current user: public

If you have questions about the server, please let us know.

Query: gi|15607158|ref|NP_214530.1|(removed signalp:1-30) penicillin-binding protein PbpA (Rv0016c) [Mycobacterium tuberculosis H37Rv], from M.tuberculosis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460
# Score Template Links and tools%idFirst ADGLRADPRNQRVLLDEYSRQRGQITAGGQLLAYSVATDGRFRFLRVYPNPEVYAPVTGFYSLRYSSTALERAEDPILNGSDRRLFGRRLADFFTGRDPRGGNVDTTINPRIQQAGWDAMQQGCYGPCKGAVVALEPSTGKILALVSSPSYDPNLLASHNPEVQAQAWQRLGDNPASPLTNRAISETYPPGSTFKVITTAAALAAGATETEQLTAAPTIPLPGSTAQLENYGGAPCGDEPTVSLREAFVKSCNTAFVQLGIRTGADALRSMARAFGLDSPPRPTPLQVAESTVGPIPDSAALGMTSIGQKDVALTPLANAEIAATIANGGITMRPYLVGSLKGPDLANISTTVGYQQRRAVSPQVAAKLTELMVGAEKVAQQKGAIPGVQIASKTGTAEHGTDPRHTPPHAWYIAFAPAQAPKVAVAVLVENGADRLSATGGALAAPIGRAVIEAALQGEPLast
1 -101.000IDP00345 hypothetical protein lmo0441 lmo0441 [Listeria monocytogenes EGD-e]  ali follow..  23  230...........DQKWVQADSFVPLVTLNKDNLPEATGLTYAQKEMRTYPLNEATSHLIGYVGEVIGKSGLERYYDKQLRGKNGNDQTKQEDTLQKIDKKDGEEIKLTIDAAVQKKAFDSL-----GSETGAVTMINPTNGELLALVSTPSYDANQMVLG---ITSEDYAKYNDDKRLPFLAR-YANRYAPGSTFKTITATIGLDTGITKPDKVREISGLQWQKDAS--GKYFVTRVHDVPKVNMTDALVHSDNIYFAQEGLEIGKDKLTAGLKKFDFD---KEYNLPFTMKPAQISNDEILLADTSYGQGELLMSPIQQAIAYSAIANDGKMPYPKLDTKEKAGKETQA-----------TEAKSANQVKAALVKTVSGTAHALEIQGHSIAAKTGTAELKEKQGEDGLENGFVYAFDADNPNYLMVGMIENVKGRG---GSGLVIDKLKPVIESMYK... 678
2 -98.500IDP92559 Chain A, Structure Of Semet Penicillin Binding Protein 2a From Methicillin Resistant Staphylococcus Aureus Strain 27r (Trigonal Form) At 2.45 A Resolution. 1MWR_A [Staphylococcus aureus]  ali follow..  17  203.............................SDFAKKFHLTTNETESRNYPLEKATSHLLGYVGPIIGKKGLEKLYDKKLQHEDGDDNSNTIAHLIEKKKKDGKDIQLTIDAKVQKSIYNNX-----KNDYGSGTAIHPQTGELLALVSTPSYDVYPFXYG---XSNEEYNKLTEDKKEPLLNK-FQITTSPGSTQKILTAXIGLNNKTLDDKTSYKIDGKGWQKDKSWGGYNVTRYEVVNGNIDLKQAIESSDNIFFARVALELGSKKFEKGXKKLGVG---EDIPSDYPFYNAQILDNEILLADSGYGQGEILINPVQILSIYSALENNGNINAPHLLKDTKNKVWK----------KNIISKENINLLTDGXQQVVNTHKEDIYRSYANLIGKSGTAELKXKQGTGRQIGWFISYDK-DNPNXXXAINVKDVQDKG---XASYNAKISGKVYDELYENG. 638
3 -98.100IDP01258 gene: pbpC; penicillin-binding protein 3 BA_2238 [Bacillus anthracis str. Ames]  ali follow..  23  219..................PIGILPEGATQNTYIDLPGVSTKPVNVRTYPLGEAAAHLTGYIGKVVGKAGLEQVLEEKLRGKKGDAQGKEIKNLAKTDAVDGENVTLTIDSAVQEKTYNEM-----KGEAGSSAAINPKSGETLALVSSPAYDPNIIARG---TSKAQREAWNNDPKKPMTNRFTQL-SVPGSVFKPITAAIGLETKTIDPKEELKIEGLKWTKDSS--GNYYVTRVKDANPIDFDKAMKYSDNIYFAQEALKIGKDKFMSEAKKFGFDEKL-EYGFPASKIANDGIKNDIQMADTGYGQGQVLMTPLHLALTYAPIVNDGNIPSPYIIKTDKQPK---------VWKENVISKGNQDILKTAMTKVINGTGKIAKIDGMTLAGKTGTAELKVSKEEGKELGWFAAF-DLNSPDMVITMMIEDVKG---RGGSNIPAEKVKHVFQK...... 661
4 -96.600IDP00860 putative penicillin-binding protein STM1910 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  24  126...........RPVVLKNALTDVEIARFAVNQFHFNGVTINSYQDRQYPYGAELAHVLGYVSKIIGKQGIERYYENDLHGKTGDNHGRIVRLLKDVPPIAGKNIHLTLDLHLQEYIESLL-----AGQRAAVLVEDPHDGSVLAMVSMPSYDPNPFVKG---ISYQDYGKLLHDKNLPLINRVTQGLYPPASTVKPYMAMSALLCGIITPQTFFGAPTWTLPGTQ---RHYRDWKKTGHGMLDVTKAIEESADTFFYQVAYMMGIDRIDTMLSQFGYG---KPTGIDLNEEYDGLLPSRAWTISVGIGQGYWIATPIQMVKAMVALINNGKVIAPHLLLNEESGKTVVPYRPSGTPAQIAPASPYWGLVRQAMYGMANGTGYKFHTAPYGIAAKSGTSQVFSLKERLRDHVFYTAFAPYKNPKVAIALILENGGS-----DGVTAAPIMRKILDHLFDPQ. 613
5 -95.600IDP00320 gene: pbpA; penicillin-binding protein 2 CBU_0550 [Coxiella burnetii RSA 493]  ali follow..  24  131...........QPVPLKYKLTNEEVARFYVNQYRFPDVRIETRMMRYYPLGDLTSDVVGYVGRIIGKMGIEKYYENELHGTMGNASGRIVRILKRVPPTPGTNIYLTIDSNLQTEARKVL-----GEESGAIVAIQPSTGQVLALVTKPSFDPNPFVSG---LSQQDYQKLVNSPQHPLYNRAIRGQFASGSTVKPFLALFGLDMGIITPQYIYDPGWFQLPNTQ---HIYHDWRERGHGWVNVVKAIAVSCDVYFYNLAVALGIKRMDDILQRFGFG---QLTGIDLPEEVPGLVPSPRWTIEAGIGQGFFLVTPLQLAQATATLAEHGKRYRPTLLFKSVEPTGKVNVQQPIPKPPIFKNPDNWDIVIHAMQEVVDGTADFFRHPGFTVAAKTGTAQVYGHQRRLRNNHLFIAFAPVENPQIAVAVVVEHSAM-----ADKMAGEIINYYFKHQQK... 612
6 -94.800IDP06526 gene: pbp5; penicillin binding protein 2 prime [Enterococcus faecium DO] AFK59080 [Enterococcus faecium DO]  ali follow..  21  243.........................IIDGATPELPAGATIQEVDGRYYPLGEAAAQLIGYVGDIIGRSGLEMAFDKDLRGTTGDADGVEKKVLIEHEVQNGKDIKLTIDAKAQKTAFDSL-----GGKAGSTVATTPKTGDLLALASSPSYDPNKMTNG---ISQEDYKAYEENPEQPFISRFATG-YAPGSTFKMITAAIGLDNGTIDPNEVLTINGLKWQKDSS--GSYQVTRVSDVSQVDLKTALIYSDNIYMAQETLKMGEKKFRTGLDKFIFG---EDLDLPI-----SMNPAQISLADTGYGQGELLINPIQQAAMYSVFANNGTLVYPKLIADKETKDKKNV-----------IGETAVQTIVPDLREVVQGTAHSLSALGIPLAAKTGTAEIKEKDEKGKENSFLFAFNP-DNQGYMMVSMLENKE------DDDSATKRASELLQYLNQNY. 677
7 -94.700IDP00417 gene: pbpA; penicillin-binding protein 2 YPO2604 [Yersinia pestis CO92]  ali follow..  24  131...........TSIAVKTPLTEVQVARFAVNQFRFPGIEVKGYQRRFYPYGSALTHVIGYVSKIIGKLGIERYYESTLHGKTGNNRGRVIRQLHEQPPQAGKDIYLTLDLSLQIYIEKLL-----SGSRAAVVVTDPRTGGILALVSNPSYDPNLFVDG---ISNKDYQGLLNDTNRPLINRATQGVYPPASTVKPYIAVSALSAGVITKNTLFDPGWWQLPGSE---KRYRDWKKWGHGRLNVTKALEESADTFFYQVAYDMGIDRLSSWMSKFGYG---EYTGIDLSEERAGLMPTREWTIPVGIGQGYWTATPIQMAKSLMTLINDGTVKTPHLLQSTRIDGVLVPYKQEDSTQIGSINSGYWEIAKDGMYGVANGTGRKFEGTPYKAAAKSGTAQVYSYETHLRDHKLMVAFAPYENPTVSVAIILENGG------AGPAVGTITRQILDHILLGDN 614
8 -93.500IDP95166 peptidoglycan synthetase [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002919585 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  24  150...........KAVTLKSDLSDVEVARFAVNEFRFPGVTVESYQQREYPYGAELAHVVGYVSKIIGKQGIEGYYEKALHGTTGDNHGRVVRLLKEVPPVAGKNLYLTLDLHLQQYIESVL-----KGQRAAVVVVDPRDGGVLAMVSSPSYDPNPFVKG---IGYQAYKSLLENPDRPLINRVTQGLYPPASTVKPYMALSALSAGVITPNTFFGAPTWTLPGTQ---RRYRDWLKTGHGMLNVTKAIEESADTFFYQVAFEMGIDRIHEWLSKFGYG---QSTGIDLNEEYAGVLPSREWTISVGIGQGYWIATPIQMVKALTTLLNNGKVQDPHLLYSMKQGNHVERYQQPANLPQVGPKSPYWGIVRNGMYGMANGTGYKLHTAPYQIAAKSGTSQVFSLKQRLRDHIFYTLFAPYQHPKVAMALILENGGG-----DGVVAGPTARAILDHIFVPQ. 637
9 -90.000IDP01244 penicillin-binding protein BA_2504 [Bacillus anthracis str. Ames]  ali follow..  18  133.................................KPNNVIIKDEWIRYYPKHEIGSQVIGYVENNVGKSGIELQYEDDLKGKPGMNNKEFLWNI--QKVQKGKDIRLSLDSKLQQKSEEALRSQIKDAKAGYAVVSDAKTGAILTMANSAVFDPNILHTH---VSTKIDNLKSLSQNKAIQKLKYESYINMASTIKPLTILIGLNEKLFQPEDYLDKGTFEYDNQ----NNITNAPGTPTGEITPRQAIINSSNTFMTAKNVEKVAHIWTDYLMQFGLRS---KTGIDLPFEEDGQYEFHPSLLNASWGGN-EVHTPLQLAQYAATLARKGDKYKPQMTSAIIGQNGKETKKFKPILESSNYPTKFWSVVQGGMSQNIE----EIKKLPFDVAGKTGITGFPDEQARMINHSLFIAYAPTEDPQIAVSVVIPGSN-----SEKNIAALVTSEILESWNTLQK 577
10 -87.600IDP01251 penicillin-binding protein BA_4606 [Bacillus anthracis str. Ames]  ali follow..  22  149............................................EVRLRQTSVMNHLIGNVGENIGISGLQQAFDEFLLTDGEDRQGEPIFGKQAKYTSPGNTIQTTLHNELQKKAEEVVEAS--EIKKGGLVLLDVKKNEILAMVSKPSVQVKDE----------------SLYKNTLENQMLTP-HFPGSVFKTIVAAAALDQNENVFNRTFNCNKDL---------YGEDHPKVMMGTLSFKESFARSCNRTFSELGNELIQKDLETYVAALGGADKVTTHFEQMPEEKSITIWRSEGVAQTAIGQKDVRMSPLAIANMMATIARGGEKMEVKAVEKIMYKNGTDFYTFEDHTLGKQLSYETVKTLQQLLRSVVTGTGAAFSSLPLSVAGKSGTAQTG---KGTKENRWFAGYFPYENPRYALVVVDVETSS-----NVNAVTPIFKAIVESIYRLE. 581
11 -84.000IDP05079 hypothetical protein lmo1438 [Listeria monocytogenes EGD-e] lmo1438 [Listeria monocytogenes EGD-e]  ali follow..  18  184..KMTTGYAMTESVVKNKDVTDEEIARVSENMDSLPGVDTTTDWNRYYTYDETLRSILGSVSTAVGKSYLEAQYESVLAGSKSDSKGNIIETVNKYEGSKGKDLVLSVDVEFQKAVEEILQKNIKQGKRAFVVAMDPYSGEVLALAGQKLNDKGEF--------------------EDYSLGTFTTAYAMGSAVKGSTILGGIMDGAITNKTVFTDQPIVLKGTK-PKSSWFNRTGAGNRPLDPVGALEISSNSYMYQVAMKMGFDDMRYYYNQFGLGV---KTGIDLPGEQTGYKGDDGKILDFAIGQYD-SYTPLQMAQYVSTIANGGSRIAPSMVKEIRNPSGTLATANEPKVLNKIVSESDIKTVQQGFYEVTHGSTGTATSSDYDVAGKTGTADAFYDGPKEVWNTTFVGYAPVEKPEIAISVVVPWIYRP-YGTDQKTNMKISKEVFDKYFELKK 689
12 -78.800IDP92561 Chain A, Crystal Structure Of Penicillin-Binding Protein 2 From Neisseria Gonorrhoeae Containing Four Mutations Associated With Penicillin Resistance 3EQV_A [Neisseria gonorrhoeae]  ali follow..  22  83VDVLRNKLEQKGKSFIWIKRQLDPKVAEEVKALGLENFVFEKELKRHYPMGNLFAHVIGFTDDGKGQEGLELSLEDSLYGEDGDRQGNIVDSLDSPAPQNGKDIILSLDQRIQTLAYEELNKAVEQAKAGTVVVLDARTGEILALANTPAYDPNRPGRADSEQ---------------RRNRAVTDMIEPGSAIKPFVIAKALDAGKTDLNERLNTQPYKIGPSPVRDTH-------VYPSLDVRGIMQKSSNVGTSKLSARFGAEEMYDFYHELGIG---VRMHSGFPGETAGLLRRPIEQATMSFGYG-LQLSLLQLARAYTALTHDGVLLPLSFEKQAVAPQGKRI-----------FKEXTAREVRNLMVSVTEGTGTAGAVDGFDVGAKTGTARKLVNGRYVDNKGTFIGFAPAKNPRVIVAVTIDE--TAHGYYGGVVAGSPFKKIMGGSLN... 523
13 -78.300IDP01246 penicillin-binding protein BA_2648 [Bacillus anthracis str. Ames]  ali follow..  21  113.KNFHEGRTQVEIGKVGRNLTREKKEQIRK--LKIPGVSFMPEKARVYPNEDFASYILGFAGNTEGKFGLEKSLDKYLRSTNGGRGGIPLDIGKIEPAKHGNNVYLTLDKQINSFLEEAMNKAQDDPSMLLGIIADPKTGKVLAMSSKPSFNPN------------------KGDIEYFLNDPIANAYEPGSTMKVFTLAAAINEGVYNGKEYFQSGKYAVGSSDIKDHN----GGFGWGSITFDEGFERSSNVAFSILEDQLKPNKFKQYMNKFGFN---QKTGIDLPGESKNTLNTQIQQVTTSFGQG-STVTPIQLIQAATAIANDGKMMQPYIVDKVVNPTNQVIMENQPKEIGNPIKKETADKVRDLMERVIKGTGTMYKVDGYPIGGKTGTAQIPNPENGRYMEG-FLGMAPIDDPELIVYLAIKQPKLKGDEYGAQPLAEIFKPVVKNSLE... 569
14 -78.100IDP04394 gene: spoVD; stage V sporulation protein D [Clostridium perfringens ATCC 13124] CPF_2117 [Clostridium perfringens ATCC 13124]  ali follow..  21  124.................................KIRGVIVSQDTKRYYPDNNFLAQVLGRVDDGIGQGGIEREYNVELSGLPGARNSSGISNSEFAKPVDGKDVTLTVDETIQYFAEKVAEEGKKKADGVSIIVMNPKNGEILAMANKPDYNPNEPYKGYENFPGKDKTEKMENMWK---NDAVSNSFEPGSIFKMVTSSAAVQEGIAGGNETYCPGGKNVSGTYI-----KCWKPDGHGTETFDQILENSCNVGFMDIGQKLGKEKLNEYIEKFGFG---KQTGIDLPGETTGIVLPNDELATISFGQT-DSASSVQMMAAMNTIANGGTWIQPHIMKEISHEDTSVDKTFVPKKIDNIIDQKTAMRVSEALEKTVFGSPKRAYIEGYGIAGKTGTAEKVKASGGYGAGASFAGFAPYNDPQVSVLISVDN---KGEYFGGLVAAPLAHDLFSDIFN... 558
15 -77.800IDP01224 sporulation specific penicillin-binding protein BA_4054 [Bacillus anthracis str. Ames]  ali follow..  25  104KDEIYKRITKKESIVRLDKGGRKISHDKAKEVLSLKGVYIAEDSIRYYPFGNFLSHVLGFAGDNQGLMGLEKYYDKELNGDEGDAKGQRMPNVGDDKPEAGLNLGLTIDARINRIMEREMNIAESNPDGMIAIAMNPKNGEILGMSSRPSFDPADFQSVSPEVYNR--------------NLPVWSTYEPGSTFKIITLAAALNENLVDLEKDTDDGAAEVGGARL-----KCWKAGGHGSQTFLEVVQNSCNPGFIELGDRLGKERLFKYIRNFGFG---QKTGIDLQGEGSGILFNLDEQATTSFGQG-VSVTPIQQVAAVAAAVNGGTLYQPYIAKEFIDPKNNVVSKKTPVDKRKVISKETSEKVRYALENVVKGSGKGAFIDGYRVGGKTGTAQKVKDGKYLENNVSFIGFAPADDPEIVVYVAVDN--KGVTQFGGVVAAPIVGNILRDALP... 561
16 -77.500IDP04190 gene: spoVD; stage V sporulation protein D [Clostridium perfringens ATCC 13124] CPF_0544 [Clostridium perfringens ATCC 13124]  ali follow..  21  146.................................EIPGVMVSPDTQRYYPNDNFLSHVLGTTNDGVGLNGIELKYDRVLSGSPGVKDGAEYTISRFTAPVDGKDVVLTIDEKLQYFAEQIAEIGLVNADAASVIIMNPNNGEILAMSNKPDFNPNKPYDGAENFSGNTSSDRIQKMWR---NRSVSDSFEPGSIFKIITASAAVQEGVAGKDETYCSGGLQKGDRFI-----KCWKRGGHGTQTFEEIIQNSCNVGFMNLGEKLGAEKLNEYIKKFGLG---KKSGVDLPGESPGIVKKTEDLATISFGQT-NTVNPIQFMTAVNAVANGGTLIQPHVVKEISYIDENIDETFVPKKTENLISKETADQIKLALENAVNGSAKGAYKEGYGVAGKTGTAQKVNPETGGYGGGYFVGFAPYDNPQISVMVSVDN--KNGEYYGGRVAAPLAGMLLQNIFN... 582
17 -77.000IDP04267 gene: spoVD; stage V sporulation protein D [Clostridium perfringens ATCC 13124] CPF_2134 [Clostridium perfringens ATCC 13124]  ali follow..  20  155.................................DINGVIVSEDTKRYYPNGDFLSHTLGTTNDGEGLSGLELYYNEELMGIPGVRVSEVYSETSFTPPVDGKDMTLTIDENIQYFVEKVAEDALKNADSVSIAVMNPNNGEILGMVNKPGFNPNNPYEGSEAFKGKDESAKLQNMWR---NTIVSDAFEPGSIFKIITSIAAIEENIAGKDEVYCDGSLNVAGKNI-----KCWKPGGHGVQNFNQTLENSCNVAFMEMGAKLGAEKLNEYIKLFGFG---TQSGIDLPGEATGIVKNVEDLATISFGQT-NTMNGIQFMTALNAVANGGDLIQPHIMKELSHKDDNGTEVFVPKIQENIVDEKSTMRVKEALESTVNGSSKDAGIEGIKVAGKTGTAEKVDPETGTYGAGYFAGFAPYDNPQVSLIVIIDN--KNGEHFGGIVAAPFAGELFNNIFN... 591
18 -76.600IDP00720 gene: pbp3; penicillin-binding protein 3 SACOL1609 [Staphylococcus aureus subsp. aureus COL]  ali follow..  18  187..EMNAGTVLDPQMIKNEDVSEKEYAAVSQQLSKLPGVNTSMDWDRKYPYGDTLRGIFGDVSTPVGKSYLEYQYEDVLRGKKKDKSGKVTSSEVLNPGARGQDLKLTIDIDLQKEVEALLDKQIKDMDNAMMVVQNPKNGDILALAGKQINKSGKM--------------------TDYDIGTFTSQFAVGSSVKGGTLLAGYQNKAIKVGETMVDEPLHFQGGL---TKRSYFNKNGHVTINDKQALMHSSNVYMFKTALKLAAQKLRRGLNQVGLGV---KTGIDLPNETRGQIEPLTNYLDLSIGQYD-TYTPLQLSQYVSTIANDGYRIQPHIGLTIHESTGPLKKKINGTVLNKVNTEKEIKQIQEGFKMAFNGTGYVSKDTVVPTAGKTGTAEVFQNGEP-RVNSTYIGYAPIDDPKLAFSIVYTNQPV---PPPWLTGGDLGRDVINYYFKQL. 680
19 -76.600IDP01250 penicillin-binding protein BA_4497 [Bacillus anthracis str. Ames]  ali follow..  19  185....MDGGYAMTPQVIKKDATEQEYAIISENLATLPGVDTNVDWDRKYIYDDLFRSVLGGVSTSVGKSYLEQQYEDSLHGNKADKNGNILETINVSKGQSGNNLNLTIDMELQKRVEEIITKNLLRYKRAFVVMMNPKNGEVLSMAGKQLVEENGE-----------------TKVQDFALGTMTSSYPMGSTVKGATVLTGYQTGAIQPGSVQLDEPIRLKGT----PPKSSWK--TMGYINDLTALKMSSNVYMFKTAMNIAFDTMRYYFGQFGLGV---KTGIDLPNESAGQTGRGGFLLDLSIGQYD-TYTPLQLAQYVSTIANGGYRMQPQVVKEIRQPSGKVVHSMEPKVLNRIMPESQIKRVQEGFRQVFNDSGGTATGAPYKAAGKTGTAQTANGERKETYNLTLVGYAPLEDPEVAFSVVVPWVDD-----KSGINGYISRDIMDAYFDLK. 684
20 -76.100IDP00344 gene: pbpB; hypothetical protein lmo2039 lmo2039 [Listeria monocytogenes EGD-e]  ali follow..  22  154.................................NLPGIEFTRQSERFYPNGTFATQLIGFAQVLEGKMGIESRYNDILTGKNGDRMGYILSKNKVTEAKDGKDITLTLDKKIQTFLEDTMTTVDYKPKNMMAVVADPKTGEILAISQRPSFNPA------------DRSTITGNSSSIWQDLPVEYAYEPGSVMKIISLASAIDTNAYNANEYYQSGSYKVGDIAIHDHN----NGNGWGSITYREGVERSSNVAFAKLLNKMGTDTFKTYLDKFGFG---KKTGIALPNETSGKINYPIEKVTTVFGQG-TTVSMMQMIQAASAIASDGTMKEPYVVSSVKDPNTGEETDTKTKIAGKPISAETAKKTRDELKNVIHGTGKLYAIPGYDVAGKTGTSQIPDPKTGKYMTG-FLGMAPADNPELVIYVTMQQPQLSGSQTGGEAVSEVFNPVMKNSLQ... 587
21 -76.000IDP00548 gene: ftsI; penicillin-binding protein 3 YPO0549 [Yersinia pestis CO92]  ali follow..  22  154.................................KLPGIHLRQESRRYYPAGQVMAHIIGVTNDGQGIEGVEKSFDRWLTGQPGDHYGRVIEDISSVDSQAAHNLVLSVDERLQALVYRELNNAVAKAESGTAVLVDVNTGEVLAMANSPSYNPNNLTGTPKDA---------------MRNRAITDIFEPGSTVKPMVVMTALQHGVVKENSVLNTLPYFVNGHQIKDVA-------RYAELSVTGILQKSSNVGVSKLALAMPSSALVDTYSRFGFG---KATNLGLVGESSGLYPKKQERATFSFGYG-LMVTPLQLARVYATIGSMGVYRPLSITRVDPPVAGERI-----------FPEPLVRTVVHMMESVAGGGGTKAAIKGYRIAIKTGTAKKVGPDGKYMDRAYTAGVAPASNPRFALVVVIND--QAGKYYGGAVSAPVFGAIMGGVLR... 558
22 -75.700IDP01249 penicillin-binding protein BA_4055 [Bacillus anthracis str. Ames]  ali follow..  24  147................................LKLPGISFITENARVYPNGDFASYVVGHAGIAIGQFGLEKSLDKYLGASHGDRRGVSLGKVNVKAPKNGDNVYLTLDQRIQSYLEDAMKEASYEPESLIGIVADPKTGKILGMSSKPSYDPN------------------QENNQYFYNDAIANAFEPGSTMKIFTLAAAINEGVYKGQDYYQSGTYPVGNRKIKDHN----GGAGWGSITFDEGVERSSNVAFAILGQKLGPERFRKYIHSFGLD---EKTKIDLPGEGSNTIDQQIQQVTTAFGQG-STVTPIQLVQAATAIANDGKMMKPYTIDKIVDPITEVKLEHKPEEVGKPVTKETAAQVRQLLERVVTGTGTAYKVDGYSVGGKTGTAQIPDGKGGYMTGFSFLGMAPMDDPQLVVYVAVKKPKLKDDESGAQPLADIFKYVTKNSLE... 573
23 -75.200IDP00794 gene: pbp1; penicillin-binding protein 1 SACOL1194 [Staphylococcus aureus subsp. aureus COL]  ali follow..  20  156................................MNLPGISLLPETERFYPNGNFASHLIGRAQELKGALGVEKIFDSYLSGSKGDIWGYIAPNTKKKQPKRGDDVHLTIDSNIQVFVEEALDGMVYQPKDLFAVVMDAKTGEILAYSQRPTFNPETG----------------KDFGKKWANDLYQNTYEPGSTFKSYGLAAAIQEGAFDPDKKYKSGHRDIMGSRI-----SDWNRVGWGEIPMSLGFTYSSNTLMMHLQDLVGADKMKSWYERFGFG---KSTKGMFDGEAPGQISNELQQKTSSFGQS-TTVTPVQMLQAQSAFFNDGNMLKPWFVNSVENPVSKQFYKGQKQIAGKPITKDTAEKVEKQLDLVVNSHAANYRIDGYEVEGKTGTAQVAAPNGGGYVKG-FMGDAPKKNPKVIVYAGMSLAQKNDQEAYELGVSKAFKPIMENTLK... 583
24 -74.900IDP92560 Chain A, Double Mutant Pbp2x T338aM339F FROM STREPTOCOCCUS Pneumoniae Strain R6 At 2.4 A Resolution 1PYY_A [Streptococcus pneumoniae]  ali follow..  18  125................................AEVKGIDFTTSPNRSYPNGQFASSFIGLAQSLLGTSGMESSLNSILAGTDGDRLGNIVTEQVSQRTMDGKDVYTTISSPLQSFMETQMDAFQEKGKYMTATLVSAKTGEILATTQRPTFDADTKEG---------------TEDFVWRDILYQSNYEPGSAFKVMMLAAAIDNNTFPGGEVFNSSELKIADATIRDWD-VNEGLTGGRMMTFSQGFAHSSNVGMTLLEQKMGDATWLDYLNRFKFG---VPTRFGLTDEYAGQLPNIVNIAQSSFGQG-ISVTQTQMIRAFTAIANDGVMLEPKFISAIYDPNDQTARKSQKEIVGNPVSKDAASLTRTNMVLVGTTGKPTVTVPGQNVALKSGTAQIADEKNGGYLVG-AVSMSPAENPDFILYVTVQQPEHYSGIQLGEFANPILERASAM...... 566
25 -74.500IDP01457 penicillin-binding protein 3 VC2407 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  23  161.................................KLAGIGLKEESRRYYPAGEVSAHLVGVTGDGHGLEGVERSFDSTLTGESGDKFGRVVENIALEEREEGKPIQLTIDQRLQAIAFRAVKQAMARATSASAVMLDVKTGAVLAMVNAPSYNPNNRNDWQSFK---------------MRNRVITDAFEPGSTVKPFVVLAALANGIADKNTIIDTGDGTMQIGGSRVRDTS-----KVGKADLTLILKKSSNIGVAKLALEMPLEALLGMYSSVGLG---EMSGLDLVGETIGIFPSQFEIATLSFGYG-LAITPIQLAHAYATLGNHGKYQPIHIIKGDQHGETRQV-----------VDPKYVNQVLEMLETVTQGTATRAAVPGYRIAAKSGTSRKAIAGGYSDEYAYTAGVAPVSDPRISLVVMVNE--QGDSYYGGAVAGPVFSEIMKGALQ... 566
26 -74.200IDP01245 penicillin-binding protein BA_2637 [Bacillus anthracis str. Ames]  ali follow..  18  190....MTSGYQMAPQIIKKDVSEKEFTIISEGLANLPGVDVSVDWERVYVNDGLFRSVLGNVSNSVGKSYIEQQYEDVLHGTKKDKQGTTIRTETISEGKSGKNLTLTIDMELQKKVEESIEKILKALDRAFVVMMNPKNGQVLSMAGKRLVEKDGK-----------------TEIEDYALGTMTSSYELGSTVKGATVLTGFETKAITPGTYFYDAPMKFKGTREK---------KEFGNIDDLRALQVSSNVYMFHTALKIAFDKMRYYFRQFGLGV---PTGIDLPNETAGQIGKKDNLLDYSIGQYD-TYTPLQLVQYISTIANGGYRMKPQIVQEVREQTGKVVHAVEPIVLNKVMKEEYIKQVKEGFRKVFQDGDGTGQKASYKPAGKTGTAQTVYGGERECYNLTLAGYAPYDNPEVAFSVVVPWVMND----KSGINSDIGKEVLDAYFELKN 692
27 -72.800IDP00305 gene: pbpB; penicillin-binding protein 3 CBU_0118 [Coxiella burnetii RSA 493]  ali follow..  23  133.................................NISGVFFQREYRRYYPEGEVAAHVVGLTNDDQGQEGLELAYNRWLGGTPGDRLGHVIADVAVQKPAQGHDLNLSIDHRIQYLAYKALEETVSHAQSGSVVVLDVKTGEILAMVNQPSYNPNNRPTDHDGR---------------YRNRAVTDMFEPGSVNKPFTIALALESGRYKPDTQINTNPGWMKIGGYRIHDDL-----NYGVVTLTQLLQKSSNIAAAKILLSLTPQHYYTLLHAFGFG---ERTTSGFPGESNGALIVPSVVATLAYGYG-LAVTTLQLAQGYAVLAAGGIRKPVTFVKVNESPQGVRV-----------LPENVAKTVIKMLETVVQGTGTRAQVYGYSVAGKTGTAYIAGPNGYFKHRASFVGIAPANNPRLVVAVVIRD---QGQHFGGIVAAPLFSKIMSGALR... 539
28 -72.400IDP95083 RecName: Full=Penicillin-binding protein 2X; Short=PBP-2X; Short=PBP2X P59676 [Streptococcus pneumoniae R6]  ali follow..  18  173................................AEVKGIDFTTSPNRSYPNGQFASSFIGLAQSLLGTSGMESSLNSILAGTDGDRLGNIVTEQVSQRTMDGKDVYTTISSPLQSFMETQMDAFQVKGKYMTATLVSAKTGEILATTQRPTFDADTKEG---------------TEDFVWRDILYQSNYEPGSTMKVMMLAAAIDNNTFPGGEVFNSSELKIADATIRDWD-VNEGLTGGRMMTFSQGFAHSSNVGMTLLEQKMGDATWLDYLNRFKFG---VPTRFGLTDEYAGQLPNIVNIAQSSFGQG-ISVTQTQMIRAFTAIANDGVMLEPKFISAIYDPNDQTARKSQKEIVGNPVSKDAASLTRTNMVLVGTTGKPTVTVPGQNVALKSGTAQIADEKNGGYLVG-AVSMSPAENPDFILYVTVQQPEHYSGIQLGEFANPILERASAM...... 614
29 -69.700IDP02787 gene: ftsI; penicillin binding protein (peptidoglycan synthetase) [Francisella tularensis subsp. tularensis SCHU S4] FTT0697 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  24  140.................................DITGIHVIREFKRYYPMAEVASHIVGFTNDGKGQEGLELEFNKFLSGQDGDLHGGVASKIEDKEPKNGRNLQISIDSRLQYIAYKYLKEGVINSEAGSVIVEDIHIGEILAMANYPSYNPNSMADAYPDR---------------RRNRAITDVYELGSVMKTFAAATALTYGVTSDEPVIDTHPGFYRIGKNTVRDER-----DYGDINLRHILMKSSNVGVSKMILGLTEPSLESSLRNFGFG---SKTGIKLPGERDGYVPTKDQLATLSFGYG-MNATDLQLIAGVSAIANNGQYIKPTILKRRPGEEIET---------RPIISEKNSKEMISMMQSVVEGTGSKAQIPLYHVAGKTGTARMLSGGNYGAKYASFVGIVPATDPKLAIVVTIKD--KGDQYGGGSVAAPVFADVALNSLQ... 553
30 -68.800IDP92623 gene: ftsI; peptidoglycan glycosyltransferase [Acinetobacter baumannii AB0057] AB57_3655 [Acinetobacter baumannii AB0057]  ali follow..  21  182.................................NFQGVYAEKTYKRYYPQPQPNAQIIGLTNEGQGIEGLEMQLNKQLSGVDGDKRGNRLKVSEVREGEPGENITLSIDSRLQYIMYRELTAAGVNARSATAIAVDVKTGEILAMTSWPSYNPNDKNG---------------SNKDAMRNRGAIDMFEPGSTMKPFTISAALETGQYTPNTIVNTSPGSMRLGWHTIRDTH-----NYGALTVSGVIIKSSNVGSAKIALSLPKETLPSFFNRVGFG---KRSAVRFPGESSGLVLNSSQIGTMAYGYG-LNATILQLAQGYAMLANHGVKMPLSLHKLDQPPKGEQV-----------LNPKIADQVLLMLEQVTGGTAKQANIPGYRVGGKTGTAHKLRADGKGYSNALFAGVAPISDPRLAVIVVVEN---QGRYYGGLVAAPVFARIMQESLR... 591
31 -68.200IDP91876 gene: ftsI; septum formation, penicillin binding protein 3, peptidoglycan synthetase [Acinetobacter sp. ATCC 27244] HMPREF0023_2561 [Acinetobacter sp. ATCC 27244]  ali follow..  23  182.................................NFQGVYTEKSYKRYYPQPQPNAQIIGLTNEGRGIEGLEMQLNTRLAGVDGDKKGNRLKVSEVKEVESGENITLSIDSRLQYIMYRELTAAGVNARSATAIAVDVKTGEILAMTSWPSYNPNDKGG---------------SNKDAMRNRGAIDMFEPGSTMKPFTVAAALESGQYTPNSIVNTAPGTMRLGWHTIRDTH-----NYGALTLTGIIVKSSNVGSAKLALSLPKEALPSFFRRAGFG---QSSDVKFPGESAGLLYSADQLGTMAYGYG-LNATILQLAQGYAMLANHGVEMPLSLHKLDQVPEGRQV-----------LDPKIADQVLMMLEQVTGGTAKQAVIPGYRVGGKTGTAHKLRADRKGYSNALFAGVAPVSDPRLAMIVVVEN---QGRYYGGLVAAPVFAKIMQESLR... 591
32 -46.400IDP02180 putative periplasmic beta-lactamase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0299 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12  2.........................................................................................................................................KKITLFLLFLNLVFGQDKILNNWFKEYNTSGTFVFYDGKTWASSRAMET-FSPASTFKIFNALIALDSGVIKTKKEIFYHY----------RGEKVFLSSWAQDMNLSSAIKYSNVLAFKEVARRIGIKTMQEYLNKLHYGNAKIS-------------------IDTFWLDNSLKISAKEQAILLFRLSQNSL----------------------------PFSQEAMNSVKEMIYLKNM--------ENLELFGKTGFND-------EQKIAWIVGFVYLKDENKYKAFALN---DIDKFEDLYKREKILEKYLDEL..... 249
33 -44.800IDP05542 gene: pbpA; hypothetical protein Cj0504c [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0508 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  19  214.....DLSISRANNVISRMYNLGWISKADYDTAIKEIPQVYDDTLTQNAAPYVVDEVIKQLSPNIKDL-----------------------------KTGGYKIILNIDLDVQNMAQNALKFGYDSTLNGAMVVVNHQSGDVLALVGGVDYEKSNY------------------------NRATQSMRQPGSSFKPFVYQVAINLG-YSPMSEIADISRIFEGGAGNNEDWKPKNEGGLGLITLKEALTRSRNLATINLALDMGLDVLYSKLMEFGFKDIPPNLSIVL---------------------GSFGISPLEYSKFYTMFGNYGTIKDPQIIRQVQDKTGKTIMEFNSNE-RKVSDEAQSFLVLDMMRNVVKGTGRNARVKDIEIAGKTGTTNKSVD-------AWFCGLT----PEIEAIIWYNNKPMRYTEGGARTAAPVFREFLTQYIEKFP 599
34 -44.000IDP06098 penicillin-binding protein [Helicobacter pylori J99] NP_223262 [Helicobacter pylori J99]  ali follow..  19  216.....EFSLSRANDILRRLYSLGWISSNELKSALNEVPIVYNQTSTQNIAPYVVDEVLKQLDQLDGLK------------------------------TQGYTIKLTIDLDYQRLALESLRFGHQDNLNASMIVTETSTGKILALVGGIDYKKSAF------------------------NRATQAKRQFGSAIKPFVYQIAFDNGIPDTARNFENGNYSKNSVQNHAWHPSNYTRKFLGLVTLQEALSHSLNLATINLSDQLGFEKIYQSLSDMGFKNLPKDLSIVL---------------------GSFAISPIDAAEKYSLFSNYGTMLKPMLIESITNQQNEVKTFTPIET-KKITSKEQAFLTLSALMDAVNGTGSLARIKGLEIAGKTGTSNNNID-------AWFIGFT----PTLQSVIWFDNTPIGKGATGGVVSAPVYSYFMRNILAIEP 615
35 -40.700IDP01241 penicillin-binding protein BA_1474 [Bacillus anthracis str. Ames]  ali follow..  20  227.....NKSIERRNVVLSLMKEQGYISDEQYNKEKESGLVLKRGVDDK--YKGKYSQYVDYIVREAMDK-YELTQNEILAG--------------------GYRIYTELDPKKQQAVEDVVNNDSYQLMQTGVVLMNPTTGGVPALVGGRGP------------------------QFLQFNHATQLKRQPGSTLKPLAVVPALEQGYEVYDILKDEP------FNIKEYKPQNSDHTFHGDVTMYEAVAKSYNVSAVWLLEQIGLDKGLKSLERFGIPLVPEDRTYPI-----------------ALGGMHVGTSPFVMAQAYSTFANDGVQVEAHAIREIQNAEGETIGKWYKKE-TRVTSEKISQKMTYLLKGVVKGTGEKAKVTNVDTAGKTGTTQIVNGPSTGAKDSWFVGYT----PDLVGAIWVKTDSDHYVPGGSQITTTMFRDIMKKANANPA 620
36 -40.400IDP00592 gene: mrcB; penicillin-binding protein 1b YPO3393 [Yersinia pestis CO92]  ali follow..  19  370.....KLALERRNLVLRLLQNQGIIDAELYTMLSARPLGVQPKGGVITPQPAFMQMVRQELQQKLGNKVNDL---------------------------SGVKIFTTLDPVSQDAAEKAIEDGVMNDLEAAMVVVDRFSGEVRAMVGGSQPQFAGF------------------------NRAMQARRLVGSLAKPPTYLAALSEPDYRLNTWLSDQPLSLKLSNGSLWQPKNYDRQFRGQVMLMDALVNSLNIPTVNLGMSVGLDQISATLQRLGIPKSVIN-------------------PVPAMLLGAIDLTPVEVAQEYQTIASGGNRAPLSAVRSVIAEDGTVLYQSFPQA-ERMVPAQASYLTLYAMQQGVVSRSLSAKFGKYNLAAKTGTTNDLRD-------SWFAGID----GKEVTIAWIGRDNNGPTKTGASGALTLYRRYLENQTPLPL 756
37 -39.200IDP00358 hypothetical protein lmo2229 lmo2229 [Listeria monocytogenes EGD-e]  ali follow..  16  138..LVTSGGISGGGSTITQQLAKNALLTQEQTFTKAKEIFMAREIEKTYSKDEIMEMYLNRSYFGNGEWGVENASLKYFGKSAADLNIPEAATIAGLLQAPGYKIYTELDQNYQTSLENVYNNDGLTLVQSGAVLMDPATGGIRALVGG-----------------------RGEHVFRGFNRATQMKAQPGSTMKPLAVTPALQSG-YDVDSMLKDEKITYKGNYTP----TNVGGVYSGEVPMYKAVANSINAPAVWLLDQIGIDKGVKSVEKFGITVPEKDRTLGL-----------------ALGGMSKGASPVEMATAYATFANNGAKPESHIITKIVDPSGNTVYENVPKT-KQIISETVSNEMTSMLLDVINGTGQSAAVSGHEMAGKTGSTQVPFDDTSGTKDQWFVGYT----PNLVGAVWMGYDKTDKTTTSSAGVSSLAHYVMNSGLQYQK 642
38 -39.200IDP00317 gene: ponA; penicillin-binding protein 1A CBU_1887 [Coxiella burnetii RSA 493]  ali follow..  19  220.....KAALLRRDHVLKRMLEVNFITKENYLKAIKAPLTAKYHAATTQVKAP-------YMAEMVREAVVDQYGEEAYDR--------------------GLNVYTTISSKLQKEANRSLRDGLIAYDEGGLVALNPQDGAVNALIGGFDYEHSNF------------------------NRITQAERQPGSNFKPFLYSAALTKGYTLASMINDAPVVMQDSGENALWRPMNDTRKFYGPTSIRMGLIKSRNLVSIRLLQKIGIPYAIEYLTRFGFDPNVLPHSLSL-----------------ALGSAT--LPPLQVASGYAIFANGGYRVTPYFISRIEDQSHHVLFQAKPPRAPQVITPQNAYLITQAMHDVIQGTGRRAKVLN-DLAGKTGTTNDQVD-------AWFSGF----NANLETTVWVGYDNLRSLHYGAQAALPIWIQFMRAALQGQP 727
39 -39.000IDP01240 gene: pbpF; penicillin-binding protein 1 BA_1069 [Bacillus anthracis str. Ames]  ali follow..  16  212.....EKSKERRDLVLSLMHKQGYLTAEESVRYQGKTIALYKNLDENELAYMPYIDMV--IDEAARLYGLSH--QEVLRG--------------------GYTFVVPMDEKIQKVAYNQFQDARNEGAQGAFLLMDNRTGGIKAAIGGRKYVPRGF------------------------NRVFAKR-QPGSVLKPLIVAPALETKKYNPYSLLTNERHSFEGYE------RNYNREYSKEITMYDAILESANVPAVSLLNELGVEEGKQYLEKGNVHIADAGLST-------------------ALGGLKNGVSTFDLVKMYRAFLANGDIVEPHVIDKVLNRHGAVIGESPKVE-TKIFSKQTAWYMTKMLEGVVKEGTAKAGVYSGALAGKTGTTSLPNDDNGARD-MWFVGYT----PNLVGAVWIRIDKEHKLQGESASATKLFKKILTKANVEQK 597
40 -38.900IDP00910 gene: mrcB; penicillin-binding protein 1b STM0190 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  19  362.....KLALERRNLVLRLLQQQKIIDQELYDMLSARPLGVQPRGGVISPQPAFMQMVRQELQAKLGDKIKDL---------------------------SGVKIFTTFDSVAQDAAEKAVVEGIPSDLETAMVVVDRFSGEVRAMVGGAEPQYAGY------------------------NRAMQARRSIGSLAKPATYLTALSQPNYRLNTWIADAPISLRGQVWSPQNDDR-RYSESGKVMLVDALTRSMNVPTVNLGMALGLPAVTDTWTKLGVPKDQLN-------------------PVPAMLLGALNLTPIEVAQAFQTIASGGNRAPLSALRSVIAEDGKVLYQSYPQA-ERAVPAQAAYLTLWTMQQVVQGRQLGAKYPGLHLAGKTGTTNNNVD-------TWFAGID----GSQVTITWVGRDNNQPTKYGASGAMAIYQRYLANQTPTPL 750
41 -38.800IDP01252 penicillin-binding protein BA_5623 [Bacillus anthracis str. Ames]  ali follow..  21  221.....DRAKGRQSLILDEMVEQGYITKKQAASAKKEPLTFASLDTKK--VAEVAPYFQDAVASLLRDVGLDE--QALQKG--------------------GLRIYTTLDPKLQSVAEQAVKDHITTNIQTALVSMNPKTGEVAALVGGTDYNTSQF------------------------NRATQGARQPGSTFKPFLYYAALERGFTPATRLKSEYTVFTLGDGVSKYKPKNYKDYYADFVTMAQALAVSDNVYAVKTNLFLGEDILTKTAKQFGIKSALKD--------------------VPSLALGTSPVKPIEMVNAYSMFANGGKEVKPTFIRRIMDHEGNILYDAHLES-KQVLDKNKAFVMEEMMTGMFNKLSSYAAVTGQSYAGKSGSTE---------TDSWMIGFT----PQIVTGVWVDQPKSISNVAEQGYAKRIWTDTMEKGLDGQP 609
42 -38.700IDP02791 gene: pbpA; hypothetical protein lmo1892 [Listeria monocytogenes EGD-e] lmo1892 [Listeria monocytogenes EGD-e]  ali follow..  17  247.....EAAKKRRDQVLTNMYTHDKITKEEMTEAQKTPITTGLRSKKDREDKIYDSYVTQVLSEIPKEYDVYR---------------------------DGLTIHTALDRDAQEYTEKMLNTNEIDEMQAGIVLQDTKTGRVQAIGGGRKQKVTR------------------------YNYATQVKRSVGSTMKPIADGPAFEYLDWSTAHILEDEPYTYSGGTPI----NNWDFGYKGPISVRQALYQSRNIPALKTLQAVGLDKSEEFVNKLGITYDEGQNVESN-----------------AIGANS--SNPMQMAGAYAAFGNKGIYNKPHTVTKIVLSDGQTEIDTEPQS-TVAMKESTAYMVSDVLKDVLSGTGTSAAVPGVPAAGKTGTTNIPPEPSGAARDSWFAGYT----TNYSIAVWTDDKKKYVSASEQKIAQRMFSKLMAHASAGKT 642
43 -36.100IDP01243 penicillin-binding protein 1A BA_2345 [Bacillus anthracis str. Ames]  ali follow..  17  247.....QRATERRNVVLKLMNRHGYITKAEMEEASKVEVTDKTATVQAMPYPAFMDAVVKEVEKELPDANIGS---------------------------DGLEIYTTLDIDAQKAADRILDANIIDKFQSAFTFMDTKTGEVRAIGSGRGENKAVFKG---------------------HNMAIELDRAAGSTMKPIFDGPAIEYLKWATYHQIDDSPFKYSTGQEV----RNADRSHLGSITMREALKMSRNVPAVKAAKEVGLNKAKEFSEKLGITLKSAPEST-------------------AIGTNE--VSPTEIAGAYATFGNGGKYAKPHFVKKVVYPDGKSQSFGQKP--KQVIADSTAYMITDMLRSVVTGTGTAANISSLDVAGKTGTTNYDSKPESATRDSWFAGYT----PQYTMAVWTGYMKDGKSSKNTKIAQLIFKEMMSEMATDKS 642
44 -34.900IDP00591 gene: mrcA; penicillin-binding protein YPO0145 [Yersinia pestis CO92]  ali follow..  16  224.....DRAVARRNVVLLRMLDEKYITQAQYDQARSEELVANYHVPQIAFSAP-------YLAEMVRQEMIKRYGENAYTD--------------------GYQVYTTITRKLQLAAVDSLRANVLAYDMSALVSIDPNNGAIKALVGGFDFNQSKF------------------------NRATQALRQVGSNIKPFLYTAAMDKGLTLATILNDLPITRWDSGAGTDWRPKNSPPTYDGPIRLRQGLGQSKNVVMVRAMRAMGVDYAAEYLQRFGFPAQNIVHSESL-----------------ALGSAS--FTPLQLVRGYAVLANGGYLVDPYFITKITDDVGNVLFETKPKVAPHVISTPLAFLMRDALNSNIMGTGWRAGLKRKDIGGKTGTTNSSKD-------AWFSGY----GPDTVTSVWIGFDDHSGAEGGAKTAQPAWNDFMKVALEGLP 797
45 -33.500IDP01242 penicillin-binding protein BA_1572 [Bacillus anthracis str. Ames]  ali follow..  18  247.....ERATNRRNVVLSLMNRHGYITKEEMNNAVKIPVTEGLQPSSEITEMKYQAFLDAVVKEVEKEYPDVNIGSD------------------------GLTIHTTLDQDAQDYAEKIMDGNLIDQFQGSFVFMDTQSGEVRAIGAGRKGSKSTFKG---------------------HNMATDLKRQVGSTMKPIFDGPAIENLQWSTYHQLNDSEYTYSNGKKI----RNATNSYKGDVSLREALKKSLNIPALKTAQAVGLPKSQAFAEGLGMTFKDGKTFEST-----------------AIGSND--SSPLQLAGAYAAFGNGGNYNKPHFVKEVTFPDGKKKSFKPKE--QRAMQDYTAYMVTDVLRDVVKGTGPTAYVSGVDVAGKTGTQNFDADPADANRDSWFAGYT----PQYTMAVWTGYEKNGPSDRYTRIAQQMFQVMMSKFATDKT 648
46 -31.500IDP01007 gene: pbpC; penicillin-binding protein 1C STM2531 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  13  105.QDLTAGRVISGGSTLTMQVARLLDPHSRTFGGKIRQLWRALQLEWHLSKRDILTLYLNRAPFGGTLQGIGAASWAYFGKPPARLSYADAALLAVLPQAPNDKIVTTLDAGLQRQLEDLARARLPARSSLAMIVVDHTDMSVRGWVGSVDLNDDSRFG---------------------HVDMVTAIRSPGSVLKPFVYGLALDDGLIHPASLLQDVPRRTGDYR------GNFDSGFHGPVSMSDALVRSLNLPAVQVLEAYGPKRFAAKLRNVGLPLYLP--------------AGAAPNLSLILGGAG--ARLDEMAAAYSAFARHGKAAKLRLQPDDPLSE------------RPLMSPGAAWIIRRIMADEAQPLPDNALPRIVPLAWKTGTSYGYRD-------AWAIGV----NARYIIGIWTPDGTPVVGQFGFASAVPLLNQVNNLLLAHTG 569
47 -14.900IDP02545 beta-lactamase [Francisella tularensis subsp. tularensis SCHU S4] FTT0611c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  14  20..........................................................................................................QLDDSFKNLENKY------DGKIG-IYTLNTDDKTNIKYNE-------------------------------------SYHFPICSVFKFLLVGAILDY--DMHNQGFLDKKIPINQDDIGKLGYAPITAKNVGKTLTISQLNPASNILVRELG---GLQNLNKFIKKLGD-------------NDTIITADEPEINYTQPHSNINKTTPKAITKDIYKLAFG-----------------------------NILDKKHKDIFIKYLQDNNTGANRFSMPKDWIIGDKTGTCGQYAATNDV------IIWPKNQQP-IALGILYTNPNDKNAPSNEEIIQQAAKLIANDLTNTY. 286
48 -12.900IDP00042 gene: bla1; beta-lactamase BA_2507 [Bacillus anthracis str. Ames]  ali follow..  17  51..........................................................................................................ATHKEFSQLEKKF------DARLG-VYAIDTGTNQTIAYRP-------------------------------------NERFAFASTYKALAAGVLLSTKKLDEVITYTKEDLVDYSPVTEKHVDTGMTLGEIAEAAVRYSDNTAGNILFHKIG---GPKGYEKALRQMGD-------------RVTMSDRFETELNEAIPGDIRDTSTAKAIATNLKAFTAG-----------------------------NALPNHKRNILTKWMKGNATGDKRAGVPTNWVVADKSGAGSYGTRNDIA------IVWPPNRAP-IIIAILSSKD-EKGATYDNQLIAEAAEVIVNAF..... 308
49 -10.200IDP91872 gene: vanYD; D,D-carboxypeptidase VanYD [Enterococcus faecium] ACM47285 [Enterococcus faecium]  ali follow..  15  110..................................................................................................................................NAIVVNKDTDAVL-------YQKNG-----------------------------TDRIAPASTAKMITALTVLEYCSPEEEMRVGAEIEMIHSDSSTAWLMKGDTLTVRQ---LIALMLPSGNDAAYTLAVNTGMDKVNEKARELG-------------------VTDSNFVVPDGYDAEGQYTTAYDLAIIAKAC------LENPIISEIVASNTSYEKWPNGREVTYNNSNELLDPNSPYYRPEVIG-------------LKTGTSSLGGA---------VVSAAVIDGETYICVAM---------GSTKESRFQDSVDILDKIKAQ.. 363
50 -9.970IDP01726 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5252 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  14  41..................................................................................................................................YGITIDADTGEIL------------------------------------YGKREDERSYPASIAKMMTTLLLLENVKEDEEITVTENAIKTESQSKKIKLRAGEKLKRDEA--LKLMLIISADPIAESIAEHIAVKMMNARAKELG-------------------TKHATFKNASGADALGNKVSPYDIAMITKEALKYPVVLE--------------YMNSTRTTLHTSERSPNIANYGREELYDDPYA----------IGSKSGLSALGK----------VVTVDEKDGKRVINVVL---------SSTRKQLYPDTKKMAHYAFQQ.. 277
51 -9.810IDP02617 D-alanyl-D-alanine carboxypeptidase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA1286 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  51..................................................................................................................................FATTIDAKTGDIL------------------------------------YDKNAHHRAFPASMTKVLTAILLMEHTKPEDQFTFSQLALDQEKSNYQIEFQPGETINRNT---LMILMVLSANDVSYAIAERIGANMMNERAKQLG-------------------ATDSHFVTPNGLHDPNHYTTPYDMAMITRGVQKYPEILQ--------------------------AMNTKRTTVTTSRQTVSIFNKSTYFENPFSIGGKTGFTNEAR----------LVLLNEKDGNRIINVVM---------ASQRPEIYEDLKQMADYSFGQ.. 285
52 -9.440IDP01499 gene: pbpG; D-alanyl-D-alanine endopeptidase VCA0870 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  46...............................................................................................................................SANSALVIDLKTNEII------------------------------------YSNNPDAVKPIASVTKLMTAIVTLDAKLPMDAPITIKDAKEMKGVHSRVKIGSEISRKD-----LLLTLMSSENRAAASLAHHYPIKAMNAKAKALGMKNTRFVEPTGLSAKN--------------------VSTARDLVVLLKASKKY-------LLGKLSATDKKTVTFSKPRYTLDFRNTN--RLVHNDNWKID--------------LTKTGFTNAAG----------LVMRTQMGRRQVAFVVL--------DTKGKLSPVGDANRLRTWIETG.. 287
53 -9.160IDP05345 gene: pbpG; penicillin-binding protein 7 [Escherichia coli O157:H7 EDL933] Z3383 [Escherichia coli O157:H7 str. EDL933]  ali follow..  14  42...............................................................................................................................ASGSAMIVDLNTNKVI------------------------------------YSNHPDLVRPIASISKLMTAMVVLDARLPLDEKVDISQTPEMKGVYSRVRLNSEISRKD-----LLLALMSSENRAAASLAHHYPIKAMNAKAKSLGMNNTRFVEPTGLSVHN--------------------VSTARDLTKLLIASKQY-------LIGQLSTTREDMATFSNPTYTLPFRNTN--HLVYRDNWNIQ--------------LTKTGFTNAAG----------LVMRTVINNKPVALVVM--------DAFGKYTHFADASRLRTWIETG.. 283

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 2 4 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Pio F, Pawlowski K, Godzik A. Saturated BLAST: an automated multiple intermediate sequence search used to detect distant homology. Bioinformatics. 2000 Dec;16(12):1105-10.