current user: public

If you have questions about the server, please let us know.

Query: gi|15607166|ref|NP_214538.1| putative secreted protein P60-related protein (Rv0024) [Mycobacterium tuberculosis H37Rv], from M.tuberculosis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MNYSEVELLSRAHQLFAGDSRRPGLDAGTTPYGDLLSRAADLNVGAGQRRYQLAVDHSRAALLSAARTDAAAGAVITGAQRDRAWARRSTGTVLDEARSDTTVTAVMPIAQREAIRRRVARLRAQRAHVLTARRRARRHLAALRALRYRVAHGPGVALAKLRLPSPSGRAGIAVHAALSRLGRPYVWGATGPNQFDCSGLVQWAYAQAGVHLDRTTYQQINEGIPVPRSQVRPGDLVFPHPGHVQLAIGNNLVVEAPHAGASVRVSSLGNNVQIRRPLSGRLast
1 -56.3003pbi_A mol:protein length:214 INVASION PROTEIN  ali model follow..  24  1.....................................................................................SMDAEPGQWDPTLPALVSAGAPGDPLAVANASLQATAQATQTTLDLGRQFLGGLGINLGGPAASAPSAATTGASRIPRANARQAVEYVIRRAGSQMGVPYSWGGGSLQGFDCSGLVRYAFAGVGVLIPRFSGDQYNAGRHVPPAEAKRGDLIFYGPGHVTLYLGNGQMLEASGSAGKVTVSPVRKTPFVTRII... 212
2 -55.2004q4g_X mol:protein length:472 Peptidoglycan endopeptidase RipA  ali model follow..  21  74VNKAMVDVETARDNAAAAEDDLEVSQRAVKDANAAIAAQHRFDTFAAATYMNGPSASSPDEIIATVTAAKTLSASSQAVMANLQRARTERVNTESAARLAKQKADKAAADAKASQDAAVAALTETRRKFDEQREEVQRLAAERDAAQARTNAPAGSAQGRIPRVYGRQASEYVIRRGMSQIGVPYSWGGGNAAGFDASGLVLYSFAGVGIKLPHYSGSQYNLGRKIPSSQMRRGDVIFYGPNHVTIYLGNGQMLEAPDVGLKVRVAPVRTTPYVVRYI... 470
3 -55.1003ne0_A mol:protein length:214 Resuscitation promoting factor Interacting Protein A  ali model follow..  23  7...........................................................................................GLWDPTLPMIPSANIPGDPIAVVNQVLGISATSAQVTANMGRKFLEQLGILQPTDTGITNAPAGSAQGRIPRVYGRQASEYVIRRGMSQIGVPYSWGGGNAAGFDCSGLVLYSFAGVGIKLPHYSGSQYNLGRKIPSSQMRRGDVIFYGPNHVTIYLGNGQMLEAPDVGLKVRVAPVGMTPYVVRYI... 212
4 -49.6003i86_A mol:protein length:141 Putative uncharacterized protein  ali model follow..  31  1..............................................................................................................................................................GSTGSVYGRQAIEYVIKRMGSQMGVPYSWGGGSLDGFDCSGLMRYGFAGVGVLIPRFSGDQYNAGRHIPQDQARRGDLIFYGPGHVTMYLGNGQMLEASGSAGKVTVSPVRKTPFLTRII... 139
5 -49.1004lj1_A mol:protein length:147 Invasion-associated protein  ali model follow..  31  1..................................................................................................................................................................SMDYQQITDVVIARGLSQRGVPFSWAGGGISGFDASGLIQYAYAGAGLKLPRSSGQMYKVGQKVLPQQARKGDLIFYGPQSVALYLGKGQMLEVGDVVQVSPVRTNGMTPYLVRVLGTQ 135
6 -48.5002hbw_A mol:protein length:235 NLP/P60 protein  ali model follow..  22  75................................................................................................................................................GLLKPATVLYQAKSFSESEIKKLLPGAIAFTQKAMQQSNYYLWGGTVGPNYDCSGLMQAAFVSVGIWLPRDAYQQEAFTQAITIDELAPGDLVFFGTTHVGLYLGDGCYIHSSGKAQGIGIDILSSRSYYQQLRGAG 224
7 -48.0003gt2_A mol:protein length:142 Putative uncharacterized protein  ali model follow..  32  1..........................................................................................................................................................ATADPGVRAMDYQQATDVVIARGLSQRGVPFSWAGGGINGFDASGLMQYAYAGAGIKLPRSSGAMYRVGQKILPQQARKGDLIFYGPQSVAMYLGNNQMLEV---GDVVQVSPVRTAPYMVRVLGT. 142
8 -47.4002evr_A mol:protein length:246 COG0791: Cell wall-associated hydrolases (invasion-associated proteins)  ali model follow..  21  75.............................................................................................................................................SLSDFDSLQPATVPYQAATFSESEIKKLLAEVIAFTQKQQSNYYLWGGTVGPNYDCSGLMQAAFASVGIWLPRDAYQQEGFTQPITIAELVAGDLVFFGTTHVGLYLADGYYIHSSGKDQGIGIDILSSLSYYQQLRGAG 229
9 -45.1004xcm_A mol:protein length:244 Cell wall-binding endopeptidase-related protein  ali model follow..  30  89................................................................................................................................................GQVLRLPEEGEAPPPPPPEPEALDPESPLLRAVLRYLGVPYKYGANSPLALDCSAFVAQVYAELGVALPRTTKEQYQAFPPV--EAPRPGDLVFFEVDHVGIYLGRGVFAHASSYGSRVVIESLEAPFYRKVYRGAR 228
10 -44.1003h41_A mol:protein length:311 NLP/P60 family protein  ali model follow..  28  183...................................................................................................................................................................DIPTPAADDLINTGKMFLGLPYIWAGTSGFGFDCSGFTHTIYKSHGITIPRDSGPQSRNGVAVDKEHLQKGDLIFFAHHHVAMYIGDGNMIHSPRAERSVEIIPLNTPGYIEEYAGAR 307
11 -40.8002k1g_A mol:protein length:135 Lipoprotein spr  ali model follow..  31  2.....................................................................................................................................................................NVDVKSRIMDQYADWKGVRYRLGGSTKKGIDCSGFVQRTFREQGLELPRSTYEQQEMGKSVSRSNLRTGDLVLFRARHVGIYIGNNQFVHAS-TSSGVIISSMNEPYWKKRYNEAR 121
12 -38.9004fdy_A mol:protein length:313 Similar to lipoprotein, NLP/P60 family  ali model follow..  13  22VSPEVLAHRPLIEKYGKEYGIEDYVSYILAIMQVESGGTAEDVMQSSESLGLPPNSLSTEESIKQGVKYFSELLTSAEQQGVDIDSVIQSYNYGGGFLNYVRSHGKKYTYELAEQFSKEKSGGQKADYPNPIAIPVNGGWRYNYGNQFYVQLVSQYLTDTSPTEFDDETVQVIMDEALKYEGFPYVFGGASPTSFDCSGLIQWVYDKAGISLPRVAQDQYDATQEISMEEAQAGDLIFFYVTHVAIYLEGNRFYHA---GDPIGYGDLSSRYWQDHLIGAR 308
13 -37.1003pvq_A mol:protein length:308 Dipeptidyl-peptidase VI  ali model follow..  27  150...................................................................................................................................................................ASLKQDAESIIKTAYTMIGIPYLWAGTSSKGVDCSGLVRTVLFMHDIIIPRDASQQAYVGERIEFSNVQRGDLVFFGRSHVGIYLGNKRFIHALGDVHISSFDPEDRLLFATRFLPY. 289
14 -37.0004hpe_A mol:protein length:308 Putative cell wall hydrolase Tn916-like,CTn1-Orf17  ali model follow..  33  178................................................................................................................................................................TVPQVSGELAQKVMNEALKYQGWKYVYGGSNPNSFDCSGLTQWCYGKAGISLPRTAQAQYDATQHLPLSQAKAGDLVFFHSTHVGIYVGNNQMYHA---GDPIGYADLSSSYWQQHLIGAG 304
15 -37.0003npf_A mol:protein length:306 putative dipeptidyl-peptidase VI  ali model follow..  27  150...................................................................................................................................................................ASLKQDVESIIETAYSMMGIPYLWAGTSSKGVDCSGLVRTVLFMHDIIIPRDASQQAYVGEHIDFSNVKRGDLVFFGRSHVGIYLGNKQFIHALGDVHVSSMNPADRLLFAVRFLP.. 288
16 -28.9003m1u_A mol:protein length:434 Putative gamma-D-glutamyl-L-diamino acid endopeptidase  ali model follow..  14  186..............................................................................PAADVARVDDAFMTRYESGSLAAILRDDTSLNGADGTHLATAHIGTVLPLSGASQVGRTVLVPVRAPEGHAVVVPVLLTSGEAAQKPVPLTPGNMAELGNRMMGQPYGWGGLY-EDRDCSSTLRDLFTPFGLWLPRNSASQAKAGRYVDIAKLDADDKEAR-RGHITLYLGLAAMFHNMWG---IRTHRGG............ 389
17 -15.7004h4j_A mol:protein length:240 hypothetical protein  ali model follow..  15  108..................................................................................................................................................................TGAMSPDTERLSISYMSSHPQLYKQLANSPENVAKMKKIEQSLSGKEVHLPKAKLPAD------GLPWIKDGDIIAITTAHMGIAFNKLLLVHASSTDKKVVVSKVPLSQMLKDNNKWT 231
18 -15.5002p1g_A mol:protein length:249 Putative xylanase  ali model follow..  10  1......................................................MSLQESSLVLSNGLGFVDTPYKAGTLEVDDTEDLIINCDEVDCTTFVEYALAMALCPQQGDEMQEGDFARNLQRIRYRDGKIDGYTSRLHYISDWINNAVRQGLLEDVTAAYSPFKQKLSLSYMSTHPELYKSLKNSPENVAQMAKYEKALSGKEVHLPKDKLEP------DGLPWIKNGDIIALTTSHMGIAIGQLHLLHASSKEGKVVVGKTALSQMLKDRKSLT 232
19 -13.8004hz9_A mol:protein length:119 Putative cytoplasmic protein  ali model follow..  20  1.........................................................................................................................................................................................MYKIEPNSVGRCAEYVRKAIEWGGISLQRTRSAKLAAGFHEAIGSPMKGDVIVIQPGHMAIYDGSHWI............................ 91
20 -13.6002im9_A mol:protein length:333 Hypothetical protein  ali model follow..  16  1....................................................................................................................SLSQTTNIKEQTDTGLAPPAPAITTNSAAIEEQANSSIRKLYHTLNTMPNTSMADRISQISAYFKGTKYILGSLG-DGFDCDTYVNTVYKNGKRSIPFTALFSENKPNLHLFSQIPNGAVIEIIRSHLGFAINELFFRQASSQYGKVVDVSLIDYLDKAR..... 304
21 -12.8004eyz_A mol:protein length:246 Cellulosome-related protein module from Ruminococcus flavefaciens that resembles papain-like cysteine peptidases  ali model follow..  19  44...................................................................................................................................................................................YKGTPYI-GTYEEGGLNCMGFVWHAIAKGGLDISQTGQYVPFSSEMLSSGVLQKGDIIWCVDGHIGIYTGNGSWWQSGPVKADGDVCPIYGAAAKNTYV... 238
22 -11.7004dpz_X mol:protein length:137 HRAS-like suppressor 2  ali model follow..  29  2................................................................................................................................................................................................................................ALARPRPRLGDLIEIS-AHWAIYVGDGYVVH.......................... 35
23 -11.4004q95_A mol:protein length:149 HRAS-like suppressor 3, Lecithin retinol acyltransferase  ali model follow..  28  1............................................................................................................................................................................................................................GCGSRAPIPEPKPGDLIEIF-RHWAIYVGDGYVVH.......................... 38
24 -11.1004fa0_A mol:protein length:137 Group XVI phospholipase A1/A2  ali model follow..  25  1............................................................................................................................................................................................................................SNAMRAPIPEPKPGDLIEIF-RHWAIYVGDGYVVH.......................... 38
25 -10.6002lkt_A mol:protein length:125 Retinoic acid receptor responder protein 3  ali model follow..  34  4..................................................................................................................................................................................................................................PHQEPKPGDLIEIF-EHWALYIGDGYVIH.......................... 35
26 -10.6004dot_A mol:protein length:140 Group XVI phospholipase A2  ali model follow..  29  2................................................................................................................................................................................................................................RAPIPEPKPGDLIEIF-RHWAIYVGDGYVVH.......................... 35
27 -9.4703kw0_A mol:protein length:214 Cysteine peptidase  ali model follow..  15  122......................................................................................................................................................................SEMIRNLIKVGFSLLNSGYDKNEEDNNEYICSEFVNECFKKIGVEF-----------LTDSEGFIFPEHI............................................. 195

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.