLLYWYIPRQEWSEWLGYYDIEMDESLLKRMRWYVIAQTILSIQWHTTKKQQAEAEYWHQYLQQLLASE....................................................................................................................................................................................................... 263
34 -10.400IDP00045 aminoglycoside phosphotransferase family protein BA_3111 [Bacillus anthracis str. Ames]  ali follow..  12  1MNQIVKRLIREQFEVKPVKFSGHDNRTFQLGDKMSVR----------LPSDAAYTPQVEKENKWLPILSKELSLPI--IAKGNPSEAYPWPWSINKWIEGETVTK-------QNVRDLSEFAAHLGSFLVELQSIDWIHGDVAPGNLLVKDGKLCAVIDFGILGVGDACDAAMSWTFFDKRKIFKEVLQIDEETWNRARGWALWKALITYDANKI--SNKIVAEESYRVIQV....................................................................................................................................................................................................... 285
35 -10.300IDP91189 gene: aph(2``)-Id; APH(2``)-Id [Enterococcus faecium] AAW59417 [Enterococcus faecium]  ali follow..  12  25...............IEISGEGNDCIAYEINGNFIFK----------FPKHSRASINLLNEVTVLKTIHNELSLPI--VFTGMPSEMCQMSFAGFTKIKGVPLTP--LLLKNLPKQSQDQAAKDLARFLSELHSINLIHNDFSSDHILFDEKNTICIIDFGDAADNDFISLMEDDEEYGMNHY---KHKDIPTVLEKYMMKEKYWSFEKIIYG-KEYGYMDWYEEGLNEIRS....................................................................................................................................................................................................... 297
36 -10.200IDP95359 set215a-002 [Paenibacillus]  ali follow..  14  33...............IEMNESGMDFLVGFAEEAGTGARWILR-----KPRRPDVLDRADNEARVLKLIQSHLSVDV----RIYTPELIAYPLLSGQPAASVSMEG--YAWNMDHENPGDGFIRSLAEALVALHG--LIHGDLHPPHILIDERVQVTLLDWTESEVASAKDFVLYYAIYGEDRYEQAGGKVWPRMFDHIVEQHAAYPVLIAQFA-LLTGQEEYMTMARNALG........................................................................................................................................................................................................ 305
37 -10.000IDP95401 set236a-066 [Undefined organism]  ali follow..  11  205...............IEIIGSGYDSVAYLVNNEYIFK----------TKFSTNKKKGYAKEKAIYNFLNTNLETNVKIPNIEYSYISDELSILGYKEIKGTFLTP--EIYSTMSEEEQNLLKRDIASFLRQMHGLDLCHNDFSCNHLLLDGNNRLTIIDFG------DSGIIDEYCDFIYLLEDSEEEIGTNFGEDILRMYG..................................................................................................................................................................................................................................... 430
38 -10.000IDP91190 6`-aminoglycoside N-acetyltransferase [Enterococcus faecalis V583] EF_A0061 [Enterococcus faecalis V583]  ali follow..  13  205...............IEIIGSGYDSVAYLVNNEYIFK----------TKFSTNKKKGYAKEKAIYNFLNTNLETNVKIPNIEYSYISDELSILGYKEIKGTFLTP--EIYSTMSEEEQNLLKRDIASFLRQMHGLDLCHNDFSCNHLLLDGNNRLTIIDFGDSGIIDEYCLEDSEEEIGTNFGEDILRMYGNIDIEYQDIVEEYYPIETIVYG-IKNIKQEFIENGRKEIYK....................................................................................................................................................................................................... 474
39 -10.000IDP91792 gene: aph; spectinomycin phosphotransferase [Legionella pneumophila 130b] AAB58447 [Legionella pneumophila 130b]  ali follow..  11  8.AQQLIELLKVHYGID-QGGADTNAFAYQADSE--SKSYFIKLKYGY---------HDEINLSIIRLLHDSGIKEI---AKLFQQLKHFK-IIAYPFIHAPNGFT---------QNLTGKQWKQLGKVLRQIHETVLCHSDIHAGNVLVGNEESIYIIDWDLMFIGGGVG-HEIQYFYEGYGEINVDKTILSYYRHERIVEDIAVYGQDLLSRNQ-FDPNNVVEIAFATEQ........................................................................................................................................................................................................ 331
40 -9.810IDP90857 hypothetical protein YPO1614 [Yersinia pestis CO92] YPO1614 [Yersinia pestis CO92]  ali follow..  16  12.....................SGLTG----ESWRITGPGIDWLAREQSPHKSQLGVNRRRERKFLQHIAGNGLSAVIAANQR---------WLVVNWLEGDVVTN--------EQFIPLVNHGQLARLLARLHHLPALHMDIHPGNLLTTPVG-LKLIDLEIAALFRGNHWSMLQQQAFLQDYCNNEHGYHDIARLSRQI....................................................................................................................................................................................................................................... 226
41 -9.750IDP95360 set225-001 [Brevibacillus brevis]  ali follow..  13  25...............VKVNESGLDFLAIFASTID-GIPWVLR-----QPRRDDVVETARYEKRVLDLVAKHLRVEV----QVHTSEFIAYPILGGTPMATINMETKNYDWYLNPESLPELCIQTWAEALVELHGSALVHGDLHPGHILVAENGKVTLLDWTEAEVSDAIDFTVVYLLFGDQRYEKAGGRVWSRMHEHIVEMTAAYPVTLATFA-LKSGLEEFKIMARQALGVDENGKEIT............................................................................................................................................................................................... 307
42 -9.350IDP91796 gentamicin resistance protein [Enterococcus gallinarum] AAB49832 [Enterococcus gallinarum]  ali follow..  10  24...............VESLGEGFRNYAILVNGDWVFR----------FPKSQQGADELNKEIQLLPLLVGPQYVYI-------GKRSDGNPFVGYRKVQGQILGE--DGMAVFPDDAKDRLALQLAEFMNELSAPRLIHGDLSPDHFLTNLNTPLTIIDFGDAAISDPDY-ELFTRQVMAYRGEVDLDTHIRKVSLFVTFDQVSYLLEGLRARD-----QDWISEGLELLEEDKANNFGA............................................................................................................................................................................................... 303
43 -9.240IDP95426 set236a-028 [Undefined organism]  ali follow..  12  50...............IKKLGGGLDNLAFEVNGEYIFR----------FPKRDEDNQKLLREGKVLELVKDLSSVPVPEP---------STKFMGYRKIEGVSLLE-----GRETFDGYEELAETLAKFLSQTHS--FSHNDLGIEHIIVKDNSVTGIIDWADAEITDAYDFGKLLRDLGELARYTVEANNKEEIFRRAVFYAKCSALEDLAYTAGDGKDKLYWDNSRAALKR....................................................................................................................................................................................................... 310
44 -9.110IDP95393 MphBM [Staphylococcus aureus] BAA34540 [Staphylococcus aureus]  ali follow..  14  23...............ISLNESGLDFQVAFGKDKH-GVEWVLR-----LPRRPDVYKRTKPEKQTVDFLQKPKWKVHERDLIAYPKLTGKPAATIDPEIQNYVWEI-------EHKPLPENFINTLAETLVDLHN--MIHGDLHPGHIMVDNQANVTLIDWTEATHSDSMDFMGHHRVFDDTAYGKAGGEIWPRMKEHIIELNMFIAEFAMESGESAYETMALKELGMKE.......................................................................................................................................................................................................... 299

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.