current user: public

If you have questions about the server, please let us know.

Query: gi|15607161|ref|NP_214533.1| hypothetical protein (Rv0019c) [Mycobacterium tuberculosis H37Rv], from M.tuberculosis

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# Score Template Links and tools%idFirst MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGLALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRHARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRPLast
1 -5.290HGC01213 gi|163579070|dbj|BABE01006032.1|2.0 TMP01709;  ali follow..  10  53.........RIVAGTVLLLIIALIVFCVYSLGRGIGAVNSMIHHDEVYAISRDATPAPKKVSNVKDCSASDVTLQLSAASQSVPVGGSLDFTATIVHEGSGNYLVDGSDSGRVLTITSGQETIYKSDVCPADSRLLLMAKGDKDV.......... 188
2 -3.630PB015266 gi|154494998|ref|ZP_02034003.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]gi|154085548|gb|EDN84593.1| hypothetical protein PARMER_04044 [Parabacteroides merdae ATCC 43184]  ali follow..  1.......MKRIVSMMVIFTLLLGGMTHVQAQTSKAAXXXXXXXXXXXXXXXRLAKDAVMGEEAFNNAMQAITNRSFVLEANSVQPLNGRVYYVNSNTNFVSLNDGQAMVQ-----YPGPNGLGGITVQGSASNVQVKQENNGNVYL......... 140
3 -3.210PB062763 Q9F6U5_BACTN/1-245 PB062763; Pfam-B_62763;  ali follow..  1MTKVFLIVSVACNVWFLLMLLSDRITETKFVRFLKGAAGLWRSLGTKSEKQDTLHSEASDEDADIIGKSTTAAISTQEAAISEKGIELSEEEATFDDGNTETASRPTQVPEDGSAFEDIDMAVRT-IKKDSPSEAEMRHAGKVMELDGTEL.... 191
4 -2.980HGC00044 gi|162658718|dbj|BAAX01000887.1|1.0 TMP00920;  ali follow..  37......VAYGFGY-GLSYTFTQEIQGQPEISVNIDSETGAPQAYATFNVKVTNTGKVPGKTSVQIYGQAPYTEGGLEKVAIQLL-GASEIVSVKVD-------------------LQYIASYDMEHDNGDGTTGTYVLDPGTYFAAGNGA..... 171
5 -2.900HGC00672 gi|162843654|dbj|BABA01001055.1|4.0 TMP00845;  ali follow..  17.......ILAFAVIFVVVIFVYMSMRLQQQK--------AENRNFIETYTITLTKGFAGDSTSIFINDSLLVNRTMTEEPFILEVKRFAEQSALM-----------VNNATEKLSLFELSEQGGEYRFEKEGEEVKPTGAG.............. 132
6 -2.840PB044380 A7LRP7_BACOV/1-223 PB044380; Pfam-B_44380;  ali follow..  1MGTIVYLSIRLACACYILVCGQKKKIREICDLLYTKLPPVKEKELENVLSEPGGESGIMGSTCFVYLDEDAGKSVAPYMSQPL----ETAADFIGEEEDVAEEEVECKLPSRVVTPDDLDNAGNVLFK----LNDADKDEEKSLRAALTLHTIR. 172
7 -2.710PB006791 A6TXD6_9CLOT/1-181 PB006791; Pfam-B_6791;  ali follow..  109..................................................................................................DLSYSYALLDENNNGMIITGIYGRSETVTYAKPVKSNYSLSVEELQALQRAK..... 163
8 -2.500PB009510 _JGI.0345302_ 2004041369 [Human Gut Community Subject 8]  ali follow..  261........................................................................DGSVPMDGNLLMNYCRADNKTTANIKIPVASISESYGNATCTVKRNLAYFDGSLMNGSRLLNSLNRKE............... 329
9 -2.480PB003645 Q65HI2_BACLD/1-230 PB003645; Pfam-B_3645;  ali follow..  32...LLLFVLGVSFMLVSQIFSSEPSQEPAADQPAASQKATSESTVQSGEGEKEVFKPASDDKPKESIQDYEQEYENQLKDILETIIGVEDVSIVVNVDATSLKIFEKNRKTQETSTNETDKQGGK-VSEMSSDEEIVIIKNGDKETPVVVQTKKP 184
10 -2.420HGC00267 gi|163310129|dbj|BABD01000566.1|6.0 TMP00066;  ali follow..  13  2.................................................DEKEVSEMQEEMMTVLVVEPMKAPYVKHIPNELEDLQQAVGGDI---------EMTYPFDDEVGILLNGNGKFEGLPLNRALYDDHGQVYDGTFLVVG........ 93

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35