current user: public

If you have questions about the server, please let us know.

Query: gi|15607163|ref|NP_214535.1| hypothetical protein (Rv0021c) [Mycobacterium tuberculosis H37Rv], from M.tuberculosis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MVLSTAFSQMFGIDYPIVSAPMDLIAGGELAAAVSGAGGLGLIGGGYGDRDWLARQFDLAAGAPVGCGFITWSLARQPQLLDLALQYEPVAVMLSFGDPAVFADAIKSAGTRLVCQIQNRTQAERALQVGADVLVAQGTEAGGHGHGPRSTLTLVPEIVDLVTARGTDIPVIAAGGIADGRGLAAALMLGAAGVLVGTRFYATVEALSTPQARDPLLAATGDDMCRTTIYDQLRRYPWPQGHTMSVLSNALTDQFEDTELDILHREEAMARYWRAVAARDYSIANVTAGQAAGLVNAVLPAADVITGMAQQAARTLTAMRAVLast
1 -81.1003bo9_A mol:protein length:326 Putative nitroalkan dioxygenase  ali model follow..  30  7MTVRTRVTDLLEIEHPILMGGMAWAGTPTLAAAVSEAGGLGIIGSGAMKPDDLRKAIRQKTDKPFGVNIIL-VSPWADDLVKVCIEEKVPVVTFGAGNPTKYIRELKENGTKVIPVVASDSLARMVERAGADAVIAEGMESGGHIG------EVTTFVLVNKVSRSVNIPVIAAGGIADGRGMAAAFALGAEAVQMGTRFVASVESDVHPVYKEKIVKASIRDTVVTGAK---------LGHPARVLRTPFARKIQEMEFENPMEEMLVGSLRRAVVEGDLERGSFMVGQSAGLIDEIKPVKQIIEDILKEFKETVEKLRGY 317
2 -80.6002z6i_A mol:protein length:332 Trans-2-enoyl-ACP reductase II  ali model follow..  32  1..MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGNAPKEVVKANIKSLTDKPFGVNIML-LSPFVEDIVDLVIEEGVKVVTTGAGNPSKYMERFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGK-LTTMTLVRQVATAI-----SIPVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISAQH---------FGHAVRAIKNQLTRDFELAEKDAFKQEDGAGALAKAVVHGDVDGGSVMAGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASR 316
3 -78.6004iql_A mol:protein length:333 Enoyl-(Acyl-carrier-protein) reductase II  ali model follow..  26  12GSHMNRICELLGIEHPIISGGMVWCSGWKLASAVSNCGGLGLIGAGSMHPDNLEHHIKAATDKPFGVNVPL-LYPEMDKIMEIIMREHVPVVVTSAGSPKVWTAKLKAAGSKVIHVVSSATFARKSEAAGVDAIVAEGFEAGGHNGRE----ETTTLCLIPEVVDAVNIPVVAAGGIASGRAVAAALALGADAVQVGTRFALSEESSAHEDFKAHCRRSVEGDTMLSLK----------AVSPTRLLKNKFYQDVFAAEQRGASVEELRGRAKQGIFEGDLHEGELEIGQAVSQISHAETVAEIMVDLVDGYKRSLAGMPTE 326
4 -77.5002gjl_A mol:protein length:328 hypothetical protein PA1024  ali model follow..  23  3.VFRTRFTETFGVEHPIMQGGMQWVGRAEMAAAVANAGGLATLSALTQSPEALAAEIRELTDRPFGVNLTLLPTVPYAEYRAAIIEAGIRVVETAGNDPGEHIAEFRRHGVKVIHKCTAVRHALKAERLGVDAVSIDGFECAGHPGED----DIPGLVLLPAAANRLRVPIIASGGFADGRGLVAALALGADAINMGTRFLATRECPIHPAVKAAIRAADERSTDLIMRS---------LRNTARVARNAISQEVLAIEARGGAGYADIARGRQVYQQGDTDLGIWSAGMVQGLIDDEPACAELLRDIVEQARQLVRQRLE. 322
5 -74.3005lsm_A mol:protein length:359 FMN-dependent nitronate monooxygenase  ali model follow..  24  1..MPCRLTRLFGIEFPIIQAPMAGVQGSALAIAVSEAGGLGSLPCAMLSLEALEAELRSQTAKPINVNFFCHREPYSKAQAEVLAKFKPEVVSFHFGLPDELLLEIKSWGSKVISTATTVEEALWLEARGADAIIAQGLEAGGHRGHFLSE-QLGTFSLLPQIIAAVEIPVIAAGGIVDATTVRAAMTMGASAVQVGTAYLLCPECNTSAIHREALQSDAAQHTALTNLF---------SGRPARGIVNRFMAEMGPMNEAVPDFPLAAGLRTAAERLGFWDFSPLWCGQNASGCRAI-PAADLTRSFVLSLPSSCVEPQEK 357
6 -73.3004qit_A mol:protein length:357 Nitronate monooxygenase family protein  ali model follow..  28  1..MTDRFTRLLGIQQPIIQAPMLGVSTPALAAAVSNAGGLGSIAITGSAAEKGRALIRGLTDKPFNVNLFCHRPLEDPTLLPMLLEERPAAVSFHFGAPPRQVRALQAVGIRVLVCATTPEEAALVEAAGADAVVAQGIEAGGSRGVFEPERAIGTLALVRLLAARGSLPVVAAGGIMDGRGIRAALELGASAVQMGTAFVLCPESSANAAYREALKGPRAARTALTVTM---------SGRSARGLPNRMFFDAAAPGVPPLPYDATKALQTAALARGNHDFAAQWAGQGAALAREL-PAAELLRTLVEELRG........ 351
7 -73.2004q4k_A mol:protein length:357 Nitronate Monooxygenase  ali model follow..  28  1..MTDRFTRLLGIQQPIIQAPMLGVSTPALAAAVSNAGGLGSIAITGSAAEKGRALIRGLTDKPFNVNLFCHRPLEDPTLLPMLLEERPAAVSFHFGAPRDQVRALQAVGIRVLVCATTPEEAALVEAAGADAVVAQGIEAGGHRGVFEPERAIGTLALVRLLAARGSLPVVAAGGIMDGRGIRAALELGASAVQMGTAFVLCPESSANAAYREALKGPRAARTALTVTM---------SGRSARGLPNRMFFDAAAPGVPPLPYDATKALQTAALARGNHDFAAQWAGQGAALAREL-PAAELLRTLVEELRG........ 351
8 -70.9003bw2_A mol:protein length:369 2-nitropropane dioxygenase  ali model follow..  26  1..MSSALTDLFPL--PIVQAPMAGVSVPQLAAAVCEAGGLGFLAAGYKTADGMYQEIRGLTGRPFGVNVFMPQPDGYDAKLAVLLDDPVPVVSFHFGVPDRVIARLRRAGTLTLVTATTPEEARAVEAAGADAVIAQGVEAGGHQGTHRDSSGIGLLSLLAQVREAVDIPVVAAGGIMRGGQIAAVLAAGADAAQLGTAFLATDESGAPGPHKRALTDPLFARTRLTRAF---------TGRPARSLVNRFLREHGPYAPAAYPDVHTSPLRKAAAKAGDAQGMALWAGQGHRMAREL-PAGRLVEVLAAELAEARTALSDA 354
9 -67.7006bka_A mol:protein length:374 Nitronate monooxygenase  ali model follow..  22  4..QIQSFLKTFEVRYPIIQAPMAGASTLELAATVTRLGGIGSIPMGSLSEKCDADELVGDSGRIVNLNFFAHKEDPQHPTVRLLKNLKPKIVSFHFGLPHEVIESLQASDIKIFVTVTNLQEFQQAYESKLDGVVLQGWEAGGHRGGQLKTLDLVSTIVDYIASISNPPFIIAAGGIHDDESIKELLQFNIAAVQLGTVWLPSSQATISPEHLKMF-QSPKSDTMMTAAI---------SGRNLRTISTPFLRDLHQSSPLASIPDYPLPANDAKQSGKGPQYSAFLAGSNYKSWKDTRSTEEIFSILVQDL.......... 374
10 -53.2004yx6_A mol:protein length:547 Omega-3 polyunsaturated fatty acid synthase subunit PfaD  ali model follow..  17  88SLGDSNFRRVHGVKYAYYAGAMAGIASEELVIALGQAGILCSFGAAGLIPSRVEAAIKRLPNGPYAFNLIHSPSEQIGNKVIAKISRTEVATKFMEPAPVKILQQLVNEG------LISEDQMLMAQSVPMADDITAEADSGGHTDN-RPLVTLLPTIIQAKYQYKTPIRVGAGGGIGTPDAALATFNMGAAYIVTGSINQACVEAGASEHTRKLLATTEMADVTMAPAADMFE-----MGVKLQVVKRGTLFPMRANKPAEERQKLEEQVFRASLDEIWAGTVAHFNERDPKQIERALDMALIFRWYLGLSSR........ 466
11 -52.1004z38_A mol:protein length:470 MlnA  ali model follow..  15  32...DQSFKEDYGLTYAYLAGAMHGISSAEMLIRLGKKGMLGFFGTAGLPIREIEQALISINGQPYGMNLRFEPDHQIPHNRIIAKVSRPEVAAAFLSPPPQIVKRMCQHG------MLTEEQAEWLSRIPAADDIIIEADCGSNTEQ-SSLTAMLPFFMMETHKYARKIRIGAAGGIGTPESAASAFLMGADFIMTGSINQCTVEAETSGFVKEMLSGTGICDTAYAPSETLFE-----FGTKVQVLKKGTLFPVRANKDEKTKIQLENDYFNKTFDEIYESLIEKQPNLAQKAERNQKYKMLLLFK............... 396
12 -51.4004fo4_A mol:protein length:366 Inosine 5`-monophosphate dehydrogenase  ali model follow..  14  33ADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAQVHQVKISGGLRVGAAVGAAPGNEERVKALVEAGVDVLLIGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMGSLGAM---------SKGSSDRYFQTDNAADKLVPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKE........ 348
13 -50.9004cw5_A mol:protein length:454 DFNA  ali model follow..  18  14.LGNEDFKKDYNIQYAYMTGSMYGIASEQMVIKAAKAGMLGFFGTGGLSIERIGQAIGTIQGETFGMNLLHHMPDKEVRMIDLYLKNGIHLIEASAFMPAHVLERLVSDNR-----LTAGEAALAKEIPMADDICVEADSGGHTDQGIMPAMIRLRDRMMEKHGYAKKVRIGAAGGIGTPEAAAAAFLLGAEFIGTGSINQCTVEAGTSDSVKDLLQEANVQDTSYAPAGDMFE-----AGARVQVLKKGLFFPARANKLFDLYFKWYFSHTTRLALEGKSESKIIHCGPALGAFNQ-RHVDLIGKQLMEETAGLLAQ.... 447
14 -48.7003khj_A mol:protein length:361 Inosine-5-monophosphate dehydrogenase  ali model follow..  15  32VSLETKLTKNVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKNMDMESQVNEKVKNSGGLRVGAAIGVNEIERAKLLVEAGVDV-LDSAHGHSLNIIRTLKEIKSKMDVIVGNVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVQITAIEKCSSVASKFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKELIGDTVYKYYRGMGSVGAMK---------SGSGDRYFQEKRPENKMVPEGIEGRVKYKGEMEGVVYQ----VEITTSGLRESHVHDVEIVKEVMN................ 358
15 -48.5004q32_A mol:protein length:363 Inosine-5`-monophosphate dehydrogenase  ali model follow..  14  31VSLKTQLTKKIQLNIPLMSASMDTVTESKMAIAMAREGGIGIIHKNMTIEDQAREVDRVKRSGGLLCGASI-VDAVVKAKVDVIVLDTAHGHSKGVIEGVKRIKAKYPELQVIAGNIATPEAVRDLAEAGADCVKVGIGPGSICTTRIVAGVQLTAVMDCAEEGKKLGIPVIADGGLKYSGDIVKALAAGACAAMMGSIFAGCEEAPGAIEIYQGRSYKVYRGMGSLGAMAKGSSDRYFQNGTKKFVPEGVEGRIAYKGHLADTIYQLIGGIKSGMGYLGAPTVQTSAGFRESHPHDINITKEAPNYSVNQ........... 363
16 -47.5004fez_A mol:protein length:388 Inosine-5`-monophosphate dehydrogenase  ali model follow..  14  33ADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFIHKNMSIEQQAAHQVKIFESGGAKDFHKAESKPNVEAGVDVLLIDSSHGHSEGVLQRIRETRAAYPHLEIIGGNVATAEGARALIEAGVSAVKVGIGPGSICTTRIVTGVQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAPGEVILYQGRSYKAYRGMGSLGAM---------SKGSSDRYFQTDNAADKLVPEGIEGRIAYKGHLKEIIHQQMGGLRSCMGLTGSATVEDLRTKAQFVRISGAGMKE........ 370
17 -45.1005ahl_A mol:protein length:400 INOSINE-5`-MONOPHOSPHATE DEHYDROGENASE  ali model follow..  17  42VSLKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAAEVRKHETAKAKTYPLASKDEADTGERVAALVAAGVDVVDTAHGHSKGVIERVRPDVQVIGGNIATAEAAKALAEAGADAVKVGIGPGSICTTRIVAGVQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGEIELFQGRSYKSYRGMGSLGAM---------SGSQGSSDRYFQDASAGAEKLVPEGIEGRVSADIQQMRTQPQFVRITGAGMAESHVHDVQITKEAPN................ 390
18 -44.9004my1_A mol:protein length:384 Inosine-5`-monophosphate dehydrogenase  ali model follow..  15  48VSVKTVLSESLQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQVDKVKRSGGLLVGAAVGVTADAMTRIDALVKASVDAIVLGVIDKVKEVRAKYPSLNIIAGNVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVQLTAVYDCATEARKHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAM---------EKGSKDRYFQEGNKKLVPEGIEGRPLADTVHQLVGGLRAGMGYCGASGAGLLESHPHHVQITKEAPN................ 375
19 -43.3004mjm_A mol:protein length:385 Inosine-5`-monophosphate dehydrogenase  ali model follow..  14  33VSVKTVLSESLQLNIPLISAGMDTVTEADMAIAMARQGGLGIIHKNMSIEQQAEQKVKRSESGGIKDIEKVIEFPNVKASVDAIVLDTAHGHSQGVIDKVKEVRAKYPSLNIIAGNVATAEATKALIEAGANVVKVGIGPGSICTTRVVAGVQLTAVYDCATEARKHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESPGETEIYQGRQFKVYRGMGSVGAM---------EKGSKDRYFQEGNKKLVPEGIEGRVPYKVGGLRAGMGYCGAQDLEFLRAGLLESHPHHVQITKEAPN................ 382
20 -42.6005upx_A mol:protein length:386 Inosine-5`-monophosphate dehydrogenase  ali model follow..  12  33VDLSVEMAPSLKLNVPIWSAGMDTITEAKMAIAIARQGGIGVVHKNMSIEQQAEEKVKRSESGGIKDIEKVIEFPNIEAGVDAIVIDTAHGHSAGVINKISEIRQTFKDVVIVAGNVATAEGARALFEVGVDIVKVGIGPGSICTTRVVAGVQITAIYDCATVAREFGKTIIADGGIKYSGDIVKALAAGGNAVMLGSMLAGTDESPGETEIFQGRQFKTYRGMGSLAAME--------HGSKDRYFQADAKKLVPEGIEGRVPYK-VGGIRSGMGYTGSPDLRHLRAGLRESHPHDIQITKEAPNYSIS............ 386
21 -42.1005upy_A mol:protein length:364 Inosine-5`-monophosphate dehydrogenase  ali model follow..  12  33VDLSVEMAPSLKLNVPIWSAGMDTITEAKMAIAIARQGGIGVVHKNMSIEQQAEEIEKVKRSGGLLAAAAVGITNDTFVRVEKLIEAGVDAIVIGVINKISEIRQTFKDVVIVAGNVATAEGARALFEVGVDIVKVGIGPGSICTTRVVGVPQITAIYDCATVAREFGKTIIADGGIKYSGDIVKALAAGGNAVMLGSMLAGTDESPGETEIFQGRQFKTYRGMGSLAAMEHGSKDRYFQADAKKLVPEGIEGRVPYKGSVADIIFQLVGGIRSGMGTGSPDLRHL-AGLRESHPHDIQITKEAPN................ 360
22 -41.3004zqm_A mol:protein length:407 Inosine-5`-monophosphate dehydrogenase,Inosine-5`-monophosphate dehydrogenase  ali model follow..  13  67ADTSSQLTKKIRLKVPLVSSAMDTVTESRMAIAMARAGGMGVLHRNLPVAEQAGQVEMVKRSGGLLVGAAVGVGGDAWVRAMMLVDAGVDVLVVDTAHVGKLKSEVGDRVEVVGGNVATRSAAAALVDAGADAVKVGVGPGSICTTRVVAGVQITAILEAVAACRPAGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAEAPGELIFVNGKQYKSYRGMGSLGAM---------RGRGGATSYSKDRYFADDALSEDKLVPEGIEGRVPFRGPGGLRAAMGYTG--SPTIEVLQQAQFVRITPAGLKESHPHDVAMT 398
23 -39.6004mz8_A mol:protein length:406 Inosine-5`-monophosphate dehydrogenase  ali model follow..  14  45VKIHTKLTKNITLNMPLISAAMDTVTEHRAAIMMARLGGLGVIHKNMDIASQVRKRVKKSESGGIKDLKKRKEYPDVEAGVDVVVLDSAHGHSKGIIDTVKAIKAKYPNLDLIAGNIATAAAAKALCEAGVDAVKVGIGPGSICTTRIVSGVQISAIDECVEEANKFGVPVIADGGIKYSGDIAKALAVGASSVMIGSLLAGTDESPGELFTYQGRQYKSYRGMGSLGAM---------QKGSSDRYFQQGTAQDKLVPEGIEGRVPYVGSIRSVVHQLLGGLRSSMGYVGAKDIEDFQKRAEFVEITTAGLKE........ 380
24 -35.0003ffs_A mol:protein length:400 Inosine-5-monophosphate dehydrogenase  ali model follow..  13  29VSLETKLTKNVSLKIPLISSAMDTVTEHLMAVGMARLGGIGIIHKNMDMESQVNKVKNWISNLEKNESTPDQNLDNEIERAKLLVEAGVDVIVLDSANIIRTLKEIKSKIDVIVGNVVTEEATKELIENGADGIKVGIGPGSICTTRIVAGVQITAIEKCSSVASKFGIPIIADGGIRYSGDIGKALAVGASSVMIGSILAGTEESPGEKELIGDTVYKYYRGMGSVGAM---------SGSGDRYFQEKRPENKMVPEGIEGRVKYKGELRSCMGYLGSASIEELWKKSSYVEITTSGLRESHVHDVE............. 390
25 -34.0001eep_A mol:protein length:404 INOSINE 5`-MONOPHOSPHATE DEHYDROGENASE  ali model follow..  12  29VSLKTQLTKNISLNIPFLSSAMDTVTESQMAIAIAKEGGIGIIHKNMSIEAQRKEIEKVKTNNKLRVGAAVSIDIDTIERVEELVKAHVDILVIDSAELIKKIKTKYPNLDLIAGNIVTKEAALDLISVGADCLKVGIGPGSICTTRIVAGVQITAICDVYEACNNTNICIIADGGIRFSGDVVKAIAAGADSVMIGNLFAGTKESPSEEIIYNGKKFKSYVGMGSISAM---------RGSKSRYFQLENNEPKKLVPEGIEGMVPYSGKLKDILTQLKGGLMSGMGYLGAATISDLKINSKFVKISHSSLKE........ 394
26 -34.0004utt_A mol:protein length:229 PUTATIVE N-ACETYLMANNOSAMINE-6-PHOSPHATE 2-EPIMERASE  ali model follow..  17  1....GSMLDVVKGNQALSDEPLHSSFIGRMAIAAKQGGAAAIRAQGVNDINEIKEVTKLPIIKRNYDDSEIYITPTMKE-VDELLKTDCEMIALDATNVKDLVDAIHAKGRLAMADISTLEEGIEAEKLGFDCVSTTLSGYTPYSKQSNSV----DFELLEELVKTVKIPVICEGRINTPEELKKALDLGAYSAVVGGAITRPQQ--ITKRFTDIL.......................................................................................................... 222
27 -30.2005z9y_A mol:protein length:252 Thiazole synthase  ali model follow..  13  1VAESKLVIGDRSFASRLIMGTGGATNLAVLEQALIASGTLDLLNRLGITPLPNTAGSRSAAEAVLTAQLAR-EALNTNWVKLEVIADERTLWPDAVELVRAAEQLVDDGFVVLPYTTDDPVLARRLEDTGCAAVMPLGSPIGTGLG-------IANPHNIEMIVAGARVPVVLDAGIGTASDAALAMELGCDAVLLASAVTRAADPPAMAAAMAAAVTAGYLARCAGRI............................................................................................. 239
28 -28.2001y0e_A mol:protein length:223 Putative N-acetylmannosamine-6-phosphate 2-epimerase  ali model follow..  14  1....AMLPHGLIVSQALPDEPLHSSFISKMALAAYEGGAVGIRANTKEDILAIKETVDLPVVKRDYDHSDVFITATSKE-VDELIESQCEVIALDATLQQR-YIRTHAPNVEIMADIATVEEAKNAARLGFDYI---GTTLHGYTSYTQGQLLYQNDFFLKDVLQSVDAKVIAEGNVITPDMYKRVMDLGVHCSVVGGAITRPKE--ITKRFVQVM.......................................................................................................... 221
29 -27.4004xtd_A mol:protein length:413 Inosine-5`-monophosphate dehydrogenase,Inosine-5`-monophosphate dehydrogenase  ali model follow..  20  58VVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGIIHHNCTAEEQAELASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSNMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRDGKRLKTYRGMGSIDAM............................................................................................ 314
30 -24.2002htm_A mol:protein length:268 Thiazole biosynthesis protein thiG  ali model follow..  12  11..LKSRL--ILGSDFGVMREAIAAAKAEVVTVSVRRVELKAPGHVGLLEALEGVRLLAGARTAEEAVRLLGRLLTGERWVKLEVIPDPTYLLPDPLETLKAAERLIEEDFLVLPYMGPDLVLAKRLAALGTATVMPLAAPIGSGWGVRTRAL-----LELFAREKASLPPVVVDAGLGLPSHAAEVMELGLDAVLVNTAIAEAQDPPAMAEAFRLAVEAGRKAYLAGPM............................................................................................. 239
31 -23.6005j5r_A mol:protein length:389 Inosine-5`-monophosphate dehydrogenase,Inosine-5`-monophosphate dehydrogenase  ali model follow..  12  49ADTSSQLTKKIRLKVPLVSSAMDTVTEARMAIAMARAGGMGVLHRNLPVAEQAAQVETVKRSGGLLVGAAVGVGDDAWERAMALRDAGVDVLVVVLDMVHRLKTTVGDEIEVVGGNVATRAAAAALVEAGADAVKVGVGPGSICTTRVVGAPQITAILEAVAACAPHGVPVIADGGLQYSGDIAKALAAGASTAMLGSLLAGTAESPGELILVNGKQFKSYRGMGSLGAMQGRGGA--KSYSKDRYFQDDALSEDKLVPEGIEGRVPFRGPLSTVIHQGGLRAAMGYTG--SATIEELQQAQFVQITAAGLKESHPHDI... 377
32 -22.8003q58_A mol:protein length:229 N-acetylmannosamine-6-phosphate 2-epimerase  ali model follow..  13  4MSLLARLEQSVHENGGLIVSCQPVPGSPAMAQAAASAGAVAV----RIEGIENLRTVRPHLSVPI--------ITPYLQDVDALAQAGADIIAFDASF-DSLLTRIRLHGLLAMADCSTVNEGISCHQKGIEFIGTTLSGYTGPITPVEPDLAMVTQLS------HAGCRVIAEGRYNTPALAANAIEHGAWAVTVGSAITRIEH--ICQWFSHAV.......................................................................................................... 227
33 -22.6003igs_A mol:protein length:232 N-acetylmannosamine-6-phosphate 2-epimerase 2  ali model follow..  14  4MSLLEQLDKNIAASGGLIVSCQPVPGSPAMALAAEQAGAVAVRIEGIDNLRMTRSLIIGIIKRDLDESPVRITPFLDDVDALAQAGAAIIAVDGTARQRPVAVEALLARILLTMADCSSVDDGLACQRLGADIIGTTMSGYTTPDTPEEPDLPLVKAL------HDAGCRVIAEGRYNSPALAAEAIRYGAWAVTVGSAITRLEH--ICGWYNDALKKAAS..................................................................................................... 228
34 -22.4001yxy_A mol:protein length:234 Putative N-acetylmannosamine-6-phosphate 2-epimerase  ali model follow..  17  1MPDKPTKEKLMQLKGGIIVSCQALPGEPLMAKAAQEAGAVGIRANSVRDIKEIQAITDLIGIIKKDYPPQEPFITATMTEVDQLAALNIAVIAMDCTKRDSFIRQVKEKNQLLMADISTFDEGLVAHQAGIDFV---GTTLSGYTPYSRQEAGPDVALIEALCK--AGIAVIAEGKIHSPEEAKKINDLGVAGIVVGGAITRPKEI.................................................................................................................... 224
35 -21.1004n6e_A mol:protein length:256 Putative thiosugar synthase  ali model follow..  20  133.........................................................................................................RAEGMELLPFILPDLATARALEEAGCAALRVMASPVASGRG-------IANPAAIRELIEQIGIPVVVEGGIGSARHVAEAMELGASATLVNTALVRAESPLLMAAAMRQAALAGLL.................................................................................................... 242
36 -20.4005zjb_A mol:protein length:253 Putative N-acetylmannosamine-6-phosphate 2-epimerase  ali model follow..  16  49...........................VAMAIAVEQAGAKAL----RIEGVSNVAAVSAAVTIPI-IGIV--RITPFVSDVDGLANAGATVIAFDATSRERIAQAIKNTGCFAMADCSTFEDGLWANSQGVEIVGSTLSGYVGDIEPTVPDFQLVKAFSEA------GFFTMAEGRYNTPELAAKAIESGAVAVTVGSALTRLEV--VTQWFNNATQAAGERKC.................................................................................................. 245
37 -19.6004af0_A mol:protein length:556 INOSINE-5`-MONOPHOSPHATE DEHYDROGENASE  ali model follow..  18  73VSLQSKATKNIVLNTPFLSSPMDTVTEDRMAIALALHGGLGII---NCSAEEQAAMVRRVKKYENGCGAAIGTRPGDKDRLKLLAEAGLDVVVLSQGNSVYQIEFIKW---VIAGNVVTREQAAQLIAAGADGLRI-GMGSGSQEVMAVGRPQGTAVYAVAEFASRFGIPCIADGGIGNIGHIAKALALGASAVMMGGLLAGTTESPGEYFYHE------------GKRVKVYRGMGSIEAMEHTQRGSASGKRSILGLDNAATARYFSEADAVKVAQG------------SGDVADKGSINKFVPYLFTGLQHSLQDAAI. 508
38 -19.4001wv2_A mol:protein length:265 Thiazole biosynthesis protein thiG  ali model follow..  12  1......MSQASSTDTPFLLVGTGKYKDLDETRRAIEASGAEIVTVAVRRTNIGQNPCYDAVEAVRTCRLARELLDGHNLVKLEVLADQKTLFPNVVETLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGCIAVMPLAGLIGSGLG-------ICNPYNLRIILEEAKVPVLVDAGVGTASDAAIAMELGCEAVLMNTAIAHAKDPVMMAEAMKHAIVAGRLAYLAGRM............................................................................................. 248
39 -18.8003r2g_A mol:protein length:361 Inosine 5`-monophosphate dehydrogenase  ali model follow..  17  32...STDRLGKLTLNLPVISANMDTITESNMANFMHSKGAMGAL----HRFMTIEENIQEFKKCKGPVFVSVGCTENELQRAEALRDAGADFFCVAHAHAKYVGKTLKSLRCIMAGNVATYAGADYLASCGADIIKA-GIGGGSVCSTRIKTGFGVPMLTCIQDCSRADRSIVADGGIKTSGDIVKALAFGADFVMIGGMLAGSAPTP................................................................................................................... 238
40 -18.6002a7r_A mol:protein length:366 GMP reductase 2  ali model follow..  18  48..FSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQPDCLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLANGYSEHFVEFVKDVRKRMAGNVVTGEMVEELILSGADIIKV-GIGPGSRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSES.................................................................................................................... 263
41 -18.6001ypf_A mol:protein length:336 GMP reductase  ali model follow..  17  31....TVTLGKHKFKLPVVPANMQTIIDERIATYLAENNYFYIMHRFQPEKRIIRDMQSRGLIASISVGVKEDEYEFVQQLAAEHLTPEYITIDIAHGHSNAVINMIQHI--VIAGNVGTPEAVRELENAGADATKV-GIGPGKVCITKIKTTGGWQLAALRWCAKAASKPIIADGGIRTNGDVAKSIRFGATMVMIGSLFAGHEESP................................................................................................................... 243
42 -18.5005zkn_A mol:protein length:241 Putative N-acetylmannosamine-6-phosphate 2-epimerase  ali model follow..  17  43............................RMAYAAYSGGAAGIRANTVEDIKEIKKNVSL---KKVYNNSDVYITPTIKE-VEDLINEGVQIIAIDATDLKNFIAEIKEKNQLFMADISSVDEALYAEKIGFDIVGT------TLVGYTDYTKNYKALEELKKVVKVVKIPVIAEGNIDTPLKAKKALEIGAFAVVVGGAITRPQQ--ITKKFVDEM.......................................................................................................... 234
43 -18.2002qr6_A mol:protein length:393 IMP dehydrogenase/GMP reductase  ali model follow..  12  49VDTTWHIDA-YKFDLPFMNHPSDALASPEFVIEMGKQGGLGVINAEGLWGRHATRTLQELHAAPLDTELLS-SPQNVREIAPIVIKAGADLLVITLISAEHVNTGGEALNLKIAGGVNDYTTALHMMRTGAVGIIVGGGENTNSLGMEVSMATAIADVAAARETGGRYVHIIADGSIENSGDVVKAIACGADAVVLGSPLARAEEAAGKGYFWP--AVAAHPRFPRGVVTESVDLDEAAPSLEQILHGPSTMPWGVEN-------------------EGGLKRALAKCG--YTDLKSFQKVSLHVN................ 387
44 -18.1002ble_A mol:protein length:367 GMP REDUCTASE I  ali model follow..  20  52..FTFRNSKQTYSGIPIIVANMDTVGTFEMAAVMSQHSMFTAIHKHYSLDDWKLFATNHPECL-VAVSSGSGQNDLEKMTSILEAVPQVKFICLANGYSEHFVEFVKLV--IMAGNVVTGEMVEELILSGADIIKV-GVGPGSRTKTGVGYPQLSAVIECADSAHGLKGHIISDGGCTCPGDVAKAFGAGADFVMLGGMFSGHTECA................................................................................................................... 268
45 -17.9001b3o_A mol:protein length:514 PROTEIN (INOSINE MONOPHOSPHATE DEHYDROGENASE 2)  ali model follow..  27  49VDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFI---NCTPEFQANEVRKVKKYEQGCGAAIGTHEDDKYRLDLLAQAGVDVVVLSQGNSIFQINMIKYI--VIGGNVVTAAQAKNLIDAGVDALRV-GMGSGSQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAP................................................................................................................... 397
46 -17.9001jr1_A mol:protein length:514 Inosine-5`-Monophosphate Dehydrogenase 2  ali model follow..  26  49VDLTSALTKKITLKTPLVSSPMDTVTEAGMAIAMALTGGIGFI---NCTPEFQANEVRKVKKYEQGCGAAIGTHEDDKYRLDLLALAGVDVVVLSQGNSIFQINMIKYM--VIGGNVVTAAQAKNLIDAGVDALRV-GMGCGSQEVLACGRPQATAVYKVSEYARRFGVPVIADGGIQNVGHIAKALALGASTVMMGSLLAATTEAP................................................................................................................... 397
47 -17.8001jcn_A mol:protein length:514 INOSINE MONOPHOSPHATE DEHYDROGENASE I  ali model follow..  24  49VDLTSALTRKITLKTPLISSPMDTVTEADMAIAMALMGGIGFI---NCTPEFQANEVRKVKNFEQGCGAAVGTREDDKYRLDLLTQAGVDVIVLSQGNSVYQIAMVHYI--VIGGNVVTAAQAKNLIDAGVDGLRV-GMGCGSQEVMACGRPQGTAVYKVAEYARRFGVPIIADGGIQTVGHVVKALALGASTVMMGSLLAATTEAP................................................................................................................... 397
48 -17.7004z87_A mol:protein length:525 Inosine-5`-monophosphate dehydrogenase  ali model follow..  17  58VVLSSRLTKKITLNAPFVSSPMDTVTEADMAIHMALLGGIGII---NCTAEEQAEMVRRVKKYENGCGAAIGTIDADRQRLAMLVEAGLDVVVLSQGNSVFQINMIKWI--VIAGNVVTREQAASLIHAGADGLRI-GMGSGSQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRD----------------------------------GKRLKTYRGMGSIDAMQKTDVKGNAATSRYFSESDKVLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGV. 483
49 -17.4001zfj_A mol:protein length:491 INOSINE MONOPHOSPHATE DEHYDROGENASE  ali model follow..  16  31VDLKTKLADNLTLNIPIITAAMDTVTGSKMAIAIARAGGLGVI---NMSITEQAEEVRKVKRSENGVAAAVGVTSDTFERAEALFEAGADAIVIAHGHSAGVLRKIAEI--LIAGNIATAEGARALYDAGVDVVKV-GIGPGSRVVAGVGVPQVTAIYDAAAVAREYGKTIIADGGIKYSGDIVKALAAGGNAVMLGSMFAGTDEAPGETEIYQ--------------------------GRKYKTYRGMGSIAAMKKGSSDRYFQGSVNEANKLVPEG------------EGRVAYKGAASDIVFQMLGGIRSGMGYVGA. 452
50 -17.2001xm3_A mol:protein length:264 Thiazole biosynthesis protein thiG  ali model follow..  13  9..........KSFQSRLLLGTGKYPSFDIQKEAVAVSESVRRMNIFEASQPNFLEQLDLSKYTLLPNTAGASTAEEAVRIARLAKAS-IKVEVIGCSDPVETLKASEQLLEEGFIVLPDVVLARKLEELGVHAIMPGASPIGSGQG-------ILNPLNLSFIIEQAKVPVIVDAGIGSPKDAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGR..................................................................................................... 231
51 -17.2001vrd_A mol:protein length:494 inosine-5`-monophosphate dehydrogenase  ali model follow..  23  30VKIDTRLTRQIRINIPLVSAAMDTVTEAALAKALAREGGIGII---NLTPDEQARQVSIVKKTENGVGAAVGTSPETMERVEKLVKAGVDVIVIAHGHSRRVIETLEMIKADVAGNVATPEGTEALIKAGADAVKV-GVGPGSRVVAGVGVPQLTAVMECSEVARKYDVPIIADGGIRYSGDIVKALAAGAESVMVGSIFAGTEEAP................................................................................................................... 373
52 -17.2002bzn_A mol:protein length:351 GMP REDUCTASE 2  ali model follow..  18  40..FSFRNSKQTYSGVPIIAANMDTVGTFEMAKVLCKFSLFTAVHKHYSLVQWQEFAGQNPDLEHLAASSGTGSSDFEQLEQILEAIPQVKYICLANGYSEHFVEFVKDV--IMAGNVVTGEMVEELILSGADIIKV-GIGPGSRKKTGVGYPQLSAVMECADAAHGLKGHIISDGGCSCPGDVAKAFGAGADFVMLGGMLAGHSESG................................................................................................................... 256
53 -17.2003tsb_A mol:protein length:511 Inosine-5`-monophosphate dehydrogenase  ali model follow..  23  48VSVKTVLSESLQLNIPLISAGMDTVTEADMAIAMARQGGLGII---NMSIEQQAEQVDKVKQGRLLVGAAVGVTADAMTRIDALVKASVDAIVLAHGHSQGVIDKVKEV--IIAGNVATAEATKALIEAGANVVKV-GIGPGSRVVAGVGVPQLTAVYDCATEARKHGIPVIADGGIKYSGDMVKALAAGAHVVMLGSMFAGVAESP................................................................................................................... 392
54 -17.0004fxs_A mol:protein length:496 Inosine-5`-monophosphate dehydrogenase  ali model follow..  21  30ADLRTRLTKNIALNIPMVSASMDTVTEARLAIALAQEGGIGFI---NMSIEQQAAQVHQVEQGRLRVGAAVGAAPGNEERVKALVEAGVDVLLISHGHSEGVLQRIRETREIIGGNVATAEGARALIEAGVSAVKV-GIGPGSRIVTGVGVPQITAIADAAGVANEYGIPVIADGGIRFSGDISKAIAAGASCVMVGSMFAGTEEAP................................................................................................................... 373
55 -16.7003zfh_A mol:protein length:510 INOSINE 5`-MONOPHOSPHATE DEHYDROGENASE  ali model follow..  17  45..LKTRLTRGIELNIPLVSAAMDTVTEARLAIAMAQEGGIGIIHKNMGIEQQAARDIEKAKTYPLAVGAAVGTGADTGERVAALVAAGVDVVVVAHGHSKGVIERVRWV--VIGGNIATAEAAKALAEAGADAVKV-GIGPGSRIVAGVGVPQISAIANVAAALEGTGVPLIADGGIRFSGDLAKAMVAGAYCVMMGSMFAGTEEAPGEIELFQ----------------------------------GRSYKSYRGMGSLGAMSGSQGSSDRYFQDASAGAEKLVPEGIE-GRVPYKGALSAIVHQLMGGLRAAMGYTGS. 464
56 -16.6002cu0_A mol:protein length:486 Inosine-5`-monophosphate dehydrogenase  ali model follow..  13  34VDVSTRITPNVKLNIPILSAAMDTVTEWEMAVAMAREGGLGVI---NMGIEEQVEQVKRVKRAERLLLVAAAVSPFDIKRAIELDKAGVDVIVVDTAHAIKSMKEMRQKVDADFIVGNIANPKAVDDLTFADAVKV-GIGPGSRIVAGVGVPQITAVAMVADRAQEYGLYVIADGGIRYSGDIVKAIAAGADAVMLGNLLAGTKEAPGKEVIIN--------------------------GRKYKQYRGMGSLGAMMKGGAERYYQGGYMKTRKFVPEG------------EGVVPYRGTVSEVLYQLVGGLKAGMGYVGA. 444
57 -16.5005x8o_A mol:protein length:504 Inosine-5`-monophosphate dehydrogenase  ali model follow..  19  33VNTTTRLSRNVKLSIPIVASNMDTVCEQRMAVAMAREGGIGIL---FCSIEEQCAMLREVKRAQSFVGAAVGVKKDDMNRAIRLVEAGADVLVIAHGHSDLCINMVKRLK-IIAGNIASAEAAEALIDAGADGLKI-GVGPGSRLVAGAGVPQLSAVLACTRVARRRGVPCIADGGLRTSGDISKAIGAGADTVMLGNMLAGTDEAP................................................................................................................... 384
58 -16.3001lrt_A mol:protein length:376 INOSINE-5`-MONOPHOSPHATE DEHYDROGENASE  ali model follow..  17  40...QKGQQSEINLKIPLVSAIMQSVSGEKMAIALAREGGISFIFGSQSIESQAAMVHAVKNFKDSQKRYLVGAGINTRDFRERVPAADVLCIDSSDGFSEWQKITIGWIRKVGAGNIVDGEGFRYLADAGADFIKI-GIGGGSICITREQKGIGRGQATAVIEETGIYIPVCSDGGIVYDYHMTLALAMGADFIMLGRYFARFEESP................................................................................................................... 264
59 -16.1002cdh_0 mol:protein length:226 ENOYL REDUCTASE  ali model follow..  21  2.......TTILGISMPIMIAPTAMQKMAH-YATARAASAAGTIMTLSSWATSSVEEVASTGPGIRFFQLYVYKDRNVAQLVRRAERAGFKAIALTVWKDVAWLQTITSLPI-LVKGVITAEDARLAVQHGAAGIIVSN-HGARQLDYVPATIMALEEVVKAAQGR---IPVFLDGGVRRGTDVFKALALGAAGVFIGRPVVFSLAAEGEAGVKKVL.......................................................................................................... 211
60 -15.7001ak5_A mol:protein length:503 INOSINE-5`-MONOPHOSPHATE DEHYDROGENASE  ali model follow..  19  31VNLSTPLVKFINLKIPLVSAIMQSVSGEKMAIALAREGGISFI---SQSIESQAAMVHAVKNFKAGRYIVFRKTRDFRERVPALVEAGADVLCISDGFSEWQKITIGW---VGAGNIVDGEGFRYLADAGADFIKI-GIGGGS-RGQATAVIDVVAERNKYFEETGIYIPVCSDGGIVYDYHMTLALAMGADFIMLGRYFARFEESP................................................................................................................... 391
61 -15.1003w9z_A mol:protein length:322 tRNA-dihydrouridine synthase C  ali model follow..  17  1..............MRVLLAPMEGVLDSLVRELLTEVNDYDLCITEFVRVVDQLLPVKVFSGTLVRVQLLGQFPQWLAENAARAVELGSWGVDLNCGCPSKTVNG-SGGGATLLKDPELIYQADAVQQAGATELVVHGTKEQGYRAEHIDWQAI------GDIRQRLNIPVIANGEIWDWQSAQQCMASGCDAVMIGRGALNIP...................................................................................................................... 231
62 -14.7004bf9_A mol:protein length:338 TRNA-DIHYDROURIDINE SYNTHASE C  ali model follow..  17  14..........HMASMRVLLAPMEGVLDSLVRELLTEVNDYDLCITEFVRVVDQLLPVKVFSGTLVRVQLLGQFPQWLAENAARAVELGSWGVDLNCGCPSKTVNG-SGGGATLLKDPELIYQADAVQQAGATELVVHGTKEQGYRAEHIDWQAI------GDIRQRLNIPVIANGEIWDWQSAQQCMASGCDAVMIGRGALNIP...................................................................................................................... 248
63 -14.4003kts_A mol:protein length:192 Glycerol uptake operon antiterminator regulatory protein  ali model follow..  15  1MSLELPFSN-----QSIIPA----AHNQKDMEKILELD-LTYMVMLETHVAQLKALVKYAQAG-LHADLVNGLKNDDYAIDFLCTEICPDGIISTRGNAIMKAKQHKMLAIQMIDSSAYNKGVALIQKVQPDCI------------------ELLPGIIPEQVTQKLHIPVIAGGLIETSEQVNQVIASGAIAVTTSNKHL......................................................................................................................... 183
64 -14.2003sr7_A mol:protein length:365 Isopentenyl-diphosphate delta-isomerase  ali model follow..  14  72.......THFAGFDFPFYINAMTGGSNEKLAQVADTCGVTGSYSTALKNPDDTSYQVKKSRPHLLLA-TNIGLDKPYQAGLQAVRDLQPLFLQVHINLMQELLMPAKKLQLPFILK--DVKTIQTAIDLGVKTVDISGR--GGTSFAYIENRQTTAQVLLNAQPLMDKVEILASGGIRHPLDIIKALVLGAKAVGLSRTMLELVEQHSVHEVIAIV.......................................................................................................... 320
65 -13.9004n02_A mol:protein length:357 Isopentenyl-diphosphate delta-isomerase  ali model follow..  13  60.......TEFAGWDFPFYINAMTGGSNQKLAQVAESCGVTGSYSAALKNPTDDSFSVKSSHPNLLLG-TNIGLDKPVELGLQTVEEMNPVLLQVHVNVMQELLMPSKQIPVPIVLK--DAKTIERAYEFGVRTVDLSG--RGGTSFAYIENRR-TMQALLNAQEWKDKVELLVSGGVRNPLDMIKCLVFGAKAVGLSRTVLELVETYTVEEVIGIV.......................................................................................................... 308
66 -13.8001huv_A mol:protein length:380 L(+)-MANDELATE DEHYDROGENASE  ali model follow..  18  64.......AEVLGQSMPLLIGPTGLNGKGDLALARA-ATKAGIPFVLSTASNMSIEDLARQCDGDLWFQLYVIHREIAQGMVLKALHTGYTTLVLTTDVAVEALRWLRDPHKLLVKGLLSAEDADRCIAEGADGVILSN-HGGRQLDCAISPMEVLAQSV-----AKTGKPVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVL.......................................................................................................... 326
67 -13.7001p0k_A mol:protein length:349 Isopentenyl-diphosphate delta-isomerase  ali model follow..  16  47.......TKIGESSSPIFINAMTGGGNKSLARAASQAGAVGSQMSALKDPSERLSYEIVRKENPNGLIFANLGSEAAAQAKEAVEMIGANALQIHLNVIQEIVMPCSRVSVPVIVK--SKASAGKLYEAGAAAVDIGG--YGGTNFSKIENLR-TAASLAEIRSEFPASTMIASGGLQDALDVAKAIALGASCTGMAGHFLKALTDSGEEGLLEEI.......................................................................................................... 299
68 -13.6001ep1_A mol:protein length:311 DIHYDROOROTATE DEHYDROGENASE B (PYRD SUBUNIT)  ali model follow..  22  14..........LDLKNPIIPASGCFGFGEEYAKYYDLNKGLQNPGLEVIMTEKLPWLNENFPELPIIANVAGSEEADYVAVCAKIGDAAVKAIELNISCPAALVKACKAV-VKLSPNVTDIVPAKAVEAAGADGLTMINTITGGLSGPAIKPVAL----LIHQVAQDVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANF......................................................................................................................... 274
69 -13.5001vcf_A mol:protein length:332 isopentenyl-diphosphate delta-isomerase  ali model follow..  19  50.......TPFLGLKAPFLIGAMTGGENLALAEAAEALGMLGSGRILLERPEALRRVRKVAPKALLIANLGLAQLRRYDDLLRLVEMLEADALAFHVNPLQEAVQRLLPLPFPVMVK--SREAALALRDLPLAAVDVAGA--GGTSWARVEEWV-TARAILEVREVLPHLPLVASGGVYTGTDGAKALALGADLLAVARPLL......................................................................................................................... 289
70 -13.4005ksw_A mol:protein length:306 Dihydroorotate dehydrogenase  ali model follow..  21  61............................ETASGMLNADGLQNPGLEVIMAEKLPWLNENFPDLPIIANVAGSEEDDYVAVCAKIGDAPVKVIELNISCPAALVKACKAV-VKLSPNVTDIVPAKAVEAAGADGLTMINTITGGLSGPAIKPVAL----LIHQVAQVVDIPIIGMGGVESAQDVLEMYMAGASAVAVGTANF......................................................................................................................... 270
71 -13.3004rje_A mol:protein length:374 Lactate oxidase  ali model follow..  20  78.......TEILGIKAPFIMAPIGA-KEAGTARAVSEFGTIMSISA--YSGATFEEISEGLNGGPRWFQIYMAKDDQQRDILDEAKGDGATAIILTADST-RDIEEIAAH--VFVKGIQHPEDADMAIKAGASGIWVSN-HGARQLYEAPGSFDTLPAIAERVNKR---VPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVL.......................................................................................................... 338
72 -13.3002du2_A mol:protein length:374 Lactate oxidase  ali model follow..  20  78.......TEILGIKAPFIMAPIAA-KEAGTARAVSEFGTIMSISA--YSGATFEEISEGLNGGPRWFQIYMAKDDQQRDILDEAKSDGATAIILTADST-RDIEEIAGH--VFVKGIQHPEDADMAIKRGASGIWVSN-HGARQLYEAPGSFDTLPAIAERVNKR---VPIVFDSGVRRGEHVAKALASGADVVALGRPVLFGLALGGWQGAYSVL.......................................................................................................... 338
73 -13.2006bfg_A mol:protein length:399 (S)-mandelate dehydrogenase  ali model follow..  17  64.......AEVLGQSMPLLIGPTGLNGKGDLALARA-ATKAGIPFVLSTASNMSIEDLARQCDGDLWFQLYVIHREIAQGMVLKALHTGYTTLVLTTDVAVEALRWLRDPHKLLVKGLLSAEDADRCIAEGADGVILSN-HGGRQLDCAISPMEVLAQSVAKT-----GKPVLIDSGFRRGSDIVKALALGAEAVLLGRATLYGLAARGETGVDEVL.......................................................................................................... 345
74 -13.1002uv8_G mol:protein length:2051 FATTY ACID SYNTHASE SUBUNIT BETA (FAS1)  ali model follow..  16  577IFVETKFSKLIG-RPPLLVPGMTPCTSPDFVAATTNAG-IELAGGGYFSAAGMTAAIDSVVGSTFGINLIYVNPFMLQWGIPLIKELRIQFLTIGAGVPSVASEYIETLGLKYLGSIDAISQVINIAKAHPNFIALQGGRGGGHHSFEDAHTPMLQM---SKIRRHPNIMLIFGSGFGSADDTYPYLTMPFDGFLFGSRVMIAKEVKTSPDAKKCIAACTGVPQTYKKPTGGIVTVRSEMGEPIHKIATRGVMLWKEFDETIFNLPKNKLVPTLEAKRDNADFQKPWFATVNGQARDLATMEEVAKRLVE............ 928
75 -13.0001fcb_A mol:protein length:511 FLAVOCYTOCHROME B2  ali model follow..  15  181.......TDMLGVDVPFYVSATALCKDVARGCGQGVTKVPQMISTLASCSPEEIIEAAPSDKQIQWYQLYVNSDRKIDDLVKNVEKLGVKALFVTVDAP-KDIEELKKK--IVIKGVQRTEDVIKAAEIGVSGVVLSN-HGGRQLDFSRAPIEVLAETMPILEQRNLKLEVFVDGGVRRGTDVLKALCLGAKGVGLGRPFLYANSCYGRNGVEKAI.......................................................................................................... 451

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.