current user: public

If you have questions about the server, please let us know.

Query: gi|15607174|ref|NP_214546.1| 8-amino-7-oxononanoate synthase BioF2 (Rv0032) [Mycobacterium tuberculosis H37Rv], from M.tuberculosis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770
# Score Template Links and tools%idFirst MPTGLGYDFLRPVEDSGINDLKHYYFMADLADGQPLGRANLYSVCFDLATTDRKLTPAWRTTIKRWFPGFMTFRFLECGLLTMVSNPLALRSDTDLERVLPVLAGQMDQLAHDDGSDFLMIRDVDPEHYQRYLDILRPLGFRPALGFSRVDTTISWSSVEEALGCLSHKRRLPLKTSLEFRERFGIEVEELDEYAEHAPVLARLWRNVKTEAKDYQREDLNPEFFAACSRHLHGRSRLWLFRYQGTPIAFFLNVWGADENYILLEWGIDRDFEHYRKANLYRAALMLSLKDAISRDKRRMEMGITNYFTKLRIPGARVIPTIYFLRHSTDPVHTATLARMMMHNIQRPTLPDDMSEEFCRWEERIRLDQDGLPEHDIFRKIDRQHKYTGLKLGGVYGFYPRFTGPQRSTVKAAELGEIVLLGTNSYLGLATHPEVVEASAEATRRYGTGCSGSPLLNGTLDLHVSLEQELACFLGKPAAVLCSTGYQSNLAAISALCESGDMIIQDALNHRSLFDAARLSGADFTLYRHNDMDHLARVLRRTEGRRRIIVVDAVFSMEGTVADLATIAELADRHGCRVYVDESHALGVLGPDGRGASAALGVLARMDVVMGTFSKSFASVGGFIAGDRPVVDYIRHNGSGHVFSASLPPAAAAATHAALRVSRREPDRRARVLAAAEYMATGLARQGYQAEYHGTAIVPVILGNPTVAHAGYLRLMRSGVYVNPVAPPAVPEERSGFRTSYLADHRQSDLDRALHVFAGLAEDLTPQGAALLast
1 -96.7005txr_B mol:protein length:491 5-aminolevulinate synthase, mitochondrial  ali model follow..  27  20..............................................................................................................................................................................................................................................................................................................................................................................................IDSELQKKRLDKSYRYFNNINRLAKEFPRQREADKVTVWCSNDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFSSCYVANDAVLSLLGQKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQSYPSVPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHCDFEDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFAPGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVIPNPSHIVPVLIGNADLAKQASDILIKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAVDDVFNELQLPRVR. 436
2 -95.8004bmk_A mol:protein length:442 SERINE PALMITOYLTRANSFERASE  ali model follow..  32  46..............................................................................................................................................................................................................................................................................................................................................................................................LIAERQKLLDSGVTDPFAIVEQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSASVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIG... 435
3 -95.2003a2b_A mol:protein length:398 Serine palmitoyltransferase  ali model follow..  36  1....................................................................................................................................................................................................................................................................................................................................................................................SKGKLGEKISQFKIVEELKAKGLYAYFRPIQSKQDTEVKI-DGRRVLMFGSNSYLGLTTDTRIIKAAQDALEKYGTGCAGSRFLNGTLDIHVELEEKLSAYVGKEAAILFSTGFQSNLGPLSCLMGRNDYILLDERDHASIIDGSRLSFSKVIKYGHNNMEDLRAKLSRLPDSAKLICTDGIFSMEGDIVNLPELTSIANEFDAAVMVDDAHSLGVIGHKGAGTASHFGLNDDVDLIMGTFSKSLASLGGFVAGDADVIDFLKHNARSVMFSASMTPASVASTLKALEIIQNEPEHIEKLWKNTDYAKAQLLDHGFDLGATESPILPIFIRSNEKTFWVTKMLQDDGVFVNPVVSPAVPAEESLIRFSLMATHTYDQIDEAIEKMVKVFKQAEVET... 396
4 -94.7002w8j_A mol:protein length:427 SERINE PALMITOYLTRANSFERASE  ali model follow..  32  30..............................................................................................................................................................................................................................................................................................................................................................................................LIAERQKLLDSGVTDPFAIVEQVKSPTEAVIRGKDTILLGTYNYMGMTFDPDVIAAGKEALEKFGSGTNGSRMLNGTFHDHMEVEQALRDFYGTTGAIVFSTGYMANLGIISTLAGKGEYVILDADSHASIYDGCQQGNAEIVRFRHNSVEDLDKRLGRLPKEAKLVVLEGVYSMLGDIAPLKEMVAVAKKHGAMVLVDEAHSMGFFGPNGRGVYEAQGLEGQIDFVVGTFSKSVGTVGGFVVSNHPKFEAVRLACRPYIFTASLPPSVVATATTSIRKLMTAHEKRERLWSNARALHGGLKAMGFRLGTCDSAIVAVMLEDQEQAAMMWQALLDGGLYVNMARPPATPAGTFLLRCSICAEHTPAQIQTVLGMFQAAGRAVGVIG... 419
5 -94.0001fc4_A mol:protein length:401 2-AMINO-3-KETOBUTYRATE CONENZYME A LIGASE  ali model follow..  32  12..............................................................................................................................................................................................................................................................................................................................................................................................LTNDLETARAEGLFKEERIITSAQQADITVADGSHVINFCANNYLGLANHPDLIAAAKAGMDSHGFGMASVRFICGTQDSHKELEQKLAAFLGMEDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRYRYANNDMQELEARLKEARARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFVGENGRGSHEYCDVMGRVDIITGTLGKALGASGGYTAARKEVVEWLRQRSRPYLFSNSLAPAIVAASIKVLEMVEAGSELRDRLWANARQFREQMSAAGFTLAGADHAIIPVMLGDAVVAQKFARELQKEGIYVTGFFYPVVPKGQARIRTQMSAAHTPEQITRAVEAFTRIGKQLGVIA... 401
6 -93.1002x8u_A mol:protein length:412 SERINE PALMITOYLTRANSFERASE  ali model follow..  33  10..............................................................................................................................................................................................................................................................................................................................................................................................LIAEREALLATGVRDPYAIVMDKVLSPTEAINGRKTILLGTYNYMGMTFDPDVIAAGKQALDEFGSGTTGSRVLNGTYQGHKACEDALKEFYGTEHAIVFSTGYQANLGMISTLAGKGDYIILDADSHASIYDGCWLGDAEIVRFRHNSVEDLDKRLGRLPAEGKLVVLEGVYSMMGDIAPLQEMVAVSKKHGAMILVDEAHGMGFFGEHGRGVFEEAGVEADVDFVVGTFSKSVGTVGGFCVSNHPKFEVLRLVCRPYVFTASLPPSVVATAATSIRKLMHAGDKRAHLWKNSRRLHQGLRDMGYKLGTAQSAIIAVILTDMAQAVALWQGLLEAGLYVNTARPPATPAGMFLLRCSLCAEHSDEQVEQILGMFESAGRATGVIPKL. 401
7 -93.0005vnx_A mol:protein length:393 8-amino-7-oxononanoate synthase  ali model follow..  36  7..............................................................................................................................................................................................................................................................................................................................................................................................LQRGLADLDAQGLRRVRRTADSACDAHMTV-NGREIVGFASNDYLGLAAHPKLVAAFAEGAQRYGSGSGGSHLLGGHSRAHAKLEDELAGFAGAPRALYFSTGYMANLAAVTALAGKDATIFSDALNHASLIDGTRLSRATVQVYPHADTATLGALLEACTSQTKLIVTDTVFSMDGDIAPLAELLALAERHGAWLVVDDAHGFGVLGPQGRGALAAAALRSPHLVYVGTLGXAAGVAGAFVVAHETVIEWLIQRARSYIFTTAAPPAVAHAVSASLKVIAGDEARRAHLAALIERTRALLRRTRWQPVDSHTAVQPLVIGSNEATLAAMRALDAHGLWVPAIRPPTVPAGTSRLRISLSAAHSFDDLARLETALLRASEEA....... 393
8 -92.8005jay_A mol:protein length:402 8-amino-7-oxononanoate synthase  ali model follow..  34  9..............................................................................................................................................................................................................................................................................................................................................................................................LAEGLKEIDARGLRRRRRTADTPCAAHMTV-DGRAIIGFASNDYLGLAAHPQLIAAIAEGAQRYGAGSGGSHLLGGHSRAHAQLEDDLAEFVGNARALYFSTGYMANLATLTALAGRGTTLFSDALNHASLIDGARLSRADVQIYPHCDTDALSAMLEASDADVKVIVSDTVFSMDGDIAPLPRLLELAEQHGAWLIVDDAHGFGVLGPQGRGAIAQAALRSPNLISIGTLDKAAGVSGAFVAAHETVIEWLVQRARPYIFTTASVPAAAHAVSASLRIIGGEEARRAHLQQLIGRTRAMLKATPWLPVDSHTAVQPLIIGANDATLEIAATLDRAGLWVPAIRPPTVPTGTSRLRISLSAAHSQADLDRLEAGLQQLGAKAA...... 396
9 -92.7001bs0_A mol:protein length:384 PROTEIN (8-AMINO-7-OXONANOATE SYNTHASE)  ali model follow..  30  7..............................................................................................................................................................................................................................................................................................................................................................................................INAALDARRAADALRRRYPVAQGAGRWLVA-DDRQYLNFSSNDYLGLSHHPQIIRAWQQGAEQFGIGSGGSGHVSGYSVVHQALEEELAEWLGYSRALLFISGFAANQAVIAAMMAKEDRIAADRLSHASLLEAASLSPSQLRRFAHNDVTHLARLLASPCPGQQMVVTEGVFSMDGDSAPLAEIQQVTQQHNGWLMVDDAHGTGVIGEQGRGSCWLQKV--KPELLVVTFGKGFGVSGAAVLCSSTVADYLLQFARHLIYSTSMPPAQAQALRASLAVIRSDEARREKLAALITRFRAGVQDLPFTLADSCSAIQPLIVGDNSRALQLAEKLRQQGCWVTAIRPPTVPAGTARLRLTLTAAHEMQDIDRLLEVLHGNG.......... 384
10 -92.2003tqx_A mol:protein length:399 2-amino-3-ketobutyrate coenzyme A ligase  ali model follow..  31  11..............................................................................................................................................................................................................................................................................................................................................................................................LNKEIEGLKKAGLYKSERIITSPQNAEIKV-GEKEVLNFCANNYLGLADHPALIKTAQTVVEQYGFGMASVRFICGTQTIHKELEKDISEFLGTDDTILYSSCFDANGGLFETLLGPEDAIISDELNHASIIDGIRLCKAQRYRYKNNAMGDLEAKLKEADARFKLIATDGVFSMDGIIADLKSICDLADKYNALVMVDDSHAVGFIGENGRGTPEYCGVADRVDILTGTLGKALGASGGYTSGHKEIIEWLRNRSRPYLFSNTVAPVIVATSLKVLELLKTEPQLRKQLQENSRYFRAGMEKLGFQLVPGNHPIIPVMLGDAQLATNMADHLLQEGIYVVGFSYPVVPMGKARIRVQMSAVHTQQQLDRAIEAFGQVGKKLGAI.... 399
11 -90.8003wy7_A mol:protein length:404 8-amino-7-oxononanoate synthase  ali model follow..  34  28..............................................................................................................................................................................................................................................................................................................................................................................................LADIEQRRRAEGLRRELRV----------RPPVAAELDLASNDYLGLSQHPDVLDGGVEALRTWGGGAGGSRLVTGNTELHEAFEHQLASFLGAESALVFSSGYTANLGALVALSGPGSLIVSDALSHASLVDACRLSRARVVVSPHRDVDAVDAALAARTEERAVVVTESVFSADGDLAPLRDLHAVCRRHGALLLVDEAHGLGVRGTRGQGLLHEVGLAGAPDVMTTTLSKALGSQGGAVLGPEAVRAHLIDTARSFIFDTGLAPAAVGAASAALRVLDAEPQRARAVLDRAAELAT----IAGVTEAPVSAVVSVILGDPEIAVGAAAACLDRGVRVGCFRPPTVPAGTSRLRLAARASLTDDEMALARQVLTDVLATAR...... 397
12 -90.7002bwn_A mol:protein length:401 5-AMINOLEVULINATE SYNTHASE  ali model follow..  30  7..............................................................................................................................................................................................................................................................................................................................................................................................LDKAIQKLHDEGRYRTFIDIEREKGAFPKAGGKQDITVWCGNDYLGMGQHPVVLAAMHEALEAVGAGSGGTRNISGTTAYHRRLEAEIAGLHQKEAALVFSSAYNANDATLSTLLFPGLIIYSDSLNHASMIEGIKRNAGPKRIFRHNDVAHLRELIAADDAAPKLIAFESVYSMDGDFGPIKEICDIAEEFGALTYIDEVHAVGMYGPRGAGVAERDGLMHRIDIFNGTLAKAYGVFGGYIAASARMVDAVRSYAPGFIFSTSLPPAIAAGAQASIAFLKTAEGQRDAQQMHAKVLKMRLKALGMPIIDHGSHIVPVVIGDPVHTKAVSDMLLDYGVYVQPINFPTVPRGTERLRFTPSPVHDLKQIDGLVHAMDLLWARCA...... 401
13 -90.3002wk7_A mol:protein length:393 CAI-1 AUTOINDUCER SYNTHASE  ali model follow..  23  1.........................................................................................................................................................................................................................................................................................................................................................................................MNKPQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRH--GPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTI-RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDFYFRL. 390
14 -89.9003hqt_A mol:protein length:409 CAI-1 autoinducer synthase  ali model follow..  23  15.........................................................................................................................................................................................................................................................................................................................................................................................MNKPQLPDFIQNKIDHYIENYFDINKNGKHLVLGKQASPDDIILQSNDYLALANHPLIKARLAKSLLEEQQSLFMSASFLQNDYDKPMIEKRLAKFTGFDECLLSQSGWNANVGLLQTICQPNTNVYIDFFAHMSLWEGARYANAQAHPFMHNNCDHLRMLIQRH--GPGIIVVDSIYSTLGTIAPLAELVNISKEFGCALLVDESHSLGTHGPNGAGLLAELGLTREVHFMTASLAKTFAYRAGAIWCNNEVNRCVPFISYPAIFSSTLLPYEAAGLETTLEIIESADNRRQHLDRMARKLRIGLSQLGLTI-RSESQIIGLETGDERNTEKVRDYLESNGVFGSVFCRPATSKNKNIIRLSLNSDVNDEQIAKIIEVCSDAVNYGDF..... 400
15 -87.8004iw7_A mol:protein length:399 8-amino-7-oxononanoate synthase  ali model follow..  23  21.............................................................................................................................................................................................................................................................................................................................................................................................NLQDKYTQYQRDNLLRELTP----------FIKDDSIIDFTTSDYLNLSSAHNLKHAIVNGFDKYGFGSKGSNIVCGYTDETQQFEHEFAKFINYPRAIFFSSGFMANLAIYSTLFSKHDSIFADKYIHASIIDGIKLSQAKLRRYKHQQLSQLQDIYDG----KSFITTEGVFSTSGSITQLDKLAKITPEK---LIVDEAHSFGVLGKNGRGAINSFRISKNCLICVFPLGKAFGGVGAVVCTTEAIAEYLIQFARNYIYTTALPPMILKAALIQLKNLENVNDNRARLQQNITFFNELCDAKDLELVSKDSPIRSIQLNNANLAIRLKDKLFENKIIVSCFRYPTVPKDQAILRFSLHSNNTFDQIQQALEIISKEVKYEYIRSN.. 393
16 -26.9002e7i_A mol:protein length:371 Sep-tRNA:Cys-tRNA synthase  ali model follow..  16  1.................................................................................................................................................................................................................................................................................................................................................................................................................................MFKRETKDFINIQTGGKLTEEARQALLEWGDGYSVCDFCT-TPPIHDFIHNQLPKFLGCDVARVTNGAREAKFAVMHSLAKKDAWVVMDENCHYSSYVAAERAGLNIALVPKTTPENFAQTIEETKKRGVLALITYPDGNYGNLPDVKKIAKVCSEYDVPLLVNGAYAIGRMPVSLKEI--------GADFIVGSGHKSMAASGGVMGMKEEWAEIVLRRSEKYLLGCTARGATIITLMASFPHVRERIKRWDEEVEKARRFAAEMEKLGIKQLGDNPHLYEISKKAKGGRFFLYRELKSRKIHG------IKPGLTRYFKLS-TYGLSDEEVDYVLNAFKEIIEKYS...... 371
17 -21.0004lnj_A mol:protein length:333 Low-specificity L-threonine aldolase  ali model follow..  17  1.................................................................................................................................................................................................................................................................................................................................................................................................................................MIDLRSDTVTR---SRAMLEAMMAA--PVGDDV-------GDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHAAVLGSIQPQPIDAAADGTLPLDKVAMKIKPDDIHTKLLSLENVLPRE----YLKEAWEFTRKRNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGMYALK---NNVARLQEDHDNTAWMAEQLREAGADVMRQDTNMLFVRV-GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR........ 333
18 -20.9002fm1_A mol:protein length:355 L-allo-threonine aldolase  ali model follow..  22  1...........................................................................................................................................................................................................................................................................................................................................................................................................................MGSDKIMIDLRSDTVTK---TEEMRKAMAQA--EVGDDV-------GEDPTINELERLAAETFGKEAALFVPSGTMGNQVSIMAHTQRGDEVILEADSHIFWYEVAVLSGVMPHPVPGKNPDDVRKAIRPRNPRTSLIAIENTHNRSGPLENIKEICTIAKEHGINVHIDGARIFNASIASGVPVKE---YAGYADSVMFCLSKGLCAVGSVVVGDRDFIERARKARKMLGGGMRQAGVLAAAGIIALT---KMVDRLKEDHENARFLALKLKEIGYSVNPEDVKTNMVILNLKVNAHGFIEALRNSGVLA-------NAVSDTEIRLVTHKDVSRNDIEEALNIFEKLFRKFS...... 349
19 -20.9003wlx_B mol:protein length:333 Low specificity L-threonine aldolase  ali model follow..  18  1.................................................................................................................................................................................................................................................................................................................................................................................................................................MIDLRSDTVTR---SRAMLEAMMAA--PVGDDV-------GDDPTVNALQDYAAELSGKEAAIFLPTGTQANLVALLSHCERGEEYIVGQAAHNYLFEAAVLGSIQPQPIDAAADGTLPLDKVAMKIKTKLLSLENVLPRE----YLKEAWEFTRERNLALHVDGARIFNAVVAYGCELKE---ITQYCDSFTICLSKGLGTVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGIYALK---NNVARLQEDHDNAAWMAEQLREAGADVMRQDTNMLFVRV-GEENAAALGEYMKARNVLI---------NASPIVRLVTHLDVSREQLAEVAAHWRAFLAR........ 333
20 -20.6004zm3_A mol:protein length:464 Aminotransferase  ali model follow..  18  24..........................................................................................................................................................................................................................................................................................................................................................................................TNAESLDGIKSVIAGGVSSSMRAAAVPLPLVVRSAGGCLLRDVEDGEIIDLNADREVLDAVADQFAK-GHMTGLP------HELDARAGALIAELVPGVEQVRFNSGTEAVASALRATTGRTLVVTFEGHYHGW-SETVLRAGAHTVQLGWNDPDALRELFARDGDRIAAVIVEPVLANAGVIPPLQLLRELTGRSGAMLVFDEV--TGFRVARG-GAQERYGVEPDL----TVLSKVMG--GGFFGGRRHAMRMLASNEAHHAGVYAGNHAALRAVVAMLGKIRSLPDLYERLEDTGQYMEDTVREV---FATEKRPVHINRVGDFPRHRRLQTLAQKEGVYFHP---------NALEPWFLSTAHTRDVIDKVAGALQRSLVGLG...... 458
21 -19.7002yku_A mol:protein length:465 BETA-TRANSAMINASE  ali model follow..  17  80.................................................................................................................................................................................................................................................................................................................................................................................................................IAQGTGSRFQDVDGHAYVNFLGEYTAGLFGHPVIRAAVERALAV-GLNLSTQ------TENEALFAEAVCDFPSIDLVRFTNSGTEANLMALAAITGRKTVLAFDGGYHGG-LLNFASGHAHVVLGVYNDVEGTADLLKRHGHDCAAILVEPMLGAGGCVPALDLLRAEASRCGALLIFDEV----MTSRLSGGAQEMLGISADL-----TLGKYIG--GGMFGGRRDLMERFDPARDGAFAHAGTNILTMSAGHAALTQIY-TRQAASDLSASGDRFRANLNRI-GTIHFSRAPI-DVRAADQQLKELFFFHMLRKGIYLAP-----------RGMYALSLEIADAGRDAFAEALADFIGEQR...... 455
22 -19.5006cbo_A mol:protein length:439 C-6` aminotransferase  ali model follow..  17  44.................................................................................................................................................................................................................................................................................................................................................................................................................FVEGSGAYLTDPDGRRWIDFDNA-VLG--GDEEVAEAIARAARG------RSGVGTAWSPVLDSLLGQLQEVCGGDVVGLYRTGTAALRSVTCAVDARDRSIVLSSGYHGYHCDEPFTPNQHGIVEFLFDLDVLAEWLSR-PEQVAAVVISPDHMHLGE---YTEFTRLTKEADVPVIADEV----KVGLRYRAGLSTPLLDPAV-----IVAKCLA--NGSVGGDAHLLAALEDVSFTSYFE----PTAMAAATTTLRRMATG-EPQQAIRAAGDRFIAHTRAAGVPILAGNGNLFQFVCADDEVADAFHAAAAAEGLLFFE-------------NQTPSAAFTDEVVEDACGRIDRVSAALT...... 389
23 -19.4005x6b_I mol:protein length:417 O-phospho-L-seryl-tRNA:Cys-tRNA synthase  ali model follow..  14  52.........................................................................................................................................................................................................................................................................................................................................................................................................................................LNPIQRGGILPKEAKKAVYEYWDGYSVCRLDEVTCPPIKDFLEDIAKFLNMDCARPTHGAREGKFIVMHAICKEGDYVVLDKNAHYTSYVAAERAKLNVAEVGYENLEGYKEVIDNLEDNVGLILLTHVDGEYGNLNDAKKVGKIAKEKGIPFLLNCAYTVGRMPVNGKEV--------KADFIVASGHKSMASAPGILAFSEEFSDKITKTSEKFMLGCTSRGLPIVTLMASFPHVVERVKKWDEELKKTRYVVDELEKIGFKQLGIKPKEHDLIKFETPVLDEIAKKDKRRGFFFDELKKRGIAGVTKEIKMSVYGL-EWEQVEYVVNAIKEIVESCK...... 411
24 -19.3002cy8_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  18  43.................................................................................................................................................................................................................................................................................................................................................................................................................ISDAQGVHKTDVDGNVYLDFFGG-VLG--GHPRVNAAIAEALSH-GVQYAAS------HPLEVRWAERIVAAFPSIRKLRFGSGTETTLLALRAFTGRRMILRFEGHYHGW-HDFSASGYANTLLIRPDDIEGMREVFANHGSDIAAFIAEPVGSHFGVTPVLREGAELARQYGALFILDEV--SGFRVGNH-GMQALLDVQPDL----TCLAKASA--GGLLGGREDVMGVLSRGSDRKVLHQGTNPITAAAAIAAIDTIL-EDDVCAKINDLGQFAREAMNHL---LAYGRFSGFHLMPGDVKMIAAMRMALILEGVDIGG-------------SVFLSAQHEREHVEHLVTTFDRVLDRL....... 435
25 -19.3006dvs_A mol:protein length:453 D-phenylglycine aminotransferase  ali model follow..  18  43.................................................................................................................................................................................................................................................................................................................................................................................................................ISDAQGVHKTDVDGNVYLDFFGG-VLG--GHPRVNAAIAEALSH-GVQYAAS------HPLEVRWAERIVAAFPSIRKLRFGSGTETTLLALRAFTGRRMILRIATHYHGW-HDFSASGYNNTLLIRPDDIEGMREVFAQHGSDIAAFIAEPVGSHFGVTPVLREGAELARQYGALFILDEV--SGFRVGNH-GMQALLDVQPDL----TCLAKASA--GGLLGGREDVMGVLSRGSDRKVLHQGTNPITAAAAIAAIDTIL-EDDVCAKINDLGQFAREAMNHL---LAYGRFSGFHLMPGDVKMIAAMRMALILEGVDIGG-------------SVFLSAQHEREHVEHLVTTFDRVLDRLA...... 436
26 -19.3005x3f_A mol:protein length:501 Putrescine aminotransferase,Immunoglobulin G-binding protein A  ali model follow..  13  65................................................................................................................................................................................................................................................................................................................................................................................................................EWQAGSLNTLVDTQGQEFIDCLGG--VG--RNPVVVSAVQNQLAKQPLHSQE------LDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLA-GKFTFIATSGAFHGKSLGALSATAKSTFRVPFGNIEAMRTALNECKDDVAAVILEPIQGEGGVILPLTAVRKLCDEFGALMILDEVQT---MGRTGK-ACEHENVQPDI-----CLAKALGG-GGATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQ-NLPAQAEQKGDMLLDGFRQL-VQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVA-----GTLNNAKTIRIEPPLTLTIEQCELVIKAARKALAAM....... 450
27 -19.2003wgb_A mol:protein length:341 L-allo-threonine aldolase  ali model follow..  18  2.............................................................................................................................................................................................................................................................................................................................................................................................................................SHMRYIDLRSDTVTQ---TDAMRQCMLHA--EVGDDV-------GEDPGVNALEAYGADLLGKEAALFVPSGTMSNLLAVMSHCQRGEGAVLGSAAHIYRYEAAVLGSVALQPVPMQADGSLALADVRAAIAPRLVCLEN--THNGKVLPLREMRELVDEHGLQLHLDGARLFNAVVASGHTVRE---LVAPFDSVSICLSKGLGAVGSLLVGSHAFIARARRLRKMVGGGMRQAGILAQAGLFALQ---QHVVRLADDHRRARQLAEGLAALPLDLAQVQTNMVFLQL-TSGESAPLLAFMKARGILF---------SGYGELRLVTHLQIHDDDIEEVIDAFTEYLGA........ 341
28 -19.2004ao9_A mol:protein length:454 BETA-PHENYLALANINE AMINOTRANSFERASE  ali model follow..  15  67.................................................................................................................................................................................................................................................................................................................................................................................................................IARGEGAALWDADGHRYADFIAEYTAGVYGHPEIRDAVIEAMQG-GINLTGH------NLLEGRLARLICEFPQIEQLRFTNSGTEANLMALTHFTGRRKIVVFSGGYHGG-VLGFGARPSDFLVLPYNDAQTARAQIERHGPEIAVVLVEPMQGASGCIPGLQALRESATQVGALLVFDEV----MTSRLAHGLANKLGIRSDL-----TLGKYIG--GGMFGGRADVMALFDPRTGPLAHSGTFNVMTMAAGYAGLTKLF-TPEAAGALAERGEALRARLNAL-MNAHFVQGDVRDLAAVDGRLRQLLFFHLLNEDIYSSP-----------RGFVVLSLPLTDADIDRYVAAIGSFIGGHG...... 441
29 -19.0004e77_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  16  39.................................................................................................................................................................................................................................................................................................................................................................................................................IERADGAYLFDVDGKAYIDYVGS-ILG--NHPAIRQAVIEAVER-GLSFGAP------TEMEVKMAQLVTDLVPTMDMVRMNSGTEATMSAIRGYTGRDKIIKFEGCYHGH-ADCLLVKAGHTLTCTYNDLASVRQAFEQYPQEVACIIVEPVAGNMNCIPPLPGLRALCDEFGALLIIDEV--TGFRVALA-GAQDYYHVIPDL----TCLGKIIG--GGMFGGRREVMNALAPTGPVYQAGTSGNPIAMAAGFACLTEIS-QVGVYETLTELTDSLATGLRHA-FTNADTVTCYQDVMNCDVERFKRFFHLMLEEGVYLAP---------SAFEAGFMSLAHSNEDIQKTVNAARRCFAKL....... 429
30 -19.0002e7u_A mol:protein length:424 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  18  38.................................................................................................................................................................................................................................................................................................................................................................................................................LVRGEGAYVWDADGNRYLDYVMS-ILG--AHPKVLARVRETLER-GLTFGAP------SPLEVALAKKVKRAYPFVDLVRFNSGTEATMSALRGYTGRPYIVKFRGNYHGH-ADGLLVEAGSTLVLEYNDPEGLREVLKRRGEEIAAIIFEPVVGNAGVLVPTEDFLKEAKAYGVLLIADEV--TGFRLAFG-GATELLGLKPDL----VTLGKILG--GGLYAGRREIMEKVAPLGPVYQAGTSGNPLAMAAGLATLELLEENPGYYAYLEDLGARLEAGLKEV-ITVFFTEGPVVDARRTDTELFKRFFHGLLDRGIYWPP---------SNFEAAFLSVAHREEDVEKTLEALRKA........... 423
31 -18.9002epj_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  18  11..........................................................................................................................................................................................................................................................................................................................................................................................KSRMLFERTKELFPGGVNSPVRAAVKPYPFYVKRGEGAYLYTVDGARIVDLVKHPRVLEAVEEALAR-GWLYGAP------GEAEVLLAEKILGYVKRGGMIRFNSGTEATMTAIRGYTGRDLILKFDGCYHGS-HDAVLVAAGLTLVTPYNDVEALERVFAEYGDRIAGVIVEPVIANAGVIPPLAALQRLSRESGALLILDEV--TGFRLGLE-GAQGYFNIEGDI----IVLGKIIG--GGFVAGSREVMSLLTPQGKVFNAGTNAHPITMAAGLATLKALE-EEPVYSVSREAAKALEEAASEV-MQLFIGVEEVSQARKADKKFYVKLHEEMLRRGVFIAP---------SNLEAVFTGLPHQGEALEIAVEGLRSSLKTV....... 431
32 -18.9005i92_A mol:protein length:435 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  19  38.................................................................................................................................................................................................................................................................................................................................................................................................................FKHAEGAYVLDEDDKRYVDYVGS-ILG--SHPDVLDAVRRQLDH-GLSYGAP------TALEVEMADLVCSMVPSMEMVRMSSGTEATMSAIRGYTGRDSIIKFEGCYHGH-SDSLLVKAGHTLTLPFNDIEAVRKTLGEVGKEVACIIVEPVAGNMNCVPPLEGLREACDEHGVVLIFDEV--TGFRVALG-GAQAYYGVTPDL----STFGKIIG--GGMFGGKREIMQQISPLGPVYQAGTSGNPLAMAAGLTTLRLIS-RPGFHDELTAYTTRMLDGLQQR-FSGADAIVTFEDVMASDVERFKRFFHLMLDGGVYLAP---------SAFEAGFTSIAHGDKELEITLNAAEKAFAALK...... 429
33 -18.9005ykr_A mol:protein length:461 Probable aminotransferase  ali model follow..  17  61.................................................................................................................................................................................................................................................................................................................................................................................................................VKEAQGARVTDIDGQQYVDFALGDSGAMFGHPAVADAIARQARR-GSTLMLP------TEDSLWVGAELARRFGLPYWQVTTSATDANRFVLRMLSGRDKVVVFNCNYHGS-VDESQVEFTTTRLVEFNDLDALEAALAHGD---AAVLTEPFMTNVGMVPPHAGLRELTRRHDVALIIDETHTISC-----AGYSGAHGLEPDF-----VLGKCIA--GGIWGCSQAQAERIWAVLPHF--TLAGNALQLAAMRATFAEVMT-EDAYRHMFQLAAQLEAGVRAT---LEELRLPWHVTRIGNGLIEACLHLYLLNRGVLLTP----------FHNMALTCPATRAEDVELHDRLLRDCLGELLERPS.. 461
34 -18.9003l44_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1  ali model follow..  15  41.................................................................................................................................................................................................................................................................................................................................................................................................................MERGKGAYFWDVDGNKYIDYLAA-ITG--AHPHITKAITTAAEN-GVLYGTP------TALEVKFAKMLKEAMPALDKVRFNSGTEAVMTTIRAYTGRTKIMKFAGCYHGH-SDLVLVAAGEVITVPFNNVETLKEALDKWGHEVAAILVEPIVGNFGIVEPLEKVNELVHEAGALVIYDEV--TAFRFMYG-GAQDLLGVTPDL----TALGKVIG--GGLYGGKKEIMEQVAPLGPAYQAGTAGNPASMASGIACLEVLQ-QEGLYEKLDELGATLEKGILEQ-LTVYFTTNTIEAAQDTDGEMFGKFFKLMLQEGVNLAP---------SKYEAWFLTTEHTKEDIEYTIEAVGRAFAALA...... 431
35 -18.8002gsa_A mol:protein length:432 GLUTAMATE SEMIALDEHYDE AMINOTRANSFERASE  ali model follow..  15  43.................................................................................................................................................................................................................................................................................................................................................................................................................FDRVKDAYAWDVDGNRYIDYVGT-ICG--AHPEVIEALKVAMEK-GTSFGAP------CALENVLAEMVNDAVPSIEMVRFNSGTEACMAVLRAYTGRDKIIKFEGCYHGH-ADMFLVKAGNTLTTPYNDLEAVKALFAENPGEIAGVILEPIVGNSGFIVPLEGLREITLEHDALLVFDEV--TGFRIAYG-GVQEKFGVTPDL----TTLGKIIG--GGLYGGKREIMQLVAPAGPMYQAGTSGNPLAMTAGIKTLELLR-QPGTYEYLDQITKRLSDGLLAI-FGFFFTEGPVHDAKKSDLQKFSRFHRGMLEQGIYLAP---------SQFEAGFTSLAHTEEDIDATLAAARTVMSAL....... 432
36 -18.8006cbm_A mol:protein length:438 Neamine transaminase NeoN  ali model follow..  16  41.................................................................................................................................................................................................................................................................................................................................................................................................................FTAASGAWLTDESGFRWIDFDNA-LLG--GDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPERVAAVVVSPDHMHLSPGW--YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVA-TGEPQRAVREAGDRFLRHARKALDDASAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERLA...... 388
37 -18.7005hdm_A mol:protein length:434 Glutamate-1-semialdehyde 2,1-aminomutase 1, chloroplastic  ali model follow..  14  45.................................................................................................................................................................................................................................................................................................................................................................................................................IDSVKGSKMWDIDGNEYIDYVGS-IIG--ADDEVLAALAETMKK-GTSFGAP------CLLENVLAEMVISAVPSIEMVRFNSGTEACMGVLRAFTNKEKFIKFEGCYHGH-ANAFLVKAGDTLTAPYNDLEAVEKLFAAHKGEISAVILEPVVGNSGFIPPINGLRQLTKDNGVLLIFDEV--TGFRLAYG-GAQEYFGITPDL----TTLGKIIG--GGLYGGRRDIMEMVAPAGPMYQAGTSGNPLAMTAGIHTLKRLK-QAGTYEYLDKITKELTNGILEA-FGFFFAEGPVYDSKKSDTEKFGRFFRGMLEEGVYFAP---------SQFEAGFTSLAHTPEDIQLTIAAAERVLSRI....... 434
38 -18.7006cbk_A mol:protein length:424 Neamine transaminase NeoN  ali model follow..  16  25.................................................................................................................................................................................................................................................................................................................................................................................................................FTAASGAWLTDESGFRWIDFDNA-LLG--GDPVVAEAVARAATG------ADGTATGWSRRVDAVLERLHALCGGEVVGLFRSGTAAVRAAVLEATGRPLLLSAGYHGYDPMWYPSEAPNADGVVDFFFDLGLLRELLRAPERVAAVVVSPDHMHLSPGW--YRELRRLCSAAGVVLVADEV--VGL--RYAPGLSTAELLAPDV-----VVAKGMA--NGHVGGSRRLLKPLKEVSFTSFFE----PTILAAADAALARVA-TGEPQRAVREAGDRFLRHARKALDDASAGDGTFFQFVPATEELEEALYGAANAEGLLFYA-------------NQGVSAAFDEAVLGEAERRFARVCERLA...... 372
39 -18.7003lws_A mol:protein length:357 Aromatic amino acid beta-eliminating lyase/threonine aldolase  ali model follow..  10  14..........................................................................................................................................................................................................................................................................................................................................................................................................................................GQISGHGKRNVGVLKTAFAAVADEMASDQY-GTGAIIEPFEQKFADVLGMDDAVFFPSGTMAQQVALRIWSDENRTVAYHPLCHLEIHEQKELHPIETILVGAADRLMTLDEIKALPDIACLLLELPQREIGGVAPAFSELETICRERGIRLHLDGARLFEMLPYYEKTAAE---IAGLFDSIYISFYKGLGGAGAILAGPAAFCQTARIWKRRYGGDLISLYPYIVSADYYYELRKDRMGQYYEQAKQLAEQFNALPGVHTTPEVPVSNMFHLHFDGQAADISLEQVQEETGLGFVG------YLVDKDGYCSTEISVGDAYGELDQQTRDAGFARL....... 352
40 -18.7003bs8_A mol:protein length:438 Glutamate-1-semialdehyde 2,1-aminomutase  ali model follow..  14  41.................................................................................................................................................................................................................................................................................................................................................................................................................MERGKGSKIFDIDGNEYIDYVLS-ILG--TNDRVVESLKKVAEY-GTSFGAP------TEVENELAKLVIDRVPSVEIVRMSSGTEATMSALRGYTGRNKILKFEGCYHGH-GDSLLIKAGNTITVPYNDLESVKLAFQQFGEDIAGVIVEPVAGNMGVVPPLQGLRDITEQYGSLLIFDEV--TGFRVDYN-CAQGYFGVTPDL----TCLGKVIG--GGLYGGKAEIMEQIAPSGPIYQAGTSGNPLAMTAGLETLKQLT--PDSYKNFIKKGDRLEEGISKA-IGFFFTNEPVITAKASDLKLFASYYKGMANEGVFLPP---------SQFEGLFLSTAHTDEDIENTIQAAEKVFAEIS...... 430
41 -18.7003hdo_A mol:protein length:360 Histidinol-phosphate aminotransferase  ali model follow..  19  21..........................................................................................................................................................................................................................................................................................................................................................................................................................QPPDIASWIKLNTNE---YPPSPEVVKAILEELGP-----DGAALRIYPSASSQKLREVAGELYGFDSWIIMANGSDEVLNNLRAFAAEGEEIGYVHPSYSYYGTLAEVQGARVRTFGLTG--DFRIAGFPERYEGKVFFLTTPNAPLGPSFPLEYIDELARRCAGMLVLDETYAEFAESNALELVRRHENV-----VVTRTLSKSYSLAGGLAIARPEVIAALDKIRDHY----NLDRLAQAACVAALRDQAYLSECCRRIRETREWFTTELRSIGYDVIPSQGNYLFATPPDRD-GKRVYDGLYARKVLVRHFSDPLLAH----MRISIG---TREEMEQTLAALKEIGE......... 353
42 -18.6002cfb_A mol:protein length:411 GLUTAMATE-1-SEMIALDEHYDE 2,1-AMINOMUTASE  ali model follow..  15  22.................................................................................................................................................................................................................................................................................................................................................................................................................FDHVKGAHIWDVDGNQYIDYVGS-IVG--AHPEVIDALHAALEK-GTSFGAP------CLLENILAEMVIAAVPSVEMVRFNSGTEACMAVLRAYTQREKVIKFEGCYHGH-ADMFLVKAGATLTAPYNDLEAVSRLFEQYPNDIAGVILEPVVGNAGFIPPLEGLRELTKQYGALLVFDEV--TGFRIAYG-GAQEKFGVTPDL----TTLGKVIG--GGLYGGRAEIMKMVAPAGPVYQAGTSGNPLAMTAGIKTLEILS-RPGSYEHLDRITGKLVQGLLDA-FGLFFTAGPVTQAKQSDLKKFAAFHRGMLEQGIYLAP---------SQFEAGFTSLAHTEADIERTIAAARTVLSQL....... 411
43 -18.6003k28_A mol:protein length:429 Glutamate-1-semialdehyde 2,1-aminomutase 2  ali model follow..  15  39.................................................................................................................................................................................................................................................................................................................................................................................................................MERGKGSKVYDIDGNEYIDYVLS-IHG--ANDRVVEALKAVAER-GTSFGAP------TEIENKLAKLVIERVPSIEIVRMNSGTEATMSALRGYTGRNKILKFIGCYHGH-GDSLLIKAGNTITVAYNDLESVKYAFEQFGDDIACVIVEPVAGNMGVVPPLEGLREVTEQNGALLIFDEV--TGFRVAYN-CGQGYYGVTPDL----TCLGKVIG--GGLYGGKAEIMRQVAPSGPIYQAGTSGNPLAMAAGYETLVQLT--PESYVEFERKAEMLEAGLRKA-IGIFFTDEPVIAAKSSNLQFFAAYYREMVEQGVFLPP---------SQFEGLFLSTVHSDADIEATIAAAEIAMSKLK...... 428
44 -18.4001ohv_A mol:protein length:472 4-AMINOBUTYRATE AMINOTRANSFERASE  ali model follow..  14  26..........................................................................................................................................................................................................................................................................................................................................................................................RSRELMKQLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQ--IG--SHPALVKLVQQPQNVSTFINRPALGILPPENFVEKLRESLLSVAGMSQLITMACGSCSNENAFKTICPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDEEVEDLIVKYRKKKKTVAGIIVEPIQSEGGDNHAFRKLRDISRKHGCAFLVDEVQ-TG-GGSTGK-AHEHWGLDDPADVM--TFSKKMM--TGGFFHKEEFRPNAPYRIFN---TWLGDPSKNLLLAEVINIIKRE-DLLSNAAHAGKVLLTGLLDLQISRVRGRGTFCSFDTPDESIRNKLISIARNKGVMLGGC-------GDKSIRFRPTLVFRDHHAHLFLNIFSDILADFK...... 472
45 -18.4004r2n_A mol:protein length:367 Putative phenylalanine aminotransferase  ali model follow..  18  23...............................................................................................................................................................................................................................................................................................................................................................................................................................PGAIKLASNE---FGPLPSVRAAIDRATDTVNRYPDNGC---------VQLKAALARHLGPDEHVAVGCGSVSLCQQLQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNV-VVLRTFSKAYGLAGGYAIGHPDVITALDKVYVPF----TVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSR--TQDFVEQAADARIVVRPYG-------TDGVRVTVA---APEENDAFLRFARRWRSDQKLAAAL. 360
46 -18.3004uox_A mol:protein length:467 PUTRESCINE AMINOTRANSFERASE  ali model follow..  13  67................................................................................................................................................................................................................................................................................................................................................................................................................EWQAGSLNTLVDTQGQEFIDCLGGFNVG--RNPVVVSAVQNQLAKQPLHSQE------LDPLRAMLAKTLAALTKLKYSFFCNSGTESVEAALKLA-GKFTFIATSGAFHGKSLGALSATAKSTFRVPFGNIEAMRTALNETGDDVAAVILEPIQGEGGVILPLTAVRKLCDEFGALMILDEVQT---MGRTGK-ACEHENVQPDI-----CLAKALGG--GATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQ-NLPAQAEQKGDMLLDGFRQL-VQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVA-----GTLNNAKTIRIEPPLTLTIEQCELVIKAARKALAAMR...... 453
47 -18.2001svv_A mol:protein length:359 THREONINE ALDOLASE  ali model follow..  13  2....................................................................................................................................................................................................................................................................................................................................................................................................................STPRTTATAAKPKPYSFVNDYSVG---HPKILDLMARD-------NMTQHAGYGQDSHCAKAARLIGELLERPDAHFISGGTQTNLIACSLALRPWEAVIATQLGHISTHEAIEATGHKVVTAPCPDVADIESALHENRSIPKLVYISTQYTKQ----ELEDISASCKEHGLYLFLDGARLASALSSPVNDLTLA-DIARLTDMFYIGATKAGGMGEALIILNDALKPNARHLIKQRGALMAKGWLLGIQFEVLMK------ELGAHSNKMAAILKAGLEACGIRLAWPSASNQLFPILENTMIAELNNDFDMYTVEP-------LKDGTCIMRLCTSWATEEKECHRFVEVLKRLVASTA...... 359
48 -18.1003ly1_A mol:protein length:354 Putative histidinol-phosphate aminotransferase  ali model follow..  15  16...............................................................................................................................................................................................................................................................................................................................................................................................................................DNPIRINFNE---LGMSPKAQAAARDAVVKANRYAKNEI---------LMLGNKLAAHHQVEPSILLTAGSSEGIRAAEAYASLEAQLVIPELTYGDGEHFAKIAGMKVTKVKMLDIEGLKAAVAAYSGPSIVYLVN---NPTGTITPADVIEPWIAS-NTMFIVDEAYAEFVNDPRFRSISPMITQGAENIILLKTFSKIHAMAGGYAVAHPTVIALMGRYVAGE----KINFSGVDAALASMNDSAFITYSKKSNDVSRQILLKALEDLKLPYLPSEGNF--VFHQLVVPLKDYQTHMADAGVLIGRAFPPA----DNWCRISLG---TPQEMQWVADTMREFRKKSWI..... 354
49 -18.0002cin_A mol:protein length:449 L-LYSINE-EPSILON AMINOTRANSFERASE  ali model follow..  13  16..........................................................................................................................................................................................................................................................................................................................................................................................TPDRVHEVLGRSMLVDGLDIVLDLTRSGGSYLDAITGRRYLDMFTF--LG--NPPALVDDREFHAELMQAALNKPSNSDVYSVAMARFVETFARVLALPHLFFVEGGALAVENALKAA-LGTQVLHLRGAFHGRSGYTLSLTNTKPTILEAEALRQARAAFETRPHDIACFVAEPIQGEGGDRHFFAAMRELCDEFDALLIFDEVQ-TG-CGLTGT-AYQQLDVAPDI-----AFGKKTQVCGGRRVDEVADNVFAVPSRLNSTWGGN--LTDMVRARRILEVIEAE-GLFERAVQHGKYLRARLDELAVLDPRGRGLMCAFSLPTTADRDELIRQLWQRAVIV-------LPAGADTVRFRPPLTVSTAEIDAAIAAVRSALPVVT...... 449
50 -17.9005viu_A mol:protein length:419 Acetylornithine aminotransferase  ali model follow..  15  8..........................................................................................................................................................................................................................................................................................................................................................................................NSEYFIELEEKHGAHNYHPLPVVLDRGEGVFVWDVEGKKYYDFLSAVNQG--SHPKIVEALVEQASKLALTSRA------YNSKLGEYEQKITSLLGFDKVLPMNSGAEAVETAVKLA-NAAKIIVCENNFHGRTTTIVSFSNDPDANIPYNDIAALEEVLSKEAGNIAAFLVEPIQGEAGVYVPLKQSSELCKKHNVLFIADEVQT---IARTGK-ACHHEDVQPDI-----ILGKALSG--SAVLANNNIMDVIKPGQHGSTFGGN--PLACAVAMAALDVVQDE-KLSERAEKLGNLFRSEIEKL-----IEKTDLITKVRGDSSTAWNLCLALKENGLLA-------KPTHGNIIRLAPPLVITEEQLLDCVKIIEKTILEF....... 413
51 -17.9003get_A mol:protein length:365 Histidinol-phosphate aminotransferase  ali model follow..  12  30...............................................................................................................................................................................................................................................................................................................................................................................................................................KEVIKLASNE---FGTPPKAIECLRQNANKAHLYPDDSM---------IELKSTLAQKYKVQENIIIGAGSDQVIEFAHSKLNSKNAFLQAGVTFAMYEIYAKQCGAKCYKTQSITLDEFKKLYETHKDEIKLIFLCLPNNPLGECLDASEATEFIKGVDCLVVIDAAYNEFASFKDSKKHLEPCELIKEFDLYLGTFSKLYGLGGGYGIANANIISAFYKLRAPF----NVSNLALKAAVAAMDDDEFTEKTLENNFSQMELYKEFAKKHNIKIIDSYTNFITYFFDEKN-STDLSEKLLKKGIIIRNLKSYGLN-----IRITIG---TSYENEKFFTEFDKILR......... 365
52 -17.9001oat_A mol:protein length:439 ORNITHINE AMINOTRANSFERASE  ali model follow..  13  39..........................................................................................................................................................................................................................................................................................................................................................................................TSDDIFEREYKYGAHNYHPLPVALERGKGIYLWDVEGRKYFDFLSSVNQG--CHPKIVNALKSQVDKLTLTSRA------YNNVLGEYEEYITKLFNYHKVLPMNTGVEAGETACKLA-YKAKIVFAAGNFWGRTLSAISSSTDPTSYIPYNDLPALERALQ--DPNVAAFMVEPIQGEAGVVVPLMGVRELCTRHQVLFIADEIQT---LARTGR-AVDYENVRPDI-----LLGKALSG--SAVLCDDDIMLTIKPGEHGSTYGGN--PLGCRVAIAALEVLEEEIILRNELMKLPSDVVTAVRGKGLLNA------IVIKETKDWDAWKVCLRLRDNGLLA-------KPTHGDIIRFAPPLVIKEDELRESIEIINKTILSF....... 439
53 -17.8004zlv_A mol:protein length:441 Ornithine aminotransferase, mitochondrial, putative  ali model follow..  15  33..........................................................................................................................................................................................................................................................................................................................................................................................TEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGLSQG--CHPRVIAALCRQAERLTLTLRA------GNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIA-DSAKVILCNNNYWGRTITACSSSTTFDCYIDYDDVGALEEALK--DPNVAAFFVEPIQGEGGVNVPLKRAHELCRSKNVLLIVDEIQT---LCRTGR-AADHDEVHPDI-----LLGKSLSA--SAVMGRADVMDVLKPGTHGSTFGGN--PLACAVAVEALTVLKDE-KLADRAERLGAQFRDCLRRELYGKVPWIKEIRGLLNADAIDPNDVVMKLKENGILS-------KPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV....... 435
54 -17.8003pj0_A mol:protein length:359 Lmo0305 protein  ali model follow..  14  22................................................................................................................................................................................................................................................................................................................................................................................................................................................PRNVGVLTEALQNIDDNLESD--IYGNGAVIEDFETKIAKILGKQSAVFFPSGTMAQQIALRIWADENRRVAYHPLSHLEIHEQKELQQITPLLLGTANQLLTIDDIKSLREPVSSVLIELPQREIGAFEELEKISEYCHEQGISLHLDGARLWEITPFYQKSAEE---ICALFDSVYVSFYKGIGGAGAILAGNDDFVQEAKIWKRRYGGDLISLYPYILSADYYFE---KRIGKMAEYFEAAKGLAERFNSCSTVPEVPVSNMFHVYFENSADEIGLTKIQDETGVGISGYLQEKS-ADVCAFEVSVGDAFAEIPAKNLELVFRCLEKEL....... 359
55 -17.7004fl0_A mol:protein length:456 Aminotransferase ALD1  ali model follow..  13  27.................................................................................................................................................................................................................................................................................................................................................................................FEMKKLGGSTKLVRNVNLEKLKNNYL---FPEINRRELEHIEKHPNVQLISLGTGD--TEPIPEQITSHMSNFAHGLSTVEGYRGYEQGNKTLRKAIAETFYRDLHVKNEVFVSDGAQSDISRLQLLLGSNVTIAVQDPTFPAYIDSSVIIGQTGHFHEKTKKYQNVVYMPAMTPRTDVIFFCSPNNPTGYVASLHQLVDFAKTNGSIIIFDSAYAAFIEDGSPRSIYEIPGAREVA-IEVSSFSKFAGFTGGWSIIPDELLPIINDFHR--IVTTSFNGASNIAQAGGLACLSSGGSVNNYYKENRKILMDTLVSLGLKVYGGVNAPYLWVHFKGSKSWDVFNEILEN---THIITVPGSPGGEEYLRISGFG--RRDHIVEASKRLQNFFNTRTKHFTYL 449
56 -17.6005ll2_A mol:protein length:480 Isoleucine 2-epimerase  ali model follow..  15  54................................................................................................................................................................................................................................................................................................................................................................................................................VIDHAHGATLVDVDGNKYIDLLAS--VG--THEKVVKAIADQAQKLIHYTPAYFHHVPGMELSEKL-AKIAPGNSPKMVSFGNSGSDANDAIIKAYTGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTRKIGFNEFKKPFESFLPADETVLIEPIQGDGGIIKAMQLVYKFCHEHGILFAIDEVNQ---LGRTGKAIQQFKDIEPDL-----SVGKSLAS--SAVIGKKEVMQSLDAPAHLFTTAGN--PVCSAASLATLDVIEYE-GLVEKSATDGAYAKQRFLEMGIELVKDPKTKEP----DSDAATKVIYYAFAHGVVI-------ITLAGNILRFQPPLVIPREQLDQALQVLDDAFTAVE...... 459
57 -17.6004wbt_A mol:protein length:376 Probable histidinol-phosphate aminotransferase  ali model follow..  14  36...............................................................................................................................................................................................................................................................................................................................................................................................................................KIAARIGANE---FGPAPSVLLAIRQAAGDTWKYADPEN---------HDLKQALARHLGTSANIAIGEGIDGLLGQIRLVVEAGAPVVTSLGGYPTFNYHVAGHGGRLVTVPYADREDLEGLLAAGRENAPLVYLANPDNPMGSWWPAERVVAFAQALTTLLVLDEAY-CETAPRDALPPIESLIDKPNV-IRARTFSKAYGLAGGYTLSTPGTAQAFDKIRNHF----GMSRIGVAAAIAALADQDYLKEVTLKIANSRQRIGRIAADSGLAPLPSATNFVAVDCGKDASRAIVDRLMSDHGIFIRMPGVAPLNR----IRISTA---PDAEMDLLAAALPEVIRSLA...... 374
58 -17.5005d95_A mol:protein length:454 Aminotransferase class-III  ali model follow..  16  48.................................................................................................................................................................................................................................................................................................................................................................................................................AARGRGAVIVDADGEERLDFVNNYTALIHGHPDINEAVIRQLAD-GVAFAMP------TEHEIALAELLTEVPSLQQVRFTNSGTEAVMMAIKAYTGRPRIAKFDGCYHGS-YDFAEVSTQSVVVLPFNDIDGTERLIEQHRDELAAVLIDPNPRSLGLYPALQRLREITRAYGIVLIFDEVISLRS-----GGMQSVLGVTPDL----TAMGKIIG--GGFVGGSAEVMSVFDPTGGP---TFNANPVTMVAGLTAMRKLT--PAEFDRLATLGQQLRAGVEEVLREAGTGYGSLFHIHLHERAFVGRVHEALMGRGIFITP-----------ALFGCLSTPMGVPEVEAFVDAFAAALQDAR...... 445
59 -17.5004nog_A mol:protein length:442 Putative ornithine aminotransferase, mitochondrial  ali model follow..  15  18..........................................................................................................................................................................................................................................................................................................................................................................................TEEDFFACDRQYVCQNYAPVPVVISKGKGARVWDINGNEYYDFLAGLSQG--CHPRVIAALCRQAERLTLTLRA------GNDVTGPACRFMAEMFGYDRVLLMNTGAEAGESALKIA-DSAKVILCNNNYWGRTITACSSSTTFDCYIDYDDVGALEEALK--DPNVAAFFVEPIQGEGGVNVPLKRAHELCRSKNVLLIVDEIQT---LCRTGR-AADHDEVHPDI-----LLGKSLSA--SAVMGRADVMDVLKPGTHGSTFGGN--PLACAVAVEALTVLKDE-KLADRAERLGAQFRDCLRRELYGKVPWIKEIRGLLNADAIDPNDVVMKLKENGILS-------KPTRGRVMRFIPPLVITDEEHRDATTRIIKSFLAV....... 420
60 -17.5004ppm_A mol:protein length:861 Aminotransferase  ali model follow..  11  75..............................................EMLADARGIAARVVQGIEE-----DGAELVGLGGFTVGRRGEATAEKSPVP----TSGNSLTTYAGYKALQIQSWLEIRPEE-----EPVAIVGYPGSICLALSRLLLAHGFSLHLLHRAGNHDRSELLSHL--PEEYHSRVTLTSDPEDLYPRCKLF---AATSAGGVIDPARLQPGSIFIDVALPRDIASETRPARDDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAETIVLALENRRENFSLGRYLAPEKVLEIGEIAERHGFFAYPLASYGERIDRQSVTNLKRYYHHDIYAGESADAALPASRLAFIDAVIAQTPAREDTLDRYHQYINPMMVDFLKLQRCDNVFRSAAGTQLYDDAGEAFLDMVAG--LG--NPQPVVNALKNYLDAQGPNFIQYISIP---EQTAKLAEVLCRLANMGRVFFSNSGTEAVEAAMKASTGKPGIAYLRNSYHGKTLGALSITGRDKHRVPFGDLAALREALN--REDVGALMIEPIQGEGGVHIPLQAVQQLCRETGVLLMVDEVQT---LGRTGK-ACEWDGIEPDVLMLSKSLSGGLIPIGATLCRADLWQKAYGTADRFLVHSSTYGNLASVVALSALREILAQ-DLVGHAERMGAYFKQALSEIGIQFDQAFTGLPDPVQAHLRAAMDRMEQALGEMFCMKFVTKLCQDHKSTVIRIQPPLIISKAEIDRFVGAFATVCEELS...... 849
61 -17.5003asa_A mol:protein length:400 LL-diaminopimelate aminotransferase  ali model follow..  13  16..............................................................................................................................................................................................................................................................................................................................................................................................................FADLQKRVAQFRLENPQHTVINLSIGD--TQPLNASVAEAFASSIARLSSPTTCRGYDFGLPALRQKLSEDFYRGFVDAKEIFISDGAKVDLFRLLSFFGPNQTVAIQDPSYPAYLDIARLTGAKEIIALPCLQENAFFPEFPEDTHIDILCLCSPNNPTGTVLNLRAIVHYAIEHEILILFDAAYSTFISDPSLPKSIFEIPDARFCAIEINSFSKPLGFAGGWTVIPQELTYADGHFVIQDWTFNGASIPAQEAGVAGLS--LPQLEAIHYYRENSDLLRKALLATGFEVFGGEHALWVKPTQANISDRDLFDFFLRE---YHIAITPGIRSGSGFVRFSSLG--KREDILAACERLQMAPALQS...... 394
62 -17.5004uqv_A mol:protein length:429 SERINE HYDROXYMETHYLTRANSFERASE  ali model follow..  18  21.............................................................................................................................................................................................................................................................................................................................................................................................................................MRESIKLIASENITS----LAVREACATDFHRYAEGLPGKRLYQGCKEVETLCIELSKELFKAEHANV--SGVVANLAVFFAETKPGDKLMAPDGGHISHWKVSAAGIRGLKVINHPDADAMVKKILEE--KPKLILFGG--SLFPFPHPVADAYEAAQEVGAKIAYDGAHVLGLI----AGKQFQDPLREGAEYLMGSTHKTFGPQGGVILTTKENADKIDSHVFPGVVSNHHLHHKAGLAIALAEMLEFGEAYAKQVIKNAKALAQALYERGFNVDFTESHQVIIDIDIEFSASELAKMYEEANIILNKNLLPNNSDNPSGIRLGTQEC-KEKEMEEIAEFMKRIAID........ 392
63 -17.4003qgu_A mol:protein length:449 LL-diaminopimelate aminotransferase  ali model follow..  14  36...........................................................................................................................................................................................................................................................................................................................................................................................DVQRNENFGKLRAGYL---FPEIARRRKAHQEKNPDAKIISLGIGD--TEPLPKYIADAMAKAAAGLATREGYSGYEQGQGALREAVASTFYGHAGRADEIFISDGSKCDIARIQMMFGSKPTVAVQDPSYPVYVDTSVMMGMTGDHNGTGFDGIEYMVCNPDNHRTDIIFFCSPNNPTGAAATLTELVNFARKNGSILVYDAAYALYISNPDCPKTIYEIPGADEVAIETCSFSKYAGFTGGWTVVPKALKYANGEPVHADWCFNGASNIVQAGGLACLQ-LKEMNAMIKFYKENAQILKTTFTEMGFSVYGGDDAPYIWVGFPGKPSWDVFAEILER---CNIVTTPGSPAGEGFVRASAFG--SRENILEAVRRFKEAYGKRN...... 441
64 -17.4003dxw_A mol:protein length:452 Alpha-amino-epsilon-caprolactam racemase  ali model follow..  16  35................................................................................................................................................................................................................................................................................................................................................................................................................AISGGRGARLIEENGRELIDLSGA-SLG--GHPAIVAAVSAAAANPAGATILSASNAPAVTLAERLLASFPG--GTHKIWFGHSGSDANEAAYRKATGRSGVIAFAGAYHGCTVGSMAFSGHSVQADA---LTLLTEKLAAVPAGSGAAFIEPIQSDGGLIVPLRKFADICRAHGILVVCDEVKV---LARSGR-CFEHEGFVPDI-----VLGKGLGG-GLPLSAVIAPAEILDCASAFAMQTLHGNPISAAAGLAVLETIDRD-DLPAMAERKGRLLRDGLSELGMELVCDRQSREP----ARAETAKLIYRAYQLGLVVY-----YVGMNGNVLEFTPPLTITETDIHKALDLLDRAFSELS...... 433
65 -17.4001d7r_A mol:protein length:433 PROTEIN (2,2-DIALKYLGLYCINE DECARBOXYLASE (PYRUVATE))  ali model follow..  19  28................................................................................................................................................................................................................................................................................................................................................................................................................IIERAKGSFVYDADGRAILDFTSG-VLG--CHPEIVSVIGEYAGKLDHLFSG------LSRPVVDLATRLANITGLDRALLLSTGAESNEAAIRLVTGKYEIVGFAQSWHGMTGAAASATYSAGRK-YLAELDYAFDLIDRQSSGNAAFIAEPILSSGGIIELMAALKRKCEARGMLLILDEAQT---VGRTGT-ACQRDGVTPDI-----TLSKTLGA--AAIVTSAAIEERAHELGYLFYTTHVSDPLPAAVGLRVLDVVQRD-GLVARANVMGDRLRRGLLDLGVEIVKDRRTKEP----ADGLGAKITRECMNLGLSMNIV---QLPGMGGVFRIAPPLTVSEDEIDLGLSLLGQAIERA....... 432
66 -17.4004atp_A mol:protein length:456 4-AMINOBUTYRATE TRANSAMINASE  ali model follow..  17  49................................................................................................................................................................................................................................................................................................................................................................................................................YVEDADGGIIRDVDGNSFIDLGSG--VG--SDPAVVAAVQEAAAHFTHTCFMVTPYEGYVAVTEQL-NRLTPGDHAKRTVLFNSGAEAVENAVKLATGRDAVVAFDHAYHGRTNLTMALTAKAMPYKTNEAAKRAITMIEKQIGGDQVIIIEPIQGEGGFIVPLPALSEWAKEKGIVFIADEVQS---FCRTGE-AVDHEGVVPDI-----TMAKGIAG--SAITGRADLLDAVHPGGLGGTYGGN--PVACAAALAAIDTMEQH-DLNGRARHIEELALGKLRELAAELSAGGGSVVGDIRGNAELTKAVAAACLKEGVIIL-----TCGTYGNVIRLLPPLVISDELLIDGLEVLAAAIKAHA...... 456
67 -17.3005m46_A mol:protein length:440 Aminotransferase class-III  ali model follow..  15  29................................................................................................................................................................................................................................................................................................................................................................................................................AVAGGQGARLVEEDGRELIDLSGA-SLG--GHPAIIEAVSRAAANPAGASILSASNAPAVALAERLTASFPG-RGTHKVWFGHSGSDANEAAYRRATGRTGVIAFIGAYHGCTVGSMAFSGHSVQADA---LALLKERLAAVPAGSAAAFIEPIQSDGGLIVPLRKFADICRAHGISVVCDEVKV---LARSGR-CFEHEGFVPDI-----VLGKGLGG-GLPLSAVIAPAEILDCASAFAMQTLHGNPVCAAAGLAVLETIEAE-NLTTAAERKGKLLREGLARLGVELVRNRQSREP----ARAETAKLIYRAYELGLVLY-----YVGMNGNVLEMTPPLTMTEDEVRHAVNLLDQAFTELS...... 427
68 -17.3001tpl_A mol:protein length:456 TYROSINE PHENOL-LYASE  ali model follow..  11  23.............................................................................................................................................................................................................................................................................................................................................................................................................................ERLKKMQEAGYNTFLLNSKDIYIDLLTDSGTNAMSDKQWAGMMMGDEAY-YHLERTVQELFGFKHIVPTHQGRGAENLLSQLAIKPGQYVAGNMYFTTTRYHQEKNGAVFVDIVRDIDLKKLQKLIDEKGAENAYICLAVTVNLAGSMANMRAVRELTAAHGIKVFYDATENAYFIKEQEQGFENK-EMFSYADGCTMSGKKDCLVIGGFLCMNDDEMKELVVVYEGMPSYGGLAGRDMEAMAIGLREAMQYEYIEHRV-KQVRYLGDKLKAAGVPIVEPVGGHAVFLDARRFCEHLTQDEFPAQSLAASIYVETGVRPKLETVRLTIRRVYTYAHMDVVADGIIKLYQHKEDIRG.. 436
69 -17.3004ysn_A mol:protein length:462 Putative 4-aminobutyrate aminotransferase  ali model follow..  15  42................................................................................................................................................................................................................................................................................................................................................................................................................VIDHAHGATLVDVDGNKYIDLLAS--VG--THEKVVKAIADQAQKLIHYTPAYFHHVPGMELSEKL-AKIAPGNSPKMVSFGNSGSDANDAIIKAYTGRQYIVSYMGSYHGSTYGSQTLSGSSLNMTRKIGFNEFKKPFESFLPADETVLIEPIQGDGGIIKAMQLVYKFCHEHGILFAIDEVNQ---LGRTGKAIQQFKDIEPDL-----SVGKSLAS--SAVIGKKEVMQSLDAPAHLFTTAGN--PVCSAASLATLDVIEYE-GLVEKSATDGAYAKQRFLEMGIELVKDPKTKEP----DSDAATKVIYYAFAHGVVI-------ITLAGNILRFQPPLVIPREQLDQALQVLDDAFTAVE...... 447
70 -17.3003p1t_A mol:protein length:337 Putative histidinol-phosphate aminotransferase  ali model follow..  19  16...............................................................................................................................................................................................................................................................................................................................................................................................................................AQAVCLAFNE---EAVEPRVQAAIAAAAARINRYPFDAE---------PRVMRKLAEHFSCPEDNLMLVRGIDECFDRISAEFSSMRFVTAWPGFDGYRARIAVSGLRHFEIGLTDDLLLDPNDLAQVSRDDCVVLANPSNPTGQALSAGELDQLRQR--GKLLIDETY-VDYSSFRARGLAYGENE-----LVFRSFSKSYGLAGGALFGPSELIAAMKRKQWFC----NVGTLDLHALEAALDNDRAREAHIAKTLAQRRRVADALRGLGYRVASSEANFVLVENAAGE---RTLRFLRERGIQVKDAGQFGLHH----IRISIG---REEDNDRLLAALAEYSDH........ 336
71 -17.2001z7d_A mol:protein length:433 ornithine aminotransferase  ali model follow..  12  22..........................................................................................................................................................................................................................................................................................................................................................................................TPEDYINNELKYGAHNYDPIPVVLKRAKGVFVYDVNDKRYYDFLSAVNQG--CHPNILNAMINQAKNLTICSRA------FSVPLGICERYLTNLLGYDKVLMMNTGAEANETAYKLC-NMAKIVVCKNNFSGRTLGCISASTTKKCTVPYDDLEALEEELK--DPNVCAFIVEPIQGEAGVIVPLQGVYDICKKYNVLFVADEVQT---LGRTGK-CVHHYNVKPDV-----LLGKALSG--SAVLANDDIMLVIKPGEHGSTYGGN--PLAASICVEALNVLINE-KLCENAEKLGGPFLENLKRE-----LKDSKIVRDVRGELVNVLDICLKLKENGLIT-------RDVHDKTIRLTPPLCITKEQLDECTEIIVKTVKFFD...... 424
72 -17.1001kkj_A mol:protein length:419 Serine Hydroxymethyltransferase  ali model follow..  19  22......................................................................................................................................................................................................................................................................................................................................................................................................................................QHAKIELIASENFVSRAVMEANKYAEGYPGRRYYGGCEIVEELARERAKQLFGAEHANV--SGAQANMAVYFTVLEHGDTVLGSHGGHLTHGSPVNFSGVQYNFVAYGDYDDVREKARLH--RPKLIVAAA--SAYPRIIDFAKFREIADEVGAYLMVDMAHIAGLVAAG-----LHPNPVPYAHFVTTTTHKTLGPRGGMILCQEQFAKQIDKAIFPGIQGGPLMHVIAAKAVAFGEALQDDKAYAKRVVDNAKRLASALQNEGFTLVSGGTDLLVDLRPQQLTGKTAEKVLDEVGITVNKNTIPYDPESTSGIRIGTAAV-GLEEMDEIAAIIGLVLKN........ 386
73 -17.1003nx3_A mol:protein length:395 Acetylornithine aminotransferase  ali model follow..  11  1............................................................................................................................................................................................................................................................................................................................................................................................MKMDYKEQSHIIPTYKRFDIVLEKGQGVYLFDDKAKKYLDFSSGCALGYN-HAKFNAKIKAQVDKLLHTSN-------YNENIAAAAKNLAKASALERVFFTNSGTESIEGAMKTA-KGGQFIAFKHSFHGRTLGALSLTANEKYQVKFAKYNDISSVEKLVNEKTCAIILESVQGEGGINPAYKALRKLCDEKDILLIADEIQC---MGRSGK-AYEHAQILPDI-----TSAKALGCVGAFVINQKVASNSLEAGDHGSTYGGN--PLVCAGVNAVFEIFKEE-KILENVNKLTPYLEQSLDEL-CKKRKGLGFMQGLSLDKSVKVAKVIQKCQENALLL-------ISCGENDLRFLPPLILQKEHIDEMSEKLRKALKSF....... 395
74 -17.1002eo5_A mol:protein length:419 419aa long hypothetical aminotransferase  ali model follow..  12  27................................................................................................................................................................................................................................................................................................................................................................................................................VIDHGEGVWIYDVDGNKYLDFTSGNNLGWPSHPEVIKIGIEQMQKLAHAAANDFYNIPQLELAKKL-VTYSPGNFQKKVFFSNSGTEAIEASIKVVTGRKYIIAFLGGFHGRTFGSISLTASKAVQLVNRVIEFIEDYIFVNPEEVAGIFFEPIQGEGGYVIPFAELQKLAKKYGILLVDDEVQM---LGRTGK-AIENFNTVPDV-----TLAKALGG-GIMPIGATIFRKDLDFKPGMHSNTFGGNALACAIGSKVIDIVKDLLPHVNEFAEELQGLADDVRGIGL--------AWGLEYNEKKVRDRIIGESFKRGLLL-------LPAGRSAIRVIPPLVISEEEAKQGLDILKKVIKVVK...... 419
75 -17.0003h7f_A mol:protein length:447 Serine hydroxymethyltransferase 1  ali model follow..  20  38.............................................................................................................................................................................................................................................................................................................................................................................................................................QRDTLEMIASENFVP----RAVLQAQGSVLNKYAEGLPGRRYYGGCEVVENLARDRAKALFGAEFANV--SGAQANAAVLHALMSPGERLLGLDLANGGHLTHGMRLNFSGKLYE--DMDAVRATALEF--RPKVIIAGW--SAYPRVLDFAAFRSIADEVGAKLLVDMAHFAGLVAAG-----LHPSPVPHADVVSTTVHKTLGGRSGLIVGKQQYAKAINSAVFPGQQGGPLMHVIAGKAVALKIAATPEADRQRRTLSGARIIADRLMAPDVAKGGTDVHLVLVDLRDSLDGQAAEDLLHEVGITVNRNAVPNDPRPTSGLRIGTPAL-GDTEFTEVADIIATALAT........ 407

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.