current user: public

If you have questions about the server, please let us know.

Query: gi|15607146|ref|NP_214518.1| hypothetical protein (Rv0004) [Mycobacterium tuberculosis H37Rv], from M.tuberculosis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# E-value Template Links and tools%idFirst MTGSVDRPDQNRGERSMKSPGLDLVRRTLDEARAAARARGQDAGRGRVASVASGRVAGRRRSWSGPGPDIRDPQPLGKAARELAKKRGWSVRVAEGMVLGQWSAVVGHQIAEHARPTALNDGVLSVIAESTAWATQLRIMQAQLLAKIAAAVGNDVVRSLKITGPAAPSWRKGPRHIAGRGPRDTYGLast
1 2.000e-50UniRef50_UPI000A00F1F2 DUF721 domain-containing protein n=1 Tax=Devriesea agamarum TaxID=472569 RepID=UPI000A00F1F2  ali  37  7.SDSEEPQEIEEPDPQEYCGGSEYARRALGQARARARERGLFPTSKKMVARDVRDRSTSAPGYSGARPDPRDPQGIESVLSRVLGDLGWRDGLAVGRVMSEWERIVGDQIAAHCTPVSCDDGVLVLSASSSAWATQMRLISKQLITRIHEEVGRNVVTEVKVTGPAAATWKKGRRTVTWRGPRDTYG 192
2 3.000e-49UniRef50_A0QND9 UPF0232 protein MSMEG_0004/MSMEI_0006 n=366 Tax=Corynebacteriales TaxID=85007 RepID=Y004_MYCS2  ali  63  10..PEEDAPVPAPPDHLAGLRGIDLVRRTLEEARGAARSQGKDVGRGRSGPARRVGGNRRRRTWSGPGPDARDPQLLGAVTQDLAKSRGWSARVAEGSVIGRWRAVVGDQIADHATPTALNEGVLTVTAESTAWATQLRMVQSQLLAKIAAVVGDGVVTTLKIVGPAGPSWRKGRYHVSGRGPRDTYG 194
3 2.000e-47UniRef50_A0JQT6 Uncharacterized protein n=85 Tax=Terrabacteria group TaxID=1783272 RepID=A0JQT6_ARTS2  ali  39  4........DAGGLQPGRDPDDIDAAQAALNRMREAAAARGEIRRKAPGAAKKPGRSSAGTRGFTQFHGTGRDPLGLGKVVGRLVAERGWTSPVAVGSVMAEWGTLVGPEISAHCTPESFTDTTLHVRCDSTAWATQLRLLSFSLLEKFRTELGEGVVTKIQVLGPAAPSWRKGGRTVNGRGPRDTYG 185
4 3.000e-47UniRef50_A0A1A0XSZ1 UPF0232 protein A5784_28515 n=33 Tax=Actinobacteria TaxID=201174 RepID=A0A1A0XSZ1_9MYCO  ali  66  1MTDDDTPQDPFPPDHLAGLRGMDLVRRTLEEARGAARSQGKDVGRGRAAPRRVAGGARSRRSWSGPGPDRRDPQPLGVASQDLAKSRGWSTRVSEGAVFGRWRAVVGDQIADHANPTGLNDGVLTVSAESTAWATQLRLVQAQLLAKIAAAVGDGVVKSLKIVGPVGPSWRKGPRSVPGRGPRDTYG 190
5 3.000e-47UniRef50_A0A060JE42 Zn-ribbon-containing, possibly RNA-binding protein n=2 Tax=Rhodoluna TaxID=529883 RepID=A0A060JE42_9MICO  ali  40  1MNNSNSPSDENKGQESPQ----DFAQEFYWKMREA--------ITGRLSRDAKRIAEKEQKANSRPFEKGRDFVKGGDAIDGLMKAFRWESQLAEADLFNKWAEIVGDTNAASSQPETLTSGTLTIRCKSTAWATQLRLMQAQILEKINAAYPEVDIKALKMLGPDAPSWKKGPRSVPGRGPRDTYG 175
6 4.000e-47UniRef50_H8IHJ8 UPF0232 protein OCU_00040 n=54 Tax=Actinobacteria TaxID=201174 RepID=H8IHJ8_MYCIA  ali  77  1MTGTGAGPGPDPGGPSGELSGIDLVRRTLEEARAAARAQGKDAGRGRAVSSSPRRVAGQRRSWSGPGPDGRDPQPLGRLARDLAKKRGWSAQVAEGTVLGNWTSVVGHQIADHAVPTALKDGVLSVSAESTAWATQLRMIQAQLLAKIAAAVGNGVVTSLKITGPAAPSWRKGPRHIAGRGPRDTYG 187
7 5.000e-47UniRef50_A0A2G5P5H0 UPF0232 protein CQY22_016225 n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A2G5P5H0_9MYCO  ali  62  2.....TDPQPPETDPSAEPAGMDLVRRALEEARGAARTQGKEVGRGRSSPAEPRKAASRRRRWSGPGPDGRDPQTLGSVANNVARSRGWTPRVAEGSVFGQWATVVGEQIAEHASPVALRDGVLHISAESTAWATQLRMVQSQILAKIATAVGDGVVTSVRITGPTAPSWRKGPRSMPGRGPRDTYG 186
8 1.000e-46UniRef50_A0A1B7U9I4 UPF0232 protein A5782_03390 n=20 Tax=Actinobacteria TaxID=201174 RepID=A0A1B7U9I4_9MYCO  ali  76  1MTGTDEGP--QPGARTNALSGIDLVRRTLEEARAAARAQGKDAGRGRAVAPAPRRVAGQRRRWSGPGPDARDPQPLGSLARDLAKKRGWSAQVAEGTVLGNWVAVVGHQIADHAVPTALNEGVLSVAAESTAWATQLRMIQSQLLAKIAAAVGNGVVTSLKITGPTAPSWRKGPRHIAGRGPRDTYG 185
9 3.000e-46UniRef50_A0A1E3R7W3 UPF0232 protein BHQ18_27845 n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A1E3R7W3_MYCFV  ali  62  9.SGVSERDEMGPPPHLAHLAGMDLVRRTLEEARGAARSQGKDVGRGNQRAPRRIAGSSRRR-WSGPGPDGRDPQPLGTAATELARTRGWSGRVAEGAVFGRWASVVGDGIADHATPTSLHDGVLTISAESTAWATQLRMVQAQVLAKIADAVGDGVVKSLRIVGPVAPSWRKGRYHVSGRGPRDTYG 193
10 1.000e-45UniRef50_A0A2S0KBX9 UPF0232 protein C6V83_01520 n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A2S0KBX9_9ACTN  ali  62  3.............DDAGHSPGYDVARRALEEARAQAQAAGKQVGRGRSGPSPRRTGDRRRRTWSGAGPDGRDPQPFGRLVGSLARTRGWSPKISEGAVFGSWPAIVGPEIAAHAEPSALNDGVLHVRAESTAWATQLRYMQPQILAKIAAAVGDGVVKSLRITGPSAPSWRKGPLHVSGRGPRDTYG 178
11 3.000e-45UniRef50_A0A1G8NWC1 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=4 Tax=Actinobacteria TaxID=2  ali  42  38...........DELQASGLTGGDLARAALESARRSASALPPPMSRDARRRSANRQANRRRGGYSGSGPDERDPQAVGGILSSLFATRGWEQPLAEARVFADWEGLVGAEIAARCQPVLLRDGELKISAESTAWATQLRMMSSSILKRLVGELGPTVVTKLMITGPVAPSWKHGAWSVRGRGPRDTYG 214
12 4.000e-45UniRef50_A0A1B0ZF47 Uncharacterized protein n=2 Tax=Dermabacter vaginalis TaxID=1630135 RepID=A0A1B0ZF47_9MICO  ali  36  61MTDE-LAPDTDAKPRDFSRPD-ELGRRALNQARAAAKKHGYRPRASRKPKGDPRGERAQGAGYSGARPDPRDPQRLNTVLEKMLVNLGWDRGLSAGRVLAEWDDIVGPAIAQHSHIESFEEGMLVVSTDSSAWAAQLRMLGPQIVTRIHERVGAQVVSEIKVVGPSTQSWKKGRRTVHWRGPRDTYG 247
13 4.000e-45UniRef50_Q9L7L4 UPF0232 protein MAP_0004 n=304 Tax=Actinobacteria TaxID=201174 RepID=Y004_MYCPA  ali  76  1......MSDDQSPSPSGEPTAMDLVRRTLEEARAAARAQGKDAGRGRAAAPTPRRVAGQRRSWSGPGPDARDPQPLGRLARDLARKRGWSAQVAEGTVLGNWTAVVGHQIADHAVPTGLRDGVLSVSAESTAWATQLRMMQAQLLAKIAAAVGNGVVTSLKITGPAAPSWRKGPRHIAGRGPRDTYG 181
14 5.000e-45UniRef50_A0A126ZU83 RNA-binding protein n=12 Tax=Micrococcaceae TaxID=1268 RepID=A0A126ZU83_9MICC  ali  38  4........DKDAGVPDAVPDGIDAARAALNRVRRAAEARGEVRVRATGPVADPNAPRPRTRQRPAAGYSGRDPQGLGSVVSRMVAERGWNSPVSVGSVMSRWAELVGPEISAHCTPESFEGTELRVRCDSTAWATQLRLLAPSLMDRFRRELGDGIVTRIHVLGPSAPSWRKGPRHVRGRGPRDTYG 183
15 5.000e-45UniRef50_A0A173LH03 UPF0232 protein n=1 Tax=Dietzia timorensis TaxID=499555 RepID=A0A173LH03_9ACTN  ali  47  3...........DSDKPQRSAGHSMAMRALEEARENAKAKGQFTGRGRRDPVRSTVRRRKG-GWTAAGADHWDPQSLGSLISKVAKKQGWDDQVVFGRMQTRWPEIIGEGNAAHVVPEKLDDGVLYCRASSTAWATQMRLYQKQTLQNIAKAFGPNIVRRLRINGPAAPSWRKGPLHVKGRGPRDTYG 177
16 7.000e-45UniRef50_A0A1X1UMF1 UPF0232 protein AWC06_21200 n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A1X1UMF1_9MYCO  ali  72  2................NPDDAMDLVRRTLEEARGAARTQGKDVGRGRRIPSTRRAGASSRRRWSGPGPDSRDPQPLGRVARDVAKKQGWSSRVAEGTVFGQWPSVVGQQIAEHARPTTLRDGVLSVSAESTAWATQLRIMQTQLIAKIAAEVGDGVVTSLKITGPVAPSWRKGPLHIAGRGPRDTYG 173
17 7.000e-45UniRef50_S3Y4M4 Uncharacterized protein n=11 Tax=Dermabacteraceae TaxID=85020 RepID=S3Y4M4_9MICO  ali  36  79...EELAPDPDARPRDFARPE-ELGRRALNQARAAAKKHGYRPRASRLTRPKGDPRRSQGAGYSGARPDPRDPQRLNTVLEKMLVNLGWDRGLSAGRVLAEWDDIVGPAIAQHCHIESFEEGVLVVSTDSSAWAAQLRMLGPQIITRIHERVGAQVVSEIKVAGPSTQSWKKGRRTVTWRGPRDTYG 263
18 1.000e-44UniRef50_A0A1Q2CHX6 Uncharacterized protein n=4 Tax=Tessaracoccus TaxID=72763 RepID=A0A1Q2CHX6_9ACTN  ali  36  2............SDEPHDPTGLDLASEIARAAVESA-AYGVVLPDPAPQRQPRRPRRPMEQQRSGAHPDDRDPQLVGDVLDSVIKQRGWQRRISLSTLLRRWPELVGEANAEHSTPVDYTDGVLIVDCDSTAWASAMRYSASQLVARLNRSLGDRTVLRVDFRGPKPPSWKRGPRSVGGRGPRDTYG 175
19 1.000e-44UniRef50_M7MUE7 Uncharacterized protein n=11 Tax=Micrococcaceae TaxID=1268 RepID=M7MUE7_9MICC  ali  38  6..............DPHAPEALDASRAILNRMRESAISRGEARIDAARAARAARKAKRRSSAAPAKYSDGRDPQEIGNLFGKIVRDRGWSAPVAVGSVLSRWSELVGPQIAAHCVPESFEDSTVVVRCDSTTWATQMRLLSHELLKHFDKVLGPGVITVLRVLGPAAPTWKHGGRSVKGRGPRDTYG 183
20 2.000e-44UniRef50_A0A2A3XL98 DUF721 domain-containing protein n=6 Tax=Micrococcales TaxID=85006 RepID=A0A2A3XL98_9MICC  ali  35  1MSPAEETPGGG-------PSEFDAARTMLNRMRQNAVARGEARARRAGERSAQARELRCRSPIGVSYENGRDPQGIGTVFGRMVRDRGWTSPVAVGSVMSRWAELVGPQINAHCSPESFEDTTVVVRCDSTAWATQVRLLSHSLLKTFDEKLGSGVVTVIQVLGPSAPSWKKGMRRVEGRGPRDTYG 185
21 2.000e-44UniRef50_A0A2A3Y5C9 RNA-binding protein n=23 Tax=Micrococcaceae TaxID=1268 RepID=A0A2A3Y5C9_9MICC  ali  41  2.................SEEELDSAKALLNRMRKLAEERGETRVDAARMERVKKRQATRRGFAAPQGKPARDPHAIGEIVSRMSKSRGWNTQVAVGSVLGRWTELVGEDVAAHCKPESFEDTVVVVRCDSTSWATQLRLLSHQILKKIDAELGSGIVTVIKVLGPNAPSWRHGLRSVAGRGPRDTYG 175
22 4.000e-44UniRef50_G7CIP7 UPF0232 protein KEK_10793 n=41 Tax=Actinobacteria TaxID=201174 RepID=G7CIP7_MYCT3  ali  63  20.SGEPDFDSAGPPAHLAGLRGMDLVRRTLEEARGAARRQGKEVGRGSPARPARRSGAGRRRTWSGPGPDSRDPQPLAAAARDLARTRGWTGRVAEASVFGCWPEVVGEQIAAHAAPTSLRDGVLTISAESTAWATQLRMVQSQVLAKIAAAVGDGVVTSLKIVGPVAPSWRKGRYHIPGRGPRDTYG 207
23 4.000e-44UniRef50_H6N292 UPF0232 protein GPOL_c00050 n=131 Tax=Actinobacteria TaxID=201174 RepID=H6N292_GORPV  ali  55  1MTDQPDTPATGSAATGDGLTGYERARRALEEARASARAAGKSVGQGRASPPRRRSRQGGRRRWSGSGPDARDPQPFGRLVGGLARERGWQPRIAEGTLFGMWEQIVGSDISAHATPTSLRDNVLYVQAESTAWATQLRYVQAQILAKIAAAIGDGMVTSLKITGPKGPSWRKGERHVRGRGPRDTYG 191
24 5.000e-44UniRef50_A0A1I5EUK6 UPF0232 protein SAMN05216207_10338 n=25 Tax=Actinobacteria TaxID=201174 RepID=A0A1I5EUK6_9PSEU  ali  47  62............AGERAGLRGADLARDALKAAREASARKAEERAEQARPKLRVVSGKGKRRRWSGSGPDDRDPQPFGRVVSRVSMDRGWSSRLTDATVLGRWPQLVGSDVADHCTPVSLRDGELTLQAESTAWATQLRTLQRQLLTRLSAAVGPDVVRRIRVVGPSGPSWRHGPRHVRGRGPRDTYG 236
25 7.000e-44UniRef50_A9WR33 Uncharacterized protein n=7 Tax=Micrococcaceae TaxID=1268 RepID=A9WR33_RENSM  ali  40  5MTESENGHESE-TWADAKDQGIDAAQSALNRMREAAKSRGDRRVRSAAALSKSQRAKARPGGKSSENDVGRDPQGLGGIVSRMVAERGWSSPVAVGSVMAQWNTLVGAEISAHCQPESFTGTVLHVRCDSTSWATQLRLLSASLLARFDADLGSGVVTKIQVLGPTAPNWRKGGRTVNGRGPRDTYG 192
26 8.000e-44UniRef50_I0GWT8 Uncharacterized protein n=43 Tax=Micromonosporaceae TaxID=28056 RepID=I0GWT8_ACTM4  ali  46  90..GQPGTVRDGEGQPGTVPDGEALAGPELARAVLDAALARRREAASKPRKRRTGGGERRLRGYSGPGPDPRDPQLFGDMLERLMKARGWEKPKAEATVFGSWEKVVGPDIASHSRPVKLENGVLTVEAESTAWATQLRMLAARLLRQIAGEVGNNVVTKLNIHGPAAPSWSRGPRRVQGRGPRDTYG 274
27 1.000e-43UniRef50_UPI0002FF0032 DUF721 domain-containing protein n=1 Tax=Timonella senegalensis TaxID=1465825 RepID=UPI0002FF0032  ali  34  1MSGEDDVTGVPVAEAFELETAKEYARAALNRAKANARARGFYPGKQAPSRF-------TEPQVSGARAGGRDPKPLSATLGALLVQRGWNQDVAVGGVIGRWPEIVGKDISQHCTAESFENSILVVRAHSTAWATQLKFLSPEIMRTISAEVGDGVVQEIRVLGPDSPKFTRGKYSVKGRGARDTWG 183
28 2.000e-43UniRef50_UPI000363CD39 DUF721 domain-containing protein n=1 Tax=Corynebacterium ulceribovis TaxID=487732 RepID=UPI000363CD39  ali  37  1MSDADQPTEHSPGQNTEQDVEQDMVADTFNRMRKAAARGGRKPRRPRPQPVMKQNNETYLRLTGNPTKRPRRTHRFGDILKQEIENRGWNRVIVEGWIVSNWDKVVGTQVAKHSRVFQFKDTSVFVKCDSTAWATQLRYMTRNMLDVIAAEVGEGVVTEIKIFGPDAPSWRKGPLHVKGRGPRDTYG 201
29 2.000e-43UniRef50_A0A1G9BF63 Uncharacterized protein n=1 Tax=Cryobacterium psychrotolerans TaxID=386301 RepID=A0A1G9BF63_9MICO  ali  38  6..............................EAGRVYLRFKDVFGDPNAKRSRGKRRTRDETGSSVPFGAGRDPRGLGDAISSLTRQLGWNSPLAQSELLASWVELAGEETAKHSTPAGIEDGVLTVSCESTAWATQLRMMRVEIMNHIAVKYPDAGIESIRFQGPNAPSWKKGPRSIPGRGPRDTYG 162
30 2.000e-43UniRef50_M2WVU8 UPF0232 protein G419_23749 n=79 Tax=Actinobacteria TaxID=201174 RepID=M2WVU8_9NOCA  ali  60  3.......GESENAGGEPELRGVDIARRALEEARAAAKASGKAVGQGRSSPKPRARLTGR-RGWSGSGPDARDPQPLGALTNAVAKSRGWSAHVTEGTVFGRWAQVVGEDIATHAEPVALRDGVLAVSAESTAWATQLRLMQGQILAKIAAAVGDGVVTSLRITGPTAPSWRKGERHVRGRGPRDTYG 181
31 2.000e-43UniRef50_A0A1Q8M074 UPF0232 protein Ae717Ps2_5348 n=39 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q8M074_9PSEU  ali  46  56.AGVPGEQGDLLSGDRANLRGADLAREALRAAREASARKAEERAQADRPKLRVVSGRGRRRRWSGAGPDDRDPQPFGRLVSRVSVDRGWSNRLTDATVLGRWPQLVGPDVADHCTPVSLRDGELTLQAESTAWATQLRTLQRQLLTRLAAAVGPDVVRRIRVVGPSGPSWRHGPRHVRGRGPRDTYG 241
32 3.000e-43UniRef50_A0A239QTX4 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=1 Tax=Ruaniaceae bacterium K  ali  39  2..................SEDPTAAFQALERARAMAKNPG--VGRRTKRLPRAEAGPGLGDPGSGARPSTRDPQTFSDLAAHLVGDRGWEHHLKDADVVTRWPDVVGESIAAHTVIESFKDGELIIRASSTAWATQVNLLRPQLQQKLAAELGDDRVSKIVVLGPAGPSWKHGIRSVKGRGPRDTYG 168
33 5.000e-43UniRef50_A0A1H2HIN2 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=4 Tax=Jiangellaceae TaxID=12  ali  36  16LPAPATDPVGPADGFTWNPDGDDLAKALLARAKVAGRTGRPAPSRTAGRGGTWRRRRAPGAGWSGPGSDDRDPQAVGSAVDRLIGEHGWAEDLAVHGAVARWDQVVGPEVAAHVQPEHYEDGVLTVRADTTAWATQVRLFAAELVRRFNKEIGDGSVTRVDVRGPQAPSWRRGPRSVPGRGPRDTYG 206
34 5.000e-43UniRef50_A0A1G8IV06 Uncharacterized protein n=4 Tax=Arthrobacter TaxID=1663 RepID=A0A1G8IV06_9MICC  ali  37  16..PETNGGDGVIPPDAEKSVEQDAPGLLLNRLRNASAARGDLRAPAARRRRSGSGSGYSPVQASYSG---RDPQGVGAVFGRLLSERGWNSPVAVGSVMARWAELVGPEIAAHCTPESFNETTVFVRCDSTAWATQLRLISPDLLRRFEHELGSGVVTAMKIVGPSAPSWRKGGRTVRGRGPRDTYG 197
35 9.000e-43UniRef50_F4D248 UPF0232 protein Psed_0004 n=61 Tax=Actinobacteria TaxID=201174 RepID=F4D248_PSEUX  ali  49  13..DDGDGAARRDAGAEDGLRGPDLAREALRAAREAAQRAAERAGKDDPRRRRGAGRRGSRRRWSGPGPDERDPQPFGRLVARVSMDRGWSPRLTDATVLGRWPQLVGPDIADHCTPVSLRDGELTLQAESTAWATQLRTLQRQLLARLAVAVGNDVVRRIRVVGPSGPSWRHGPRHVRGRGPRDTYG 198
36 2.000e-42UniRef50_UPI000D725886 DUF721 domain-containing protein n=4 Tax=Micrococcaceae TaxID=1268 RepID=UPI000D725886  ali  39  2......TADEFDAVSGVDHDRIDAAFAALQRVRRTVSQAGYTPGDPDPNVHRSRRGSSRRGTRRAPSVRRRKVKSLDELFGGLVADRGWKEPVAVGSVLGRWEDLVGPQVAEHCQIESFEHAVLVVRCSTTSWATQLRLMSAQILQRINTALGREVVREITINGPAAPSWRKGPRVVRGRGPRDTYG 196
37 2.000e-42UniRef50_A0A1U4TFJ8 Putative RNA-binding protein containing Zn ribbon n=1 Tax=Mycobacteroides abscessus subsp. bolletii TaxID=319705 RepID=A0A1U4TFJ8  ali  39  1MTPSENMHDKEYKIRAYTAEDVDAPHALLSRIRAAKEARGERRIQGRVRRFSVGVNRYQMGGYSGPGKSARDPQGLSGILDRVIMERGWSTPVAVSSVLTRWGTLVGAQLASKSKPESFDDGVVVVRCESTAWAVEMRRMKYDIMRRINEELGGEIVKDIQAHGPNAPSWKKGRRVAPGRGPRDTYG 208
38 2.000e-42UniRef50_A0A258HQH5 Uncharacterized protein n=5 Tax=Micrococcales TaxID=85006 RepID=A0A258HQH5_9MICO  ali  42  14..............................EASAVYRRLRRVFGDPSMRSSDARKRATRIPGDSAPFGLGRDPSGLGDVLDSVTRTLGWTSPLARGELLTAWPELVGADIAAHSEPAGIDDGVLTVQCDSTAWATQLRIMRAEILTTILRRYPDAQVTSIRFSGPGAPSWKRGPRSVPGRGPRDTYG 170
39 2.000e-42UniRef50_A0A2G4GQH5 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2G4GQH5_9ACTN  ali  37  1MSNDPEELDGEPSTSSPQSNGLDLARSLLAAAKA-------------KQNSAPLQTNGLRKQVRKHNRRGGDPTSLGEVIASLAAERGWEADISSSTLLAQWGEIAGADLAAHVKAESLRDGVLTLRAETTAWATQTRLLSTDLLKKVHTHSEGKSVTAIKVLAPTPPSWRRGERHVKGRGPRDTYG 174
40 3.000e-42UniRef50_Q82FD4 UPF0232 protein SAV_4320 n=69 Tax=Actinobacteria TaxID=201174 RepID=Y4320_STRAW  ali  39  3...DTPAQTPEPSKKTPEPSGVDLARVALRAAKEQARARGDAAQQKRQARRGGLR--------SGARADGRDPMALGAAINRLLTERGWETPAAVGGVMGRWPQIVGEDLAKHCVPQRYDERVLTVQCDSTAWATQLRLLAPQLVARLNEDLGHGTVRLLKVQGPGGPARRYGPLRAPGSGPGDTYG 181
41 3.000e-42UniRef50_A0A1W0BB47 UPF0232 protein B0T46_09100 n=34 Tax=Actinobacteria TaxID=201174 RepID=A0A1W0BB47_9NOCA  ali  61  1......MTEQPDPGTEPPLRGVDLARRALEEARAAARASGKSVGQGRSSPRRSLRRARRRSGWSGARPDDRDPQLLSTLAGSIARSRGWSTKVAEGMVFGRWAGVVGEDIAAHATPVKLEDGVLSIAAESTAWATQLRMLQKQILAKINAAVGNGVVTSLRISGPAAPSWRKGDRHIKGRGPRDTYG 183
42 3.000e-42UniRef50_E0N4E6 Uncharacterized protein n=11 Tax=Mobiluncus TaxID=2050 RepID=E0N4E6_9ACTO  ali  36  44...................................AKSLGSTPER---IEQLATPGPATANFTDGSRPSRNDPQRAGFLLGHLAQRLGWETPLEIADVKKHWDEYVGAQVAAHSTVESFEKGKLIVRTDSTAWATQLKFLLPELLKQLTKRLGAGVVQQIIIRGPQVPSWNHGPRSVPGRGPRDTYG 192
43 3.000e-42UniRef50_G8S344 Uncharacterized protein n=15 Tax=Actinobacteria TaxID=201174 RepID=G8S344_ACTS5  ali  50  2...........SPAAEAAKGGPELARAVLDAALAKRRENSRQPRR-----RTGGGGEKRLRGYSGPGPDPRDPQLFGTVLQRLMKTRGWERPTAEATVFGSWEKVVGADIAAHSRPIKLDGGVLTVEAESTAWATQLRMLSGRLLKQIAGEVGHNVVTRLNIHGPAAPSWSRGPRRVQGRGPRDTYG 172
44 4.000e-42UniRef50_A0A1R4G4X1 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives n=2 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1R4G4  ali  34  1......MPDLDDALEGPPASETTEVWQRFKEV-----FGGRTTSFHRRKRKKKSLEAPKEEQF--AFGPGREPVDTGDLLSNLFQQYGWEQPLAQARVIDSWTELAGERTAEHARPLYVEDGTLVVQCDSTAWATQLRTMRSNILGTIAERVPDAGIEDLRFLNPGAPSWKHGPRSISGRGPRDTYG 174
45 5.000e-42UniRef50_A4AEW5 Uncharacterized protein n=44 Tax=Actinobacteria TaxID=201174 RepID=A4AEW5_9ACTN  ali  37  7...........................AVDEHVAVYLRFREVFGDASKRSYMARKRNEKKPGTSVPFAPGRDPHGLGDVMESLTNQMGWSSPLARSELLLAWPTIVGAETAEHSDPVGIEEGILTIRCDSTAWATQLRLMRSRITTTIAQQYPEAGVESVRFEGPNAPSWKRGPRSIPGRGPRDTYG 166
46 6.000e-42UniRef50_UPI0009DDD8C5 DUF721 domain-containing protein n=1 Tax=Kocuria sp. ZOR0020 TaxID=1339234 RepID=UPI0009DDD8C5  ali  37  61.............................AAAKANLRQFGAAMDARTATPVRRGEEPRQLGGYSGSGTSRRDPQGVGSVMSKFVAGRGWRTPINVWSVMEKWPQIVGSYVAQNCTPVTFEDTVLTVRCSSTAQATNLRMMQSQILKKIESELGSGIVTRLEVHGPVAPSWKHGRRTVRGRGPRDTYG 221
47 8.000e-42UniRef50_A0A1H6ZWF8 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=31 Tax=Actinobacteria TaxID=  ali  37  27......APDEKQDSAEEPLVPVDAARMA-REALERARAAARQRGAMRTSPKRGRKQRAEARRSTEPYTNGRDPAPMSDAVASLLRRMGWTEQIEVSSVTGRWREVIGDRIADHCEPLGFDEGVLTVKATSTAWATQLQMMSGQIRHRINEEFGREIVTELKVLGPTARSWTKGPRTVKGRGPRDTYG 206
48 9.000e-42UniRef50_A0A2S4Z156 UPF0232 protein C3488_00680 n=2 Tax=Streptomyces TaxID=1883 RepID=A0A2S4Z156_9ACTN  ali  41  3.......TDEPTPKKTPEPSGVDLARVALRAAKEQARARGEAAQQKRQARSGGLR--------SGARGDRRDPMPLGAAINRLITERGWETPAAVGGVMGRWPQIVGEDLARHCVPQTYDERVLVVRCDSTAWATQLRLLAPQLVARLNEDLGHGTVRLIKVQGPGGPARRFGPLRAPGSGPGDTYG 177
49 1.000e-41UniRef50_A0A2T0YNA7 Uncharacterized protein DUF721 n=58 Tax=Actinobacteria TaxID=201174 RepID=A0A2T0YNA7_9MICC  ali  42  32.............................HRMRGVPRGSSLAGDPRSSAKDAQDRAKSS--GSSKPGADRRDPNLLGGVVGGLIKTRGWSSPVAVGSVIARWEQLVGTAIAQHCKPEKFENGVVEVLCDSTAWATNLKLMQPQLMDVFNTELGPGIVTGLSIRGPAAPSWKKGRYSVRGRGPRDTYG 187
50 1.000e-41UniRef50_F9NWS3 Uncharacterized protein n=24 Tax=Propionibacteriales TaxID=85009 RepID=F9NWS3_9ACTN  ali  35  6..DEGPTEEDRCLAADHDDEGVDVALAIARAARGEPAGTPRRPPPRRSTVRKRRRRSATPPAWSGPGDDGRDPMVLGDAFTHLVRSKGWGRQVNLHLVLSRWPELVGPTNAEHSRPVKYQGTVLTVRTEATVWATSLRTIAPQLVAELNRRLGERTVTRVVIEGPTAPSWKHGPRSVPGRGPRDTYG 198
51 2.000e-41UniRef50_A0A2G6JD32 Uncharacterized protein n=2 Tax=Propionibacteriaceae TaxID=31957 RepID=A0A2G6JD32_9ACTN  ali  33  27...SMSEPQLPDSDQSPAEAEFELAEQV---AQRIAGSQFSSPLAQPAPPRRRRRNPAAGEQRSGAHPDNRDPQLLGSVLKQVSQRQGWQRQISLSLVLRRWPELVGQANADHSKPVTYEDGVLVIKCDSTAWATGMRYSASQLVAKLNAELGEQTIKRVDVRGPDAPSWKKGRLSVRGRGPRDTYG 208
52 3.000e-41UniRef50_A1SCM0 Uncharacterized protein n=26 Tax=root TaxID=1 RepID=A1SCM0_NOCSJ  ali  35  15.....PAPAGGAEAPEHHDDGLDLAK---------ALTRATARSTPAARKRLRKKDTPRRGRASGAHPDDRDPQLLDATLSRLVDDHGWELDLRVHGVFGRWAELVGAEVARHTTPESFTDGRLVVRTDSTAWATQLRLLAPTVVRRLNEELGHGTVTVIEVLGPHGPTWKKGPRSVRGRGPRDTYG 188
53 3.000e-41UniRef50_A0A2C9A0Q7 Uncharacterized protein n=6 Tax=Microbacteriaceae TaxID=85023 RepID=A0A2C9A0Q7_9MICO  ali  39  31....................................RFRKVFGDASTRSATARKRKKNKKEGASVPFAEGRDPHGLADVIDGLTSKMGWTSPLARSALLTSWPAIVGVDTAEHSSPQGIEDGVLTISCDSTAWATQLRLMRSQITTTIAQRFPDAGIESVRFEGPNAPSWKRGLRSIPGRGPRDTYG 181
54 3.000e-41UniRef50_A0A2L2BN94 Uncharacterized protein n=2 Tax=Pontimonas salivibrio TaxID=1159327 RepID=A0A2L2BN94_9MICO  ali  38  12...................................................RRPTRHRVIPDEDQPFQPGRDPHSVSGAMDKLSKDMGWSSSMAEASIALHWPELVGENIAEHTEVVDINAGTLTVSCDSSAWATQLRMMRHELLVRFGEKVPEAQIEKIIVKAPGTPSWRKGPRSVPGRGPRDTYG 147
55 4.000e-41UniRef50_A0A2A9ECV9 Putative nucleic acid-binding Zn ribbon protein n=14 Tax=Actinobacteria TaxID=201174 RepID=A0A2A9ECV9_9MICO  ali  44  90..................PSPAQVAREALNRAKAAARERGLRPGMPRKRADFTVR--------SGPGRDGRDPQLFGSTMSALLRERGWEEEVSVGGAIGRWREVVGDEIADHCTPEHFEDHVLHVRASSTAWATQLKLLTPQLLTRLAAELGEGVVSEVRVQGPVGRSFSRGQRSVKGRGPRDTWG 250
56 4.000e-41UniRef50_S2VX09 Uncharacterized protein n=6 Tax=Actinomyces TaxID=1654 RepID=S2VX09_9ACTO  ali  38  50.................................RASSFRGKSWGIGRSGGGYEQETSKEGLATSGTGPSKYDPQPVDNVIGNLVNRLGWSSVLSIATIAARWPSIVGPSVAQHCRVETFEDNVLVVNTSSTAWANQMKFLLPTLEKQIAEAFGENAVKRVIIRGPQAPSWRKGRLHVPGRGPRDTYG 205
57 5.000e-41UniRef50_UPI0009704B74 DUF721 domain-containing protein n=1 Tax=Propionimicrobium sp. Marseille-P3275 TaxID=1871034 RepID=UPI0009704B74  ali  35  4........EETEKVDGYDPGGVELA---LSIAHEVAGILP-PPRGVKKIKKHWAPKSTDARQFTGSGADPRDPQPVGKVLSGFISAKGWRSELGVRNLIADWPRLVGDVIAEHSKPTGFKDKVLYVQAESTTWASALRMLASQVVARLNEELGQNSVERIEIRGPWAPSWSHGPRSVRGRGPRDTYG 179
58 6.000e-41UniRef50_UPI00082703E9 DUF721 domain-containing protein n=1 Tax=Pseudoclavibacter bifida TaxID=272239 RepID=UPI00082703E9  ali  42  42.................................................................PFGPHRDPVTSASAMSQLLQQYGWQTPLAQASVVNAWAELVGEQTARHTNPQFVDDGVLQVQCDSTAWATQLRSIRGTVLGTINQRFPDAEIRDIKFLNPGAPSWRHGIRSVPGRGPRDTYG 164
59 6.000e-41UniRef50_A4Q9S3 UPF0232 protein cgR_0005 n=28 Tax=Corynebacterium TaxID=1716 RepID=Y005_CORGB  ali  39  3......................DPIEQAFERIRAEAMRRDAFRRPPAPKGGVEKRKKGRASGLDGRQKRYRGAESLGSVLNKEIQRRGWGKDIAGGWVTSNWEELVGAKIAQHTRVEMIKDKKLFITCDSTAWATNLRMMQRQILQVIAEKVGPNIITELRIFGPQAPSWRKGPLHVKGRGPRDTYG 178
60 6.000e-41UniRef50_A0A2N3ULU0 UPF0232 protein AXZ45_3124 n=20 Tax=Actinobacteria TaxID=201174 RepID=A0A2N3ULU0_9ACTN  ali  40  1............MSDEPELSGVDLARVALRAAKEQARQRGEQVR--------EKREAKRHGLRSGARADGRDPVPLGAALNRLITERGWEAPAAVAGVMGRWPQIVGPDIAAHCAPEHFDDAVLTVRCDSTAWATQLRLLARQLVARLNHELGHGTVRVIRVLGPSVPQRRYGRLRAPGSGPRDTWG 170
61 7.000e-41UniRef50_UPI0009BAE79A DUF721 domain-containing protein n=1 Tax=Corynebacterium sp. Marseille-P2417 TaxID=1816684 RepID=UPI0009BAE79A  ali  40  3......................DPIDQAFERIREEARKRRQRPVRKAQGGVGKHVRGRPTGPDGRYRPRPREFESLGSVLNREIQTRGWGREIAGGWVSGNWEELVGPKIAQHTRVEMIKDKKLFITCDSTAWATNLRMMQKQILQVIAEKVGPNIISELRIFGPKAPSWRKGPLHVKGRGPRDTYG 175
62 9.000e-41UniRef50_K5BIA3 UPF0232 protein C731_0037 n=12 Tax=Actinobacteria TaxID=201174 RepID=K5BIA3_MYCHD  ali  69  1.....................MDLVRRTLEEARSAARRQGKDVGRGPPRSAARPASARGRRRWSGPGPDSRDPQLLGTVAAELARTRGWAERVSQGAVFGRWAEVVGDQIAAHARPTALHDGVLTISAESTAWATQLRMVQRQLLAKIAAAVGDDVVTSLKIVGPVAPSWKKGRYHIAGRGPRDTYG 172
63 2.000e-40UniRef50_A0A2A9ELJ3 Putative nucleic acid-binding Zn ribbon protein n=3 Tax=Micrococcales TaxID=85006 RepID=A0A2A9ELJ3_9MICO  ali  39  7.PAQTPDHLEPPAAEESETEDRDAARIALERAREAARAKGTDVADDAPAPGAWRPGPGLGYGISGPGPSRRDPAALGGIAARLFTQRGWSVPLSVGGVVGRWREVVGDQVADHCQVETFEEGALVLRTTSTAWATQVRLLLPQLERRLAEEVGEGTVTSITVLGPGGPSWKHGRRSVPGRGPRDTYG 211
64 2.000e-40UniRef50_A0A0M9YMF1 UPF0232 protein ADK54_07415 n=183 Tax=Actinobacteria TaxID=201174 RepID=A0A0M9YMF1_9ACTN  ali  37  3.....EESGPAEQPKVPEASGIDLARVALRAAKEQAKARGEAAQQRKQARRGGGLR-------SGARADGRDPMPLGSAINRLIRESGWETPTAVAGVLGRWPEIVGEELANHTTPHDAEEGILVVRCDSTSWATQLRLLAPQLVARINTDLGHGTVRLIKVYGPSGPPQRYGRLRAPGSGPGDTYG 180
65 2.000e-40UniRef50_A0A074PX49 Uncharacterized protein n=1 Tax=Georgenia sp. SUBG003 TaxID=1497974 RepID=A0A074PX49_9MICO  ali  41  1MSGQPDRTGPEEAEDRDA-----VARLALERAREAARGKGADQTDDAPAPGSWRPGPGLGYGISGPGPSRRDPQALGGIAARLFTQRGWSAPLSVGGVVGRWREVVGDQIAEHCQVETFEEGALVLRTTSTAWATQVRLLLPQLERRLAEEVGEGTVTSITVLGPGGPSWKRGRRSVPGRGPRDTYG 200
66 4.000e-40UniRef50_U7JAG6 Uncharacterized protein n=10 Tax=Propionibacteriaceae TaxID=31957 RepID=U7JAG6_9ACTN  ali  40  1MTDGVDPRDPVVPSDEDRRLAADHVDVALAIARASRGEPAGTPRRPRRSMVRRRRRPPSTPTWSGPGKDARDPMALGDAFTNLVKSKGWGRQVNLHLVLSRWPELVGPTNAEHSRPVKYQGTVLTVRTEATVWATSLRTIAPQLVAELNRRLGEGTVTRVIIEGPTAPSWKHGSRSVPGRGPRDTYG 201
67 4.000e-40UniRef50_A5CLT7 Uncharacterized protein n=130 Tax=Bacteria TaxID=2 RepID=A5CLT7_CLAM3  ali  35  1............MIPRAPDGGPMPESEAVAVYRRFRKVFGDASVRSPSA-----RKRREQKAGSSPFQPGRDPDSLGNVMDSLTSRMGWTSSLSQAELMAAWTTIAGEETAVHSSPVGIEDGLLMVECESTAWATQLRLMRVEITTRIAERFPDAGIRSIRFQGPNAPSWKKGPRSIPGRGPRDTYG 170
68 5.000e-40UniRef50_I0R1P4 Uncharacterized protein n=5 Tax=Microbacteriaceae TaxID=85023 RepID=I0R1P4_9MICO  ali  35  17................................................KSKDQKRREKNQTRGTQPFDPGRDLVTASQSLEHLFGEFNWTADLEKASLFADWDQVVGPESANASFPEELKGTQLIVRCKSTAWATQMRLLETQVLQKLAEVHPKLVVDEIMFIGPNAPSWKKGPRSVPGRGPRDTYG 155
69 5.000e-40UniRef50_A0A1P8NKM9 Uncharacterized protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1P8NKM9_9MICO  ali  42  2...............PSPSDPFELARRTVNRSRAAARDRGLFPISAKTQARDVRDRSGKAPGYSGSRPAPRDPQGIDLVLRKVLGNLGWNAGMNAGRVLEEWDEIVGEKVGSHCRPVSLEDGVLVVSASSSAWAAQLRMLTGQLVTTIEEHVGSHVVSELKVTGPAARSWKKGRRTVTWRGPRDTYG 175
70 6.000e-40UniRef50_UPI0003FBF4A4 DUF721 domain-containing protein n=1 Tax=Frankia sp. Iso899 TaxID=1283283 RepID=UPI0003FBF4A4  ali  44  1.......................MAAGALESARAISSGIGGPNDTSRAGRMARRRRLLRGPSYSGARPDERDPSPIGAIVGKAMPELGWVGPLAEARLMGQWASVVGPEIAARCHPVSLVDGQLKVSAESTAWATQLRLMAPQILAKITADLPRGLVKRIVISGPSGPSWKHGPWSSRGRGPRDTYG 170
71 1.000e-39UniRef50_A0A2N3GGZ3 DUF721 domain-containing protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2N3GGZ3_9ACTN  ali  38  3.........GVSDTADHDPQGTDLAKQIARAARGAA---------------------PKPRRTSKPAARTDGPTPIGELLGQVADSQGWTKELSIHQLLSRWPSLVGAVNAAHCEPEHYADGVLTVRAESTTWASSLRAMAPQLVAALNDALGQGSVTRVTVVGPQAPSWKKGARSVPGRGPRDTYG 159
72 1.000e-39UniRef50_C7NID4 Predicted RNA-binding protein containing Zn ribbon n=4 Tax=Micrococcales TaxID=85006 RepID=C7NID4_KYTSD  ali  35  1MSAAAPGPGDRPGAGNPSEEELDAADLSLARMRDMARSRGLRPG-----APGRRSRKRPGGPAGTSGKGRRDPQTLGAEFSRMIDDRGWGDELKVGRVMGDWVGIVGPDVAAHSLPESFEEGVLLVRAESSTWATQLTMLTATLQKRLDDELGFGVVTSVRVVGPAAPSWKHGRRRVQGQGPRDTYG 196
73 1.000e-39UniRef50_A0A291GKT6 RNA-binding protein n=2 Tax=Brachybacterium TaxID=43668 RepID=A0A291GKT6_9MICO  ali  38  83.SPVPGEVLFDPPELPSLADPFELARRTVNRSRAAARDRGLFPISAKTQARDVRDRSGRAPGYSGSRPDPRDPQGIENVLKKVLGNLGWNAGMSAGRVLEEWDDIVGERLATHCRPVSFDEGVLVVSASSSAWAAQLRMLTPQLITTIEERVGSHVISELTVTGPAARSWKKGRRTVTWRGPRDTYG 270
74 2.000e-39UniRef50_E5XV98 Uncharacterized protein n=6 Tax=Actinobacteria TaxID=201174 RepID=E5XV98_9ACTN  ali  53  2...........AGEDETRSPAEDLAR----------RLIGEFGTRAPRAPKPDQR--PERTRWSGPGPDARDPKTFSEVFEQLRKKDTWSQKLAEGKIFSEWGSIMGEQNAAKSTPQQLVDGVLHVQTESTAWATQLRLMQKQILEKIAGEVGKGVVFSLKITGPKAPSWRKGERHVRGRGPRDTYG 165
75 2.000e-39UniRef50_A0A0E9GDA9 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives n=3 Tax=Bacteria TaxID=2 RepID=A0A0E9GDA9_CHLTH  ali  38  10..........................................................................RIDSILSSFVKDNGWSNQTQIASVSNRWPEIVGPNIAEHTHIESFEGKKIVVRCTSTAWAKQLQLLLPRILRRISEVVGSGVVEQVVVLGPVAPSWKKGPLSVRGRGPRDTYG 122
76 4.000e-39UniRef50_U2RX67 Uncharacterized protein n=5 Tax=Microbacteriaceae TaxID=85023 RepID=U2RX67_LEIAQ  ali  43  24...............................................SPSRRRTRVRPDEVGGSKPFTAGRDPRGLGDVVDALASQLGWTSALAQSDLLEGWRELAGEETAKHAIPDAITDGVLVVRCESTAWATQLRMMRSELLVRIGERFPEADIQSIRFQGPDAPTWKRGPRSIPGRGPRDTYG 163
77 4.000e-39UniRef50_A0A126YZ38 Uncharacterized protein n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A126YZ38_9MICO  ali  33  15.............................NEAQRVYLRFRRVFGDASTRGRDARRRIARSGAPSQPFGSGRDPKGIADVILGVTTELGWNSSLAQSDLMTAWPAMVGDELSQHSIPVGVEDGTLTVQCDSTAWATQLRLMRSQVTTAIISTYPEAGIESMRFLGPNAPTWKRGPRSVPGRGPRDTYG 172
78 4.000e-39UniRef50_A0A0Q8NYJ4 UPF0232 protein ASE03_32855 n=22 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q8NYJ4_9ACTN  ali  40  1............MGETPELSGVDLARVALRAAKEQARQRGEQVR--------EKREAKRHGLRSGARADGRDPVPLGAALTRLITERGWEAPAAVGGVMGRWPQIVGPDIAAHCVPKEYAEAVLTVQCDSTAWATQLRLLARQLVARLNHELGHGTVKVIKVLGPAAPQRGYGRLRAPGKGPGDTWG 170
79 5.000e-39UniRef50_UPI000B805CE5 DUF721 domain-containing protein n=1 Tax=Arthrobacter koreensis TaxID=199136 RepID=UPI000B805CE5  ali  40  1...............................MRQAAQARGNQRVPAARRKTARKSAPFIPGEYT-----GRDPQGLGKVFSRFVNERGWNSPVAVGSVISRWEELVGPDVSAHCKPESFSDTTVQVRCDSTAWATQLRLLRSALIERFDAELGSGVVTRIEVIGPAAPNWRKGLRSVKGRGPRDTYG 151
80 5.000e-39UniRef50_W9GMB3 UPF0232 protein N864_22890 n=49 Tax=Actinobacteria TaxID=201174 RepID=W9GMB3_9MICO  ali  38  1MSDVEEPGSEGGADEGAAVEDAAVEDXXXXXXXXXXXXXXEKGLRPGMKPRKRIRPLGHGVTMSGAGRDGRDPTLLGDQLDRLIADRGWKVDVAVGSVMGRWPDIVGADIAQHVEPVSFTDGVLTVRADSTAWATQMRLLTSHVLARVDEEIGAGAVTELKVLGPGGPSWRRGPRRSPSRGPRDTYG 188
81 6.000e-39UniRef50_A0A1T4YZ43 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=2 Tax=Aeromicrobium TaxID=20  ali  35  9............................LRLAREIADAYRNGNAPPARTRRPIRRNAPARRPGREDG------VALGDVLGEMVRNQGWNDRLAASRVFSDWASIVGPEVAQHCKVDHFTDGVVYLETSSTAWAKELKMLAPRLVAKLNEELGDGQVLRIDVRGPQAPSWKKGRRSVKGRGPRDTYG 161
82 6.000e-39UniRef50_A0A239V829 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives n=2 Tax=Dermatophilus congolensis TaxID=1863 RepID=A  ali  47  55..........................................AGLRPGMLPRKRRRKNSEPLTSSAGPDRRDPQLLGDELGRLVEARGWRKDVSAASVMGSWPAVAGLDIARHSVPVSFEEGILVVRAESTAWATQLTYMIPQLQARIDDAIGNGVVTNIRVTGPSAPSWKRGPRRSRGPGPRDTYG 199
83 7.000e-39UniRef50_A0A239IWF7 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=1 Tax=Micrococcales bacteriu  ali  35  4...........EPPDVTGPAADQFGRTILQRIKSAAADRGAKPR----------AKYSKPRTDATGNVITRDPMLLGDSLQTLVNTHGWRDQLSVAAVIGRWRSIVGDQIADHCEPLEFSDGTLVVRASSTAWASQLNLLTGQMLAAFAREVGEDVVADIKVLGPSTRSFKRGAKSVPGRGPRDTWG 169
84 7.000e-39UniRef50_A0A1Y1RQ30 Uncharacterized protein n=1 Tax=Rothia nasimurium TaxID=85336 RepID=A0A1Y1RQ30_9MICC  ali  37  12..................AEGVDAPHALLSRIRAAKEARGEHRVQGAAGRKSSENGVSQLGGYSEAGPSSRDPQSLAGLLNRVIMERGWTTPLAVSSVLARWDQIAGPSLACKAIPETFEGGVLTVRCESTAWAVQVRQMKYDIMRRFNSELGDEIVTDVRAFGPTAPSWKKGRRVAPGRGPRDTYG 201
85 7.000e-39UniRef50_A0A1Q5Q3D7 Uncharacterized protein n=2 Tax=Actinomyces nasicola TaxID=208480 RepID=A0A1Q5Q3D7_9ACTO  ali  37  10.......................AALQAFNRAQRLTRRRGRTGHNRQIHADDPLSGPGLGDPGSGARRSRRDPQPIANIAERFIRMRDWFAEVGAGAILGNWESIVGEQMAKHCTAEKFSDGVLTIRTSSTAWATQLKLLLPQIERRIEEEAGEGIVSEIKILGPVAPSWKKGPRVVKGRGPRDTY. 184
86 8.000e-39UniRef50_K0YW01 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=K0YW01_9ACTO  ali  27  40......GPTPGALVGANEDCAVDMSRGQADLSAESMAEAGDLSGIVQAQRHRPEVWV-KTPGMAAMHRSYHRSGRIDSILSSFVKDNSWSNQIQIASVSNRWPEIVGPNIAEHTHIESFEGKKIVVRCTSTAWAKQLQLLLPRILRRISEVVGSGVVEQVVVLGPVAPSWKKGPLSVRGRGPRDTYG 224
87 1.000e-38UniRef50_A0A2W6C5L5 DUF721 domain-containing protein n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A2W6C5L5_9ACTN  ali  35  21...SDDGPDPTSTNHPCRPRGPELARAAVEAAKQGSRKFRRADSSSRENGTRQRNTRSRLGGYTGTHADPRDPQLLGTEIKRLFNERGWQQAVTQARIFGAWDQLVGDDLAAKCTPVSLRDGELVIAAASTAWATQLRMLTARMLAGIRRELHSDLVRVIRVHGPLGPTWKHGLRSVPGRGPRDTYG 218
88 1.000e-38UniRef50_A0A0Q5B1P9 Uncharacterized protein n=28 Tax=Microbacteriaceae TaxID=85023 RepID=A0A0Q5B1P9_9MICO  ali  37  2.....................ADSARRGAPAASRVYRHLKEVFGGDGPRRVRRTVERAEPRGDAIPFGKGRDPHDLGDVLDGLTKKLGWTAPLAQGDLISSWTAIAGEETAKHSTPLGVVDGVLTVACESTAWSTQLRLMRIEIMNHIAVNYSDAGISAIRFQGPDVPNWKKGPRSIPGRGPRDTYG 171
89 1.000e-38UniRef50_D4YKU4 Uncharacterized protein n=18 Tax=Brevibacterium TaxID=1696 RepID=D4YKU4_9MICO  ali  38  14.......................AVLEALDRVRRM----GDGADLATGAKRSWRSFTRAEVVYSGPGKDPRDPQKLGISLATLTKKFGWETQLDVGELMGRWPQLVGANVAEHCVPVVCEPPKLVVRASSSTWATQMRVMSMMLLDRLEKELGRRIIDDIEILGPTQKSWKRGRRSVKGRGPRDTYG 173
90 1.000e-38UniRef50_F5XGB7 Uncharacterized protein n=11 Tax=Propionibacteriales TaxID=85009 RepID=F5XGB7_MICPN  ali  38  1......MQKGAPDQSPHDPTGLELARSIANSVGAQQRRRRKHPKHSA----------PVDQVRSGAAPDDRDPKLLSAALDRLVEAKGWSTDLSVRALLARWPVLVGPTNAAHSWPESYADTVLTVRAESTVWATSLRTMAPQLVAKLNEQLGDGTVTRVKVLGPQGPSWKKGPLSIRGRGPRDTYG 172
91 1.000e-38UniRef50_A0A255EFH0 Uncharacterized protein n=3 Tax=Propionibacteriaceae TaxID=31957 RepID=A0A255EFH0_9ACTN  ali  35  28....AQAKNGQSDPEPGPESGLELARQIA----AAAQLRGQTGPAAPQKPKKKRAQHRDYRRYSN----DRDPKPLGDAMDGLLRRKGWRTQINVQLLIGKWSSLVGEVNADHSEPVGYSDKVLTVRADSSTWAASLRMIAPQIVAQINRELGDGTVTRVDVRGPQAPSWQHGRRSVRGRGPRDTYG 202
92 2.000e-38UniRef50_U7JPP7 Uncharacterized protein n=8 Tax=Propionibacteriaceae TaxID=31957 RepID=U7JPP7_9ACTN  ali  38  77...............EHSDDGLDLAQSTARAARGDPAGAPRPRTGALPDPQVQLPAPRGIRTWSGPGPDRRDPVPLGDAIDKLIRSRGWSTQVSLRQVLDNWEKLVGPANAAHSTPVSYTKTVLTVRTDATVWATSMRMIAPNLVAELNRRLGQGTVTRVVIEGPSAPSWKHGPRSVPGRGPRDTYG 260
93 3.000e-38UniRef50_A0A2D6I428 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2D6I428_9MICO  ali  37  2.........TSDDAHTPDSEESDL--RAATRAFQRARSSGVSAAGTSSANSPGRTSKRRSQPSGTRAGKSGDPTLMSTALAEFLSHQGWEDDAARAGLFQQWREIVGEDVAEHVHVESWSDGQLVLRADSTAWATQVRLLTASLLERVRAALGPDVVESVQVKGPQAPSWRAGPRVVKGRGPRDTYG 177
94 3.000e-38UniRef50_A0A101JGW5 RNA-binding protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A101JGW5_9ACTN  ali  49  1.......................MARAVLDAALTKRREAARQPRK-----RIGATGEKRLRGYSGPGVDPRDPQLFGSMLERLMKARGWERPKAEATVFGSWEKVVGADIAAHSKPVKLDAGVLTVEAESTAWATQLRMLTGRLLKQIAGEIGHNVVIRLNIHGPAAPSWNRGPRRVQGRGPRDTYG 159
95 5.000e-38UniRef50_M1NNH7 Uncharacterized protein n=11 Tax=Corynebacteriaceae TaxID=1653 RepID=M1NNH7_9CORY  ali  39  2..............ADTPEGPVDPVSAAFENMRAAAKKRGGRPRRTPRKRPRGRRGPGIRSGADGRFPRRKDVESFGSLLGGEIAKRGWEHEIAGGWVHSHWDELVGEKIAQHTKVEMIKDKTLFITCDSTAWATNLRMMQRQILQIIAQRVGPDIIAELKIFGPRTPNWRKGRLHIKGRGPRDTYG 203
96 5.000e-38UniRef50_A0A1Z9AAB1 Uncharacterized protein n=1 Tax=Cellulomonadaceae bacterium TMED98 TaxID=1986624 RepID=A0A1Z9AAB1_9CELL  ali  38  7...............................ARESA-EPSAVYRRLRQVFGDKRPGSKKIRPEDEPFQPGRDPLQVAGAMDSLSTEMGWRAPMAEARVAMEWRELVGENIADHSQVVDVADGVLTVQCNSSAWATQLRLMKHDLLSRLADHVPEATIDNVVVKGPGGPSWRKGSRSVAGRGPRDTYG 161
97 6.000e-38UniRef50_U2YVB0 Zn-ribbon protein n=5 Tax=Microbacterium TaxID=33882 RepID=U2YVB0_9MICO  ali  35  16........................................RLRGLEPSGRWKKRRRQRTDDDENQPFTSGRDPKGLGDVIADLTRQAGWDAQLSREDLVLRWAEVAGEETARHASPVALSDGVLTVQCDSTAWAKNLHLMRTVITTQLVKAFPQSGVQSVRFVGPDVPSWKWGPRAVPGRGPRDTYG 162
98 8.000e-38UniRef50_J9DTN3 Putative RNA-binding protein containing Zn ribbon n=10 Tax=root TaxID=1 RepID=J9DTN3_9ACTN  ali  40  14..................................................RSGYRKLRAGGQANVERVKNTDPQSLESVLSEVIAGRNWGKGVAEGNLFSNWNEIVGDEIAQHTTPISLVDGRLTIQSSSSAWATQMRLMQDDLLKTISNSSPGALVESLNVIGPHAPSWKRGLRSIRGRGPRDTYG 151
99 8.000e-38UniRef50_A0A2W5IBH6 Uncharacterized protein n=1 Tax=Lawsonella clevelandensis TaxID=1528099 RepID=A0A2W5IBH6_9ACTN  ali  42  79......................................NGPRGEQHHRGAGKASTGRRRRYSWTSSGPDKWDPQLLTALVADTIQKHGWQHEVIGGRIIHNWPEIMGEEIASHSHVEKLDDGVLYIRTDTTAWATQLRLLQPNILAELGKKYGK-TVRMLRILGPAQPSWRKGPRHVKGRGPRDTYG 227
100 1.000e-37UniRef50_UPI000B3BB83A DUF721 domain-containing protein n=3 Tax=Brachybacterium TaxID=43668 RepID=UPI000B3BB83A  ali  43  98......................ELARRTVNRSRAAARDRGLFPISAKTQARDVRDRSGRSPGYSGSRPDPRDPQGIDGVLKKVLGNLGWNAGMNAGRVLEEWDDIVGERLATHCRPVSLEDGVLVVSASSSAWAAQLRMLSPQLITTIEEHVGSHVISELKVTGPAARTWKKGRRTVTWRGPRDTYG 264
101 1.000e-37UniRef50_A0A2W4JIW5 DUF721 domain-containing protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2W4JIW5_9ACTN  ali  39  16.............................................TSPERARAQKLRRREETSPEPYSSGRDPRAMSEAVESLLRRMGWTEQVEVASVTARWREVIGDQIADHCEPEAFEDGILTLRASSTAWATQLNLMSGQIRHRLNEEFGREIVRELTILGPVGRSWTKGPRSVRGRGPRDTYG 157
102 1.000e-37UniRef50_A0A1H8YID1 Uncharacterized protein n=2 Tax=Amycolatopsis TaxID=1813 RepID=A0A1H8YID1_9PSEU  ali  49  143....PTDQPAADGPPTGPTSGRDLAHAALEAAKAKAKERGAPPNLRRGRITGGGGQNPRRRRWSGSGADARDPQPLGRLVSRLISDSGWQDTMTNARVFGQWARLVGEDVAEHAEPVALKDGELTVRASSTAWATQLRLLQGKLLAKIAAGVGHGVVKRMRIQGPTAPSWRKGPRHVPGRGPRDTYG 325
103 1.000e-37UniRef50_U2S9Q0 PF05258 family protein n=19 Tax=Actinobacteria TaxID=201174 RepID=U2S9Q0_9ACTN  ali  36  1MTGAASGGGRPDPVEQHDPEGFDVASRVAHRLSGL-----LPPARLGPGRGGRRRRRVTGEQRSGPRPDARDPQPLGAAVDELIAARGWRRQIGLRLVVQRWDELVGPSNARHSTPESYHDGVLVVRAESSTWASALRAIAPQLVAELNRRLGDGAVTLVDVRGPSAPSWHHGPRSVPGRGPRDTYG 187
104 2.000e-37UniRef50_E8N933 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives n=80 Tax=Bacteria TaxID=2 RepID=E8N933_MICTS  ali  43  40................................................................APFSPGRDPRGLGDVLATLTQSAGWEPQLAREDLVRTWHDVAGADTAAHTRPVALDAGTLTVQADSTAWAKQLQLMRAQILSEILRRFPEAGVEAIRFVGPDVPSWKWGPRAVPGRGPRDTYG 162
105 2.000e-37UniRef50_A0A2N6UNF1 Uncharacterized protein n=1 Tax=Actinomyces hominis TaxID=595468 RepID=A0A2N6UNF1_9ACTO  ali  29  37..PKKEPTIEQKTEEGAEQKPENLAASALQKQRELARSKGQFPRSASALARSKSNSQSKQHGPSGTGRSRFDPQPLANVLGNMSSHLGWTRMLSVASIAAHWTRIVGPKNSQHLKVESFNESVLVVRATSTAWANQMRILLPTVQRRIDEELGSGIVKQVIIRGPANPKWKKGGWRVPGRGPRDTYG 245
106 3.000e-37UniRef50_G5EP14 Uncharacterized protein n=43 Tax=Actinobacteria TaxID=201174 RepID=G5EP14_9MICC  ali  34  25..AEPQNPREVDGVGEFYRDEVDAPSALLTRMRVAAQERGEAPASKKKSRRAQGWDPRIMGGYSGPGESSRDPKPLGGIVSALIRSRGWKEPVAVSSVLARWAELVGPEIAAHTRPISFENSIVEVQCDSTAWTTQLRLMHGHLIELFRRELGEGVVAQVRVLGPNNGRWQRGYRRATGRGVRDTYG 231
107 3.000e-37UniRef50_D7C8V6 UPF0232 protein SBI_05387 n=269 Tax=Actinobacteria TaxID=201174 RepID=D7C8V6_STRBB  ali  40  15...................SGVDLARVALRAAKE--------QARARGAAAQQKKQARRGGLRSGARADGRDPLPLGAAINRLITERGWETPAAVGGVMGRWPQMVGPEVAQHCEPQRYDERVLTVRCDSTAWATQLRLLAPQLVARLNADLGQGTVKLIKVLGPGGPARRYGSLRAPGSGPGDTYG 177
108 4.000e-37UniRef50_A0A0Q6VM82 Uncharacterized protein n=7 Tax=Nocardioidaceae TaxID=85015 RepID=A0A0Q6VM82_9ACTN  ali  35  2.........TDSDTPAPRDDGLDLARDIAKSYR-------------GKGSPVPPSGKRRVRPAKPARGARDEPSLLADLLGEVVNDQGWDERLAAQRVFTDWATIVGPEVAQHSEVIAFDDGEVEVRTDSTAWATQLRLLAPRIVAKLNELMGDGSVLRIVVRGPQAPSWKKGPRSIRGRGPRDTYG 167
109 4.000e-37UniRef50_A0A1E4D5Z2 Uncharacterized protein n=3 Tax=Microbacterium TaxID=33882 RepID=A0A1E4D5Z2_9MICO  ali  34  22............................................PPSARGARRRRKRLAEDDDKQPFMPGREPHGVGDVLADLTKQAGWDSQLAKEDLVLQWEEVTGAETARHAHPVALSDGLLTVQCDSTAWAKNLQLMRAEIVTQLMRRFPDAGVVNVRFIGPDVPSWKWGPRAVPGRGPRDTYG 164
110 4.000e-37UniRef50_E3B8Z1 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=E3B8Z1_9MICO  ali  43  26..........DSAEAPVESSAEDERAVAARLALARAQRNAAERGFRPGSRPAPRRSRSTQSFTPSSNRDGRDPQLIDSTMKRLLLERGWNVDVAAGAVMSRWADLVGAGVAEHARPLTFEDGVLTVRAESTAWATQLQLLTASLLASIADGVGEGVVNELRVVGPSAPSWVRGPRRVAGRGPRDTYG 202
111 6.000e-37UniRef50_Q6AHN2 Uncharacterized protein n=7 Tax=Microbacteriaceae TaxID=85023 RepID=Q6AHN2_LEIXX  ali  40  33.............................................................GAPKPFGAGRDPRGLGDVVDSLASQMGWTSALAKSDLMAGWVELAGEENAKHSYPEGITDGVLIVRCETTAWATQLGTLRIELLRKAAERFPDADIQTIHLRGPHAPSWNHGSRSIPGRGPRDTYG 158
112 6.000e-37UniRef50_A0A097ICP9 Uncharacterized protein n=3 Tax=Corynebacterium TaxID=1716 RepID=A0A097ICP9_9CORY  ali  43  2................DDKQRDDAVEAAFDKIREVARRRGGPLPNLSAQGTTAQPRRSARGPGRPSGPDGRRPRRLGSVVGREITRRGWQHELASGWVTGHWEYLVGEQIAEHTRVEMIKDGQLFITCTSTAWATNLKYMQHTILQKIAEKVGPDVITGLKIFGPKVPSWRKGPLHIKGRGPRDTYG 202
113 8.000e-37UniRef50_E2S8R2 Uncharacterized protein n=3 Tax=Aeromicrobium TaxID=2040 RepID=E2S8R2_9ACTN  ali  32  1......MSDGTPADGPADGPGDTPADDPLRLAREIADA-------YRGNATPDQQPRRPRRRARSRRPGREDATPLADVMSELVQQQGWTDQLAAQRVFTDWAGIVGPEVARHCVVEGYADQVVHIAADSSAWRKELQLLAPTIVARLNAELGDGSVLRIEVRGPQAPSWKSGPRSIRGRGPRDTYG 175
114 8.000e-37UniRef50_A0A094P012 Uncharacterized protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A094P012_9ACTN  ali  35  13.........................................QRFRQQFGGYAPRPITETTVEGSEAFGLGRDPGSFAEAMESLTSSMGWGAEIARAELMAQWPDIVGSDVAGHAIPVGVSDGVMEIQCDSSAWATQLRLMRSTLLDSLTQKFPHAGVVELSIKAPGAPSWKHGRRSVPGRGPRDTYG 158
115 1.000e-36UniRef50_C7MEL0 Predicted RNA-binding protein containing Zn ribbon n=9 Tax=Actinobacteria TaxID=201174 RepID=C7MEL0_BRAFD  ali  44  100......................ELARRTVNRSRAAARDRGLFPISAKTQARDVRDRSGRAPGYSGSRPDPRDPQGIQNVLRRVLGDLGWNAGMSAGRVLEEWDEIVGERIATHCRPVSFEDGVLVVSASSSAWASQLRMLTPQVITTIEEHVGSHVISELKVTGPAARSWKKGRRTVTWRGPRDTYG 266
116 1.000e-36UniRef50_E2MYG5 Uncharacterized protein n=16 Tax=Terrabacteria group TaxID=1783272 RepID=E2MYG5_CORAY  ali  39  70....................................KQRAAQAVVRDRAGTVISPSLLKEAGIRLYRKYDRRPAPIGAVLNKAVVDRGWQIHIAHGVIMTEWDSMVGKVVAEHSQVKEFKDGTLVVECQSTAWATQLRLAQRQVLKSIAERVGDGVVEEIKVLGPKAPNWRKGKLHIEGRGPRDTYG 220
117 1.000e-36UniRef50_A0A285KT94 Uncharacterized protein n=1 Tax=Actinoplanes atraurantiacus TaxID=1036182 RepID=A0A285KT94_9ACTN  ali  48  111.AGSTQGSEPSAAQEGAEGSGPDLARAVLDAALA---RRRENAARKPRRGTTGAKGEKRLRGYSGPGPDPRDPALFGDVLQRLMKARGWERPKAEATVFGAWEKVVGPEIASHSRPVKLDAGVLTVEAESTAWATQLRLLAATLLRNIAGEVGHNVVTKLNIHGPAAPSWSKGPRRVQGRGPRDTYG 294
118 1.000e-36UniRef50_Q8FUL3 UPF0232 protein CE0005 n=60 Tax=Bacteria TaxID=2 RepID=Y005_COREF  ali  43  29............................LNNRDAFRRTTPRPIGDRANGGNGGGGGVDKRRRGRPTGPDGRSAEPLGAILNREIRSRGWSRDIAAGWVTSHWAELVGPKIAQHTKVEMIKDKKLFITCDSTAWATNLRMMQKQILQVIAEKVGPDVIAELRIFGPQAPSWRKGPLHVKGRGPRDTYG 193
119 1.000e-36UniRef50_A0A1D7VY85 DUF721 domain-containing protein n=16 Tax=Actinobacteria TaxID=201174 RepID=A0A1D7VY85_BRELN  ali  37  20....................................RVRRMEATEAKFVRSRRRSRLRGEAVYSGAGKDRRDPAAISSALGKLISARGWSSSIDIGKVLGRWPDLVGEQVAMHCKPVDFSPPLLIIAADSTTWATQLRVLKPTILRALEAGLGSQTITEIEIRGPRGRSFKKGRRSVSGRGPRDTYG 170
120 2.000e-36UniRef50_UPI0006D56EAA DUF721 domain-containing protein n=1 Tax=Flaviflexus massiliensis TaxID=1522309 RepID=UPI0006D56EAA  ali  34  4.........EEARARAHAETGDDICLHTLEWARTMQARHGYQRVGKPKAFTGKGAPRQEGQVGSGPRPSWRDPRPLGDGLAGLIAKSGWSRQLSVAKLRNDWDKIVGPTVAKHAPLEEFEDGILTIAASSSAWAVNLHSLLPQVEKAIADAIGEGVVTSIKVKTPRQVSWKHGLFSVPGRGPRDTY. 196
121 2.000e-36UniRef50_A0A2A9CX31 Putative nucleic acid-binding Zn ribbon protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2A9CX31_9ACTN  ali  36  3...............EHDPEGQELARQIARAARGAAPKPKRGPRERPLD----------------------EPTRVGDLLKGVMDDQGWTAEVNVHQLLARWPALVGPINAAHSTPESYSQTVLIVRADSTVWAASLRSIAPQLVAVLNEQLGQGTVTRIQVIGPQAPSWKKGPRSVPGRGPRDTYG 152
122 2.000e-36UniRef50_A0A1Q5PV23 Uncharacterized protein n=1 Tax=Actinomyces hordeovulneris TaxID=52770 RepID=A0A1Q5PV23_9ACTO  ali  43  4.......................LALRALDRFRSAAWEKGEVRVAWARGPRRWQPPPGVKFWGSGPGKSRRDPKRLGAVGERVLARLGLTEAVAGGKVAAMWPSLVGPQIADHTKVEACTDHNLVIRTDSTAWAQQLRILTPNLLARIEAAAGAGVITSLTILPPAAPSWRHGPRVVPGRGPRDTYG 181
123 2.000e-36UniRef50_A0A0A0C4I8 RNA-binding protein (Fragment) n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A0A0C4I8_9CELL  ali  41  2...............................................AQPGKPVPRRASGPVGDVRTGSGRDPVLVGDTLSRLASERGWSEPLSVGGVVGRWREVVGDDVAEHCTPETFDDGLLVVRADSTTWATNLSLLAPQLLGRLADEVGPDVVREVRVLGPSGPRWAKGKRSVPGRGPRDTYG 141
124 3.000e-36UniRef50_A0A2W4XF42 DUF721 domain-containing protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2W4XF42_9MICO  ali  54  2....................................................GGAKRLRRRGWTGSGADPWDPQPLGRLVGQVAKKRGWDDKVTTGRLFAEWDRIVGEDVSAHATPERLEEGVLYVRASSTAWATQLRLVAADILRKIAAAMGPGHVRRLRIQGPDKPSWRKGPLHVSGRGPRDTYG 136
125 3.000e-36UniRef50_E6J8W2 Uncharacterized protein n=4 Tax=Actinobacteria TaxID=201174 RepID=E6J8W2_9ACTN  ali  56  2..........................................................RKRGWTGAGADPWDPQPLGRLVGQVAKKRGWDDKVATGRLFAEWGRIVGEDVSSHATPERLEEGILHVRASSTAWATQLRLMSADILRKIAAAMGPGHVRRLKVEGPEKPSWRKGPLHVSGRGPRDTYG 130
126 3.000e-36UniRef50_C0E1N5 Uncharacterized protein n=1 Tax=Corynebacterium matruchotii ATCC 33806 TaxID=566549 RepID=C0E1N5_9CORY  ali  35  2.................................................RASTSKGQPTGLDGRAILRPDRNLEGISALVEQEITARGWRTKLAGGWIHSHWSLLVGDRIAGHTKVEKFADKKLYISCDSTAWASNLRTMQRNILSTIEEKVGPNIVTELRISGPKPPSWRYGPLHVKGRGPRDTYG 139
127 4.000e-36UniRef50_I6XRE5 Uncharacterized protein n=6 Tax=Propionibacteriales TaxID=85009 RepID=I6XRE5_PSEPQ  ali  38  1MTESPLG-DDLPGEEPHDPTGLELAAEI---AHQTARTSPLLPEAAPPPPKAPKRRHWAGEQRSGAHPDDRDPQLIGSVLESVAKRRGWQRQISLAIVLRDWPGLVGAMNAEHSCPVEFRDGVLIVQCDSTAWASAMRYNAGPLVAKLNHALGERSVLRIEVLGPHAPNWKRGRRSIRGRGPRDTYG 183
128 5.000e-36UniRef50_A0A1R4EQJ7 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives n=6 Tax=Bacteria TaxID=2 RepID=A0A1R4EQJ7_9MICO  ali  36  22...........................................GDPAHTTRDGRRRRAAAEQGSKPFGKGRDPEGLGAVLDLAAANFGWTEELARGDVIGNWASLVGDGAAEHSVAQEVIDGELVVQCASTAWAQQLRMMHSDIIKKLTERFPESSVRRIKFNGPHQRSFKAGYRSVPGRGPRDTYG 165
129 5.000e-36UniRef50_UPI0009FB05A7 DUF721 domain-containing protein n=1 Tax=Curtobacterium ammoniigenes TaxID=395387 RepID=UPI0009FB05A7  ali  38  2...............................................RGVDARRRRANEANADSVPYGRGREPKGLADVVEILTADLGWSEPLAQSDLVRAWPDVVGAEMAAHTTLVGVEDHALLIRCDSTAWATQLRIMRSTITTTIAERFPEAGVESVRVSGPGAPSWKKGFRSVQGRGPRDTYG 141
130 6.000e-36UniRef50_A0A2T0URV7 Uncharacterized protein DUF721 n=3 Tax=Glycomycetaceae TaxID=85034 RepID=A0A2T0URV7_9ACTN  ali  51  22........................................................PRFRKEWSGPGPDKRDPELLGSLLPQIVRKNGWTRKVADASVFGRWEAIVGPDIAGHCRPEQLENGELLVVAESTAWATQLRLFSRQIHAKIAAALGPSVVKRLKIVGPRQPTRSYGPRRVRFNGSRDTF. 151
131 7.000e-36UniRef50_A0A0M2GVP8 UPF0232 protein UK15_07560 n=46 Tax=Actinobacteria TaxID=201174 RepID=A0A0M2GVP8_9ACTN  ali  34  1MT-ENTPVGVPKPSKPPEPSGVDLARV-------ALRAAKDAARARGDAAQQKKQARRGGGLRSGARADGRDPMALGSAINRLITERGWEAPAAVGGVMGRWPQIVGEDVAKHCEPERYDEDVLTVRCDSTAWATNLRLLAPTLVARLNEDLGHGRVKLIKVQGPGGPARRYGPLRAPGSGPGDTYG 182
132 7.000e-36UniRef50_Q0RUP4 Uncharacterized protein n=7 Tax=Actinobacteria TaxID=201174 RepID=Q0RUP4_FRAAA  ali  47  2............................................................PGIAAPGREWRDPVSFGTAISRLLAARGWKAQADDAGVLARWDVIVGPDIADHCTPVSLRDGNLELVAESTAWATQLRMLSRQILAILHRELGPQVVQRITVRGPTAPSWRHGPIRTAGRGPRDTYG 128
133 8.000e-36UniRef50_T5KDW8 Uncharacterized protein n=42 Tax=Terrabacteria group TaxID=1783272 RepID=T5KDW8_9MICO  ali  34  13........................................RLRGLQPSSKSWKRKRRIATDDDNAPFTPGRDPGALGAVLDKLSRDSGWQITLAREDLVRQWADLAGADTAKHSEPVSLERGLLTVKCDSTAWAKNLQFMRATILTEIGRRYPDAGVENLRFIGPDVPSWKWGPRAVPGRGPRDTYG 159
134 9.000e-36UniRef50_A0A0N6ZVH8 Uncharacterized protein n=76 Tax=Microbacteriaceae TaxID=85023 RepID=A0A0N6ZVH8_9MICO  ali  38  18......................................RAVFGDPSLRTVDARRRRSRELDADTVPYGKGREPRGLGDVVGALAQELGWSEPLARSELFVDWPAVVGDELAKHSRPMTIDDGTLVIRCDSTAWATQLRLMRATVTTTIAERHPGAGVQSIRVSGPDVPTWKRGPRTVQGRGPRDTYG 166
135 1.000e-35UniRef50_A0A0A0BL39 Uncharacterized protein n=3 Tax=Cellulomonas TaxID=1707 RepID=A0A0A0BL39_9CELL  ali  46  15........................................................................PTLLGETLQRMATERGWSTELSVAAVTARWREVVGDQVADHCVPETFDGGVLVVRTDSTTWATNLRLLVPELLRRLEMELGADVVTEVRVLGPSGPSWAKGPRRVAGRGPRDTYG 129
136 1.000e-35UniRef50_D0WL05 Uncharacterized protein n=17 Tax=Bacteria TaxID=2 RepID=D0WL05_9ACTO  ali  39  36.......................LALRALDRAREAAYARGDVRTRRPSAARTQSPGPGWGDVGSGPRPSHRDPHPIGQILARYVRDKGWRERLEVASVASRWPEIVGPTVAKHCTVEDFDGGRLTLRTSSTSWETQIRALQATLEATLAKEVGEGVVKEIVVKGPSQPSWKHGRFSVRGRGPRDTYG 220
137 1.000e-35UniRef50_A0A285EEW0 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=7 Tax=Actinobacteria TaxID=2  ali  53  36........................................................AGPRRTWTGARPGDDDPQPLGRLVDSLVTAQDWSTHTKVGAVFGRWSALVGPDIAAHCTPQTLTEGELLVVAESTAWATQLRLLAPTILGRLRAQVGGDVVTRLRVVGPTAPSWKKGPRSVRGRGPRDTYG 166
138 1.000e-35UniRef50_UPI0009EE4BAB DUF721 domain-containing protein n=1 Tax=Cellulomonas timonensis TaxID=1689271 RepID=UPI0009EE4BAB  ali  37  10.TAPAPAVDGVPAGEVVDLPPAQVARAALERAKEAARAKGIRPGQAP-------RRSPLDIPRGTSGPGGRDPQMIGATLPVLVRNQGWVQKLSVGGLMGRWREIVGDG-ADHCVPETVEDGVLTVRADSTAYATNVRLYSSAMLREIATVVGEDVVREVRVLGPAGPGFKRGPRSVPGRGPRDTFG 188
139 1.000e-35UniRef50_UPI00037137FE DUF721 domain-containing protein n=1 Tax=Actinopolymorpha alba TaxID=533267 RepID=UPI00037137FE  ali  38  2............SESSWNPTGLDLARAVAASLGAAAATGKHAGRTSSGRKTRRTRTGRDRSTRSGARPDDRDPQALDSTIDRLVNERGWTSSVAVAGAIARWDHIVGPDVAAHCRAVRYVDQELTVQADSTAWATQVRLLAPSLVKRLNEELGDGTVSRVVVLGPAAPSWRKGPRTTRGVGPRDTYG 183
140 1.000e-35UniRef50_A0A2T1A255 Uncharacterized protein DUF721 n=1 Tax=Antricoccus suffuscus TaxID=1629062 RepID=A0A2T1A255_9ACTN  ali  41  9...............AATPPAVDPAARSFASMLHISGSSVDAGKYLPRARRTPRRQSPRRRRWSGAGPSARDPQALGSVFSRVAQVHGWGEDMQRGRIFGQWDLIVGEMLAEKTTPVSLEAGVLTIRAVSTAWATQLRLELRRLHLKINESVGPDVVTSIRVQGPVAPSWKKGRRSMRGRGPRDTYG 185
141 1.000e-35UniRef50_C2CSS5 Uncharacterized protein n=6 Tax=Corynebacteriaceae TaxID=1653 RepID=C2CSS5_CORST  ali  31  3......................DPVKDFFDRVRSNSKNAPKLNKPSPKMNVEAPKEPRKYQVGRPTGPDGRRLRSLGAALSKEISRRGWESDLADGWVMGNWTNLVGERIAAHTKPERIKDKVVYISCDASVWATELRYLQRQILKKIAERLGPDVIVELRIQGPKQHRNYQGRQWVKPQGSQDTYG 173
142 1.000e-35UniRef50_D7GHD8 Uncharacterized protein n=6 Tax=Propionibacterium freudenreichii TaxID=1744 RepID=D7GHD8_PROFC  ali  34  105..PSAGGPDEGALPDDHDPEGFEVATSVAHQLSGM--LPPARLGPRKKGRKRRRRARLFDEERSGAGPDVRDPQAVGSAMEKLVNERGWRTQLGLRLIVGRWAELVGPTNAAHSRPESYRDRVLVVRAESSTWASALRLLAPQLVAELNRRLGDGSVIRVDVRGPAAPSWRHGRRTVNGRGPRDTYG 287
143 1.000e-35UniRef50_UPI000970F966 DUF721 domain-containing protein n=1 Tax=Actinomyces mediterranea TaxID=1871028 RepID=UPI000970F966  ali  27  41...EETHPGLGSMVGTSESAAVDLSAPT-----QIDREGPLSPIEGQRAAIRAGAKWAKSPGLAPMRLKYRSAGRIDTVLSRMIHRNQWDTPTKMGSIMAKWPQIVGDTVAQHCEVETFEEHKLIVRCSSTAWAKQLHLLLATIERRIDEEVGAGVVTQVIIRGPVAPSWRKGPLSVPGRGPRDTY. 227
144 1.000e-35UniRef50_A0A2G6JWR5 UPF0232 protein CSA58_06675 n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A2G6JWR5_9MICO  ali  43  5..PGAEPGPDSDRPETAGPAGGDAVKAALAAAKAAAQARGVRPGDAPSHDASRHXXXXXXXRYTGSGPDERDPQPLGALADAVLQQRGWTREVAAGGVFGRWRELVGHQVAEHAEPESFIDGTLTIRTSSTAWATQMRLLVPSLLRRLHDELGEDVVGRLVVLGPDAPSWRRGPRSAPGRGPRDTYG 197
145 1.000e-35UniRef50_A0A1Q3PVH8 Uncharacterized protein n=26 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q3PVH8_9ACTN  ali  45  6....................GADLAREALDAAKXXXXXXXXXRTSGSGAAAAGVSRRLQRRRWSGPGTDRRDPQLLADTVGSWLSAAGAGREIVKASVFARWADIVGADIAAHASPVSLVDGELVLQAESTAWATQLRLLAPGMITKINAAVGRGTVTRIRTRGPAGPSWRFGNRHVPGRGPRDTYG 179
146 2.000e-35UniRef50_W0ZBK4 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives n=6 Tax=Microbacterium TaxID=33882 RepID=W0ZBK4_9MICO :_  ali  33  1MSEEDSPPAGEETVEAPSLTVATYLRL----------------RGIAAPRSRKRRRIRDAEGENVPFAPGRDPHGLGDVMADLTREAGWNTHLASEDVLRRWADVAGSQTAEHARPVSLEGGIMTVQCDSTAWARQLSSLRAEILTRIIREHPDAGITAVRFVGPDVPSWKWGPRTIPGRGPRDTYG 171
147 2.000e-35UniRef50_L1PE77 Uncharacterized protein n=4 Tax=Actinomycetaceae TaxID=2049 RepID=L1PE77_9ACTO  ali  36  80..................................................SRAGSRWIKMPGMAPMRRKYREPKKLGLTIDSLIASRGWQEHTRAGDLMARWSDIVGDEVAEHCSIETIDDHRLIVQCDSTAWFKQLQLLLPRLERTIAEAVGEGVVQQVILRPPASPSWKKGRLSVPGRGPRDTY. 215
148 3.000e-35UniRef50_A0A0K2GXJ4 Uncharacterized protein n=4 Tax=Corynebacterium TaxID=1716 RepID=A0A0K2GXJ4_9CORY  ali  36  31......PPKKNGAWTGLEAPAPNKA--AAEIVGDVEKQREKQAEVRDRAGTMIPPSLLRESGIRLYRKYDRRPAPIGAVLNKAIVDRGWQIHIAHGVIMTEWEQMVGKVVAEHSQVREFKDGTLVVECRSTAWATQLRLAQRQVLKSIADRVGDGVVEELKILGPKAPNWRKGRLHIEGRGPRDTYG 209
149 3.000e-35UniRef50_A0A0H2KWW2 RNA-binding protein n=3 Tax=Micrococcales TaxID=85006 RepID=A0A0H2KWW2_9MICO  ali  40  45...EPRATGVPVGDVVELTPPAEVARQALNRAKAAARAKGLRPGQ------EPRRRILADPPTSGARPGGRDPQLLGDVVAHLLRERDWVADVSVGGVVGRWREVVGDQVADHCEPETFEDKVLVVRADSTAWATQVRLLTPQLLERLAREVGEGVVETVTVLGPAGPSFRRGKKSVRGPGPRDTWG 222
150 4.000e-35UniRef50_A0A0M4MLA8 Uncharacterized protein n=2 Tax=Lawsonella clevelandensis TaxID=1528099 RepID=A0A0M4MLA8_9ACTN  ali  43  62.......................................RDRASRGQRGAGSASTGRYRRYSWTSSGPDEWDPQLLTSLIADTVKKHGWQAEVTGGRIINNWPDIMGEEIASHSHVEKLDDGTLHIRTDTTAWATQLRLLQPQILAELGKRYGS-TVRMLRILGPNRPSWRKGPKHVKGRGPRDTYG 209
151 4.000e-35UniRef50_A0A161IF61 Uncharacterized protein n=16 Tax=Micrococcales TaxID=85006 RepID=A0A161IF61_9MICO  ali  35  1MSDASPAGAADDGPRERDPRPV-AARGDLTPPAEVAREAAAARAKGLRPGVPSRRSPLAEPRPESQGPGARDPRTLSDVVGRLLRDKGWTQDVSVGGVIGRWREVVGDQVADHCVPETFEDKVLVVRTDSTAWATQVRLLVPTLLRRLAEEVGEGVVEQVQVLGPAGPSFRRGRRSVRGPGPGDTYG 191
152 4.000e-35UniRef50_A0A061LZN6 Uncharacterized protein n=5 Tax=Leucobacter TaxID=55968 RepID=A0A061LZN6_9MICO  ali  36  16......................................RAKSIWRGVPARRRNRRHQDDDSPGGRPFGGGRDPRALGEVLTVMASDMGWSIELEQARLVAEWPEFAGEATAEHTTVLGISNGVLQVQCDSTTWATELRRLRAEMLTRLLRDYPDAEVRDLRFLAPGAPSWRHGPRTVKGRGPRDTYG 164
153 5.000e-35UniRef50_E3H317 Uncharacterized protein n=39 Tax=Actinobacteria TaxID=201174 RepID=E3H317_ROTDC  ali  36  62...............................AKKILREFGSAMSAEPGQRKTRAQRMRALGGYTTSGEDSRDPKPLDGVISYLIRSRGWKEPVAVSSVMARWSELVGPELATHAKPTRFENAVVDVQCDSTAWATQLRLMRNQIVQMFARELGEGVVTNIRIYGPNNGRWSRGPKRAPGRGVRDTYG 221
154 6.000e-35UniRef50_A0A1G6VVZ6 Uncharacterized protein n=4 Tax=Glycomyces TaxID=58113 RepID=A0A1G6VVZ6_9ACTN  ali  50  26........................................................PRFRKEWSGPGPDKRDPELLGSLLPQIVRKNGWTRKVADASVFGRWEAIVGADIAGHCRPERLEHGELLVVAESTAWATQLRLFSRQIHAKLAAALGPSVVKRLKIVGPQQPTRSFGPRRVRFNGSRDTF. 155
155 6.000e-35UniRef50_A0A1M3LCJ8 Uncharacterized protein n=1 Tax=Micrococcales bacterium 73-13 TaxID=1895791 RepID=A0A1M3LCJ8_9MICO  ali  40  35..............................................................GAAPFEPGRDPGSIGAALAGLVRERGWEGELARSELFVGWADAVGPAVADHTAPVSLEEGVLVIRCDSTAWATQLGLMRPQLLAALGERFPDAGVAGLRLLGPDVPSFKRGLRSVPGRGPRDTYG 159
156 7.000e-35UniRef50_A0A147ERA5 Uncharacterized protein n=12 Tax=Leucobacter TaxID=55968 RepID=A0A147ERA5_9MICO  ali  35  12..................................DAYLRAKSVWRGVPHRRRMRRQGDSAPGGSPFGF-GRDPRALSDVLVTVASDMGWSVELEQARLIGEWADFAGGATAEHTSVIGISHGVLQIQCDSTTWATELRRLRGELLTRLLRDYPDSEVRDIRFLAPGAPSWRHGPRSVPGRGPRDTYG 163
157 8.000e-35UniRef50_A0A1H5LLE7 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=3 Tax=root TaxID=1 RepID=A0A  ali  44  14........................................RTARPGTRPGRTLRRHDGVAFEAAPGHGTGRDPAPVGNALETLATQLGWKQPLSVGGVIGRWREVVGDQIADHCTPETFAEGVLVVRADSTAWATQIRLLAPQLDRRLAEEVGEGVVTSIQVLGPGGPTWRKGPRVAPGRGPRDTYG 161
158 8.000e-35UniRef50_A0A2N6V0G7 DUF721 domain-containing protein n=2 Tax=Actinotignum urinale TaxID=190146 RepID=A0A2N6V0G7_9ACTO  ali  34  35...........................AFGRYQEAAFRRREIRQPPSSYARNVMKKMAEEKVGSGAKPSWRDPQPMALLMKRLVRDKGWNEKVEVASLSVRWSEIVGPNIAKNTRVESFDDGLLTIRTSSTSWAVQLRVYMATIQKNIAEIVGEGVVKSIDIKGPTQRSWKHGKYSVPGRGPRDTYG 215
159 8.000e-35UniRef50_UPI0009890CD3 DUF721 domain-containing protein n=1 Tax=Tessaracoccus aquimaris TaxID=1332264 RepID=UPI0009890CD3  ali  30  2............SQEPHDPTGLELASEIARATVEASEYVVALPEPAAPKQP-RRRQRVVEQQRSGAHPDDRDPQLVGAVLDRVVVERGWKRRIGLSTVLRHWPDLVGEANAEHSAPVNYDKGVLIVDCDSTAWAQAMKYTASVLVARLNEALGERTVLRVQFRGPQAPSWKKGPGPCRAEG...... 169
160 1.000e-34UniRef50_A0A076NGS8 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives n=8 Tax=Corynebacteriaceae TaxID=1653 RepID=A0A076NG  ali  36  3......................DLVQQTFEQLRETARRSGRVPRRSVDKRMAEEKKRPWVRRGRPTGQDGREVASFSALLGKEVRQRDWTEHMAYGWVMGNWESLVGAKIAQHTKVEMIKDGEVHITCDTTAWATQMKYMQSTILRALAEKLGPDVITKLHIFGPRTKSWRYGPLHVKGRGPRDTYG 199
161 1.000e-34UniRef50_A0A134BHF8 Uncharacterized protein n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A134BHF8_9ACTO  ali  37  78.....................................ARDQVPGLAQLQPSPGLAGAGNGGRWS-----RREPRSLGAVWKKYVRNFGLGKLLDEGKLKANWEQIVGSQVAQHAQIESIKDGDVILRCDSTRWASELRNLIPQLMGLIEEHAGTVVIKRLIVLGPKAPSWKYGPRSVKGRGPRDTYG 222
162 1.000e-34UniRef50_UPI0004284AF9 DUF721 domain-containing protein n=1 Tax=Leucobacter chironomi TaxID=491918 RepID=UPI0004284AF9  ali  41  16.......................................................................DPRALGEVLLVMANDMGWSVELEQARLLAEWPEFAGEATAEHTEVIGISNGVLQIQCDSTTWATELRRLRAEMLTRLLRDYPDAEVRDLRFLAPGAPSWRHGPRTVKGRGPRDTYG 131
163 1.000e-34UniRef50_UPI000C07CA76 DUF721 domain-containing protein n=1 Tax=Corynebacterium sp. Marseille-P4122 TaxID=2014528 RepID=UPI000C07CA76  ali  31  1MSEQDDAERPENSAENNADHNLDPIAQALEGLRKAGGKPGAALPRVASKKRMSDTRGRGSRVFKRPDRSYRNPKSLHDLIKPTIGRFGWAEDFAVGSVMNNWEEIVGPTVADKTRPVAFDKRKLSIECDSTPWASNLRFMKPQILQAIERLAGEDIVRDLEIRGPDLGPKRKGRYKVQGRGPRDDYG 199
164 1.000e-34UniRef50_A0A2N3FWW5 DUF721 domain-containing protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2N3FWW5_9ACTN  ali  40  31..............................................................KRRSVPRTDEPTLLGDLLKEVIEDEGWTREVNVHQLLARWPALVGPVNAAHSQPVGYADTVLTVRAESSTWATSLRTIAPQLVAVLNDQLGQGTVTRVVVIGPEAPSWKKGRRSVPGRGPRDTYG 155
165 1.000e-34UniRef50_A0A1D9MML7 Uncharacterized protein n=1 Tax=Actinomyces sp. VUL4_3 TaxID=1912795 RepID=A0A1D9MML7_9ACTO  ali  38  50.....................................................RLGPGYPRTKTGPGPSKRDPKPLGN----FVEMLNWERRLQVARVIEDWAKIVGANVAHNAQVTEFTNGKLVLQASSTAWATQLRLLIPEIMRQVNDYCDQGMCQQVQILAPKAPSWKKGPLSVRGRGPRDTYG 181
166 1.000e-34UniRef50_A0A249KR93 RNA-binding protein n=19 Tax=Actinobacteria TaxID=201174 RepID=A0A249KR93_9ACTN  ali  36  20.......................................................RKPNKPAPTKTVGQVGDPELIGELLSNMIEEREWNSGLAEGNLFITWATIVGAEIAQHATPISILDSTLTIQTSSTAWATQLTLVADNLLATIQNDPSGATIQKLRFIGPQGPSWKKGVRVIRARGPRDTYG 152
167 1.000e-34UniRef50_UPI0009F994F4 DUF721 domain-containing protein n=2 Tax=Actinomyces liubingyangii TaxID=1921764 RepID=UPI0009F994F4  ali  34  2...QPPVKERPMSETEADPQDSDYPLQAFQRARQEAFAGGALSSPLSELKGNLERGVGLPRVMSGPGPSARDPQKVGPMFSGIF--NGREKELSAASIMTNWAEMVGPQIAEHAEIESFKDGKLIIRASSTAWAQQLKLLIPNIMRKIGAA--QAGVKQLIILPPKGPNWKKGPLSVPGRGPRDTYG 209
168 1.000e-34UniRef50_A0A1H9TRF6 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=2 Tax=Propionibacterium cycl  ali  36  32...QQTPREPAGDSEEHDPEGYELA-------TQVAMGLSGLLPPPRVGPPKRRRSRTREEMRSGSGADPRDPQPLGTAMERLVRARGWRTELGLRLIVSRWSMLVGEANAQHSAPEAYHDHVLVVRAESSTWATALRTIAPQVVAELNRRLGEGSVVRVDVRGPASPSWKHGPRSVPGRGPRDTYG 208
169 2.000e-34UniRef50_UPI0009FD2800 DUF721 domain-containing protein n=1 Tax=Actinomyces hordeovulneris TaxID=52770 RepID=UPI0009FD2800  ali  41  62..............EPTPPEVRALALRALDRFRSAAWEKGEVRVAWARGPRRWQPPPGVKFWGSGPGKSRRDPKRLGAVGERVLARLGLTEAVAGGKVAAMWPSLVGPQIADHTKVEACTDHNLVIRTDSTAWAQQLRILTPNLLARIEAAAGAGVITSLTILPPAAPSWRHGPRVVPGRGPRDTYG 248
170 2.000e-34UniRef50_A0A1N7IQC0 Uncharacterized protein n=2 Tax=Corynebacterium TaxID=1716 RepID=A0A1N7IQC0_9CORY  ali  37  3.........QPETNREENRNGPDLVRATFENLRATAKRRGGKVPRLSGQGKPEPAQKRRFQRGRPTGPDGRPLQRFGSLLKKEISQREWTEPIAHGWVMGNWEALVGEKIAQHTEVSMIKDGELFISCDQTAWATNLKYMQSTVLSQIAEKIGPGVITKLHVYPPKTKNWRYGPLHVKGRGPRDTYG 219
171 2.000e-34UniRef50_A0A0Q1D8K0 Uncharacterized protein n=5 Tax=Frankiaceae TaxID=74712 RepID=A0A0Q1D8K0_9ACTN  ali  43  52.......................................RAGRRPRSGEDDGQVPQRPRLPGIAAPGREWRDPVPFGTAISRLLATRGWKAQADDAGVLARWDAIVGPDIADHCTPVSLRDGDLELVAESTAWATQLRMLSRQILAILHRELGPQVVRRITVRGPTAPSWRHGPIRTAGRGPRDTYG 199
172 2.000e-34UniRef50_A0A096AMU5 Uncharacterized protein n=9 Tax=Corynebacterium TaxID=1716 RepID=A0A096AMU5_9CORY  ali  34  2...........TEQTPEQTPPQDLVASTFKNLRATAKRRGGRQGAGVIPRRSTGKGNTAPEGLKVPGRRGYEVKGFGALVKNEIAQRDWTESIAHGWVMGNWESLVGEKIAQHTEVTMIKNGEVFISCDQTAWATNLKYMQSTVLSKIAEKIGPGVITKLHIYPPKTKNWRYGPLHVKGRGPRDTYG 208
173 2.000e-34UniRef50_S3X5X1 Uncharacterized protein n=1 Tax=Propionibacterium sp. oral taxon 192 str. F0372 TaxID=1203605 RepID=S3X5X1_9ACTN  ali  39  1MEPDDEFP-TLPKIAGYDPLGSELADTVLSNV---------LGVRPRPISRKTRHAANESQDWSGPAPDARDPQLLGAALDDLVGRRRWRREIAVRRVLESWELVVGVTNAAHSRPEGYVDKVLRVRTDSTAWATVLRRMAPRIIAMLNERIGQETVKRLEIKGPDAPNWKHGRLSIAGRGPRDTYG 178
174 2.000e-34UniRef50_C7MRN7 UPF0232 protein Svir_00050 n=14 Tax=Pseudonocardiaceae TaxID=2070 RepID=C7MRN7_SACVD  ali  51  27.SKEPGAASTATGASTSRPQGRDLAKAALQAAKERAGTRGTRPGARRPGTPRTGGQNPRRRRWSGPGFDERDPQPFGRLLSNMATQLGWSARLANGRVFGQWSTLVGAEIAEHAQPMSLNNGELTVRASSTAWATQLRLLQRQLLARIAAGVGHGVVTRMRIQGPTAPSWRKGPKHIPGRGPRDTYG 217
175 3.000e-34UniRef50_A0A094PF43 Uncharacterized protein n=1 Tax=actinobacterium acAMD-5 TaxID=1504319 RepID=A0A094PF43_9ACTN  ali  35  16.......................................RARVRATSSPVRRRTNAPNYDEQRSGAGPDERDPAMLSGLIQRLIINKGWDLQVATGKLQGQWGLIVGHDVASHVIIESFQSGTLLLRADSSAWATQIRLLLPTISERLGNEIGQGRISEIKVLGPTAPSWKHGIRSVKGRGPRDTYG 169
176 4.000e-34UniRef50_A0A1F0QC74 Uncharacterized protein n=4 Tax=Actinomyces TaxID=1654 RepID=A0A1F0QC74_9ACTO  ali  35  81.............................RNAREELRARAMLGPLWALRHRSGAGRAGRVGLASG-RLRWNEPRSIGRVIKKTTHDRGWDSSTAMGSVMAQWPVIVGDNVAQHCSIETFNDRTLIVRCSSTAWAKQLVLLLPHIERRIAEEVGAGVVDQVIVRGPSGPSWNKGRWSVKGRGVRDTYG 237
177 4.000e-34UniRef50_D1BI10 Predicted RNA-binding protein containing Zn ribbon n=4 Tax=Micrococcales TaxID=85006 RepID=D1BI10_SANKS  ali  43  59.................................................PGAQRRRILAEPRRSGPGKDGRDPKLFAETLSAFLEQRGWVQEVSVGGVIGRWREVVGDDIADHCEPETFDNGILTVRASSTAWATQIRLLVPQLLGVLEREVGQDVVQTITVQGPAGPGFGKGFRSVQGRGARDTYG 196
178 4.000e-34UniRef50_A0A1Q5PSS1 Uncharacterized protein n=1 Tax=Actinomyces marimammalium TaxID=156892 RepID=A0A1Q5PSS1_9ACTO  ali  32  11.......................LPARMLDQAREVALRNKQFPVPLKALLATKKSGRRKVQRPTGFGPSPYDPARASQVMNSVLGPF--VRELALAKLRTQWDDIVGSDIAAHCQVEKVDKETVVVRASSTAWATQLRKLSYLMLQKIQGKIGSQVIDDIKILGPIVPSWKMGALSVPGRGPRDTYG 186
179 6.000e-34UniRef50_A6W3V8 Uncharacterized protein n=43 Tax=root TaxID=1 RepID=A6W3V8_KINRD  ali  42  26.AGEPGQDPGDGPEDDDGSIGADLARTALGRARAAAAARGLRPGQVPLGGKQTREEWREARRRSGAHPDARDPQSLDSTLGRLVGERGWERPVAVGGAFGRWDVVVGPELAGHCTPETLKDGTLVVRAESTAWATQVRLLTSHLVRRLDEELGHGVVTKVVVRGPQGPSWRKGGRSAPGRGPRDTYG 217
180 7.000e-34UniRef50_D7BLH3 Uncharacterized protein n=6 Tax=Actinomycetaceae TaxID=2049 RepID=D7BLH3_ARCHD  ali  30  19.......................LPLQILERVRRMAADQGFVRRRSVSRETLAATKPPGQEVGSGARPSYRDPKPVFELMKKAIEERGWKSQLDVASVAARWPEIVGESVAANCAVVEFTDGTLTLKARTVAWETQMRSLLHHLDARLAQELGEGVVKEIVLNGPYVPSWKHGKLSVPGRGPRDTY. 193
181 7.000e-34UniRef50_A0A095Y374 Uncharacterized protein n=2 Tax=Actinomycetaceae TaxID=2049 RepID=A0A095Y374_9ACTO  ali  33  80..................................................SRAGSRWIKMPGMAPLRRKYREPKRLGLTVDSLIAQRGWQEHTRMGDLMSRWNQIAGEEIAAHCRIEAIEDRRVIVQCDSTNWFKNVQLFLPQLERNIAEAVGEGVVQQVILRPPASPSWKKGRLSVPGRGPRDTY. 215
182 7.000e-34UniRef50_A0A1J5PWI6 Uncharacterized protein n=1 Tax=mine drainage metagenome TaxID=410659 RepID=A0A1J5PWI6_9ZZZZ  ali  35  2............EPGEESKSGADLARSLL-----------------AAARKNAKAAPAKKTKRVKPTRTSRDPATFADAISGLVDERAWSGDVNVGALFGTWPEVVGEEVASHVKPVSCIDGELILKADSTAWSIQVGFLLGDFKARIETQLGAGIVKTITVNGPTAPSWKKGPRSVRGRGPRDTYG 160
183 8.000e-34UniRef50_A0A2T5X7D3 Uncharacterized protein DUF721 n=1 Tax=Microbacteriaceae bacterium MWH-Ta3 TaxID=207608 RepID=A0A2T5X7D3_9MICO  ali  34  21...............................................KGERRLPRQKKKPIVGSLPFESGRDPKLLGEILDGDSTEKGWARPIARATILDRWSEVVGEDVAAHTSPT-IENDILQVQCDSSAWATQLRILRHDIAQEIANRYPDSGIDRVDVIGPGVPRQNYGPRTVKWRGPRDTYG 159
184 8.000e-34UniRef50_A0A1X7G3B8 UPF0232 protein SAMN02745830_04895 n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A1X7G3B8_9ACTN  ali  40  3.........TDGPAPRKEPSGVDLARVALRAAREQARARGDAAQQKKQARRGGGLR-------SGAGADGRDPMALGPAINRLLAERGWEAPAAVGGVMGRWPQIVGEDVAKHCEPERYDERVLVVRCDSTAWATNLRLLAPTLVARLNEDLGQGRVRHLKVQGPGGPPRRYGPLRAPGSGPGDTYG 176
185 8.000e-34UniRef50_A0A2X0TZC0 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives n=2 Tax=Actinomyces bovis TaxID=1658 RepID=A0A2X0TZC  ali  35  1............MVEAWESAGDALAQRALARGQAAAWDQRRGGESPEDLDPQAPAAPGLAPGKGRPGPSRFDPHLASKALRATAREKGWNGKLRMAMVIVRWPELVGEQVAEHCVVESFDEGVLTVRASSSAWAQQLRLLQPRIEALLAEQIGQGAVTKMTVLGPQGPSWCHGKRTVRGRGPRDTYG 197
186 9.000e-34UniRef50_R1G1B0 Uncharacterized protein n=7 Tax=Actinobacteria TaxID=201174 RepID=R1G1B0_9PSEU  ali  60  2...............................................................................VSRLVSDRGWNESVTSARVFAQWARLVGEDVAEHAQPVALKDGELTVRASSTAWATQLRLLQGKLLHKIAAGVGNGVVKRMRIQGPTAPSWRKGPRHVPGRGPRDTYG 109
187 1.000e-33UniRef50_H5USX5 Uncharacterized protein n=8 Tax=Micrococcales TaxID=85006 RepID=H5USX5_9MICO  ali  46  70...DASVRDSTPTAEHGGDPGAELDEDVLAQAAAAALARAREAARAKGSRPAPRRRRRTGAVFSGTSNDARDPQPLGDQLDHLLLDRGWKIDVAAGSVMGRWDVIVGLDIARHCRPVTFEDGVLTVRADSTAWATQLRLMVPAILARCATEAGPGVVSELRITGPAAPSWSRGPRRARGQGPRDTYG 257
188 1.000e-33UniRef50_W2EW39 Uncharacterized protein n=12 Tax=Streptosporangiales TaxID=85012 RepID=W2EW39_9ACTN  ali  39  1.......................MAREKLAQAKADAVRRGQLPRS----------EPRRRSGSGAPRRDSGDPLPFGKAIRDLLADRGWEQPVAVGGVFGRWHDIVGPDLAAHTVPESFEDGEVMVAADSTAWATQVRLLASTLVKRLNEELGPGTVTRVKVRGPNAGPRQGGGLRVRGQGPGDTYG 155
189 1.000e-33UniRef50_UPI000BA9D5A7 DUF721 domain-containing protein n=1 Tax=Actinobacteria bacterium IMCC26077 TaxID=1848755 RepID=UPI000BA9D5A7  ali  40  6......................DLARSLLAAARRRANKFTRDKEVRSKIRQSSSNESDSTGEYQG-------PQLLNESLAELIAQRGWQEKMKDSDLFIKWNELVGRDIADHVQPLAFADGVLTLSAESTAWATQIRLIDDQIRSAVAR--GGFEVSELVIKGPNAPSWRKGGWSVKGRGPRDTYG 162
190 1.000e-33UniRef50_A0A1Q5PQJ6 Uncharacterized protein n=1 Tax=Actinomyces liubingyangii TaxID=1921764 RepID=A0A1Q5PQJ6_9ACTO  ali  42  31......................................................AGVGLPRVMSGPGPSARDPQKVGPMFSGIF--NGREKELSAASIMTNWAEMVGPQIAEHAEIESFKDGKLIIRASSTAWAQQLKLLIPNIMRKIGAA--QAGVKQLIILPPKGPNWKKGPLSVPGRGPRDTYG 159
191 1.000e-33UniRef50_A0A0A0BX79 RNA-binding protein n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A0A0BX79_9CELL  ali  35  1......MSDEVRVPRVERPVAERLGRTTAAEVARAALNRARAGAEARGLRPPVRRRRQTEVQLSSAARDGRDPALVGDAVDRLVAQLGWRAELSVGGLIGRWREFVGPDIAEHCTPETFEEGLLVVRTDSTSWAKQVQFLAPQLLARLEQELGPDVVREVRAVGPGGRQWGKGPRRVPGRGPRDTYG 183
192 3.000e-33UniRef50_A0A2A9D493 Putative nucleic acid-binding Zn ribbon protein n=2 Tax=Serinibacter salmoneus TaxID=556530 RepID=A0A2A9D493_9MICO  ali  43  41...........................................GLRPGAPGRRRATRTPGTGPGFPVTRSRDPQAVGEALKRLVAAREWSSELSVGGVTARWPQVVGREVAEHATPETFTDGRLVVRASSTAWATQLRLLLPQIERRIAEEVGDGVVQEITIIGPGAPTWRYGNRVVKGRGPRDTYG 184
193 3.000e-33UniRef50_S5SR90 Uncharacterized protein n=6 Tax=Actinobacteria TaxID=201174 RepID=S5SR90_9CORY  ali  34  55............AARDASTSGEEAAGPVIPGFTQFADLAGADRRAVLGTRGYWRAGSGRPSGPDGRRMRRSYSVPLGAVLGKEIEDRGWEHDLAAGWVTNHWAELVGEKIAQHTTIEMIKDKKVFITCDSTAWATNLKYMQRTILQQIAAKVGPDVIVALRIYGPQTKSWRKGPLHVKGRGPRDTYG 231
194 3.000e-33UniRef50_L7VW52 Zn-ribbon-containing RNA-binding protein n=1 Tax=uncultured bacterium A1Q1_fos_140 TaxID=1256547 RepID=L7VW52_9BACT  ali  35  40..........................................................................TVDESLAKLVAEQGWENDLRVHGAFARWGAIMGREVAAHSRPESLVEGKLHIRTDTTAWATQLKLMSADIVRRLNEVLGEGTVLEVDVRGPNAPSWKRGRLSVKGRGPRDTYG 152
195 3.000e-33UniRef50_X5DME6 Uncharacterized protein n=3 Tax=Corynebacterium TaxID=1716 RepID=X5DME6_9CORY  ali  40  5................................RAAAGKTGRPVRKKGRRPRKMKTRYDGR-----PDRSYRDPGQFSDLVQREIKRNGWGRNFAAGSLRSAWPEIVGENIGRHTSVVMYKKRQLHVESDSTAWATNLRLMQSAILTTIAKRIGPDVVAELKIYGPKAPSWRHGPLHVKGRGPRDTYG 156
196 3.000e-33UniRef50_UPI0009F6ECFA DUF721 domain-containing protein n=1 Tax=Actinomyces sp. VUL4_3 TaxID=1912795 RepID=UPI0009F6ECFA  ali  38  169.....................................................RLGPGYPRTKTGPGPSKRDPKPLGN----FVEMLNWERRLQVARVIEDWAKIVGANVAHNAQVTEFTNGKLVLQASSTAWATQLRLLIPEIMRQVNDYCDQGMCQQVQILAPKAPSWKKGPLSVRGRGPRDTYG 300
197 5.000e-33UniRef50_U1MU45 Uncharacterized protein n=6 Tax=Agrococcus TaxID=46352 RepID=U1MU45_9MICO  ali  35  21...........................................GDPEKVTRDGRRRSRRDPDASVPFGKGRDPRALGDVLGGFAEDRGWTTTLARADVMAHWPELVGAENADRTEPISFEDGVLTVRCASTAWTQQMRILRAETTTRILARFPDCGLESVRFIGPDLPSFNRGRRSVPGRGPRDTWG 164
198 6.000e-33UniRef50_I2N239 Uncharacterized protein n=1 Tax=Streptomyces tsukubensis (strain DSM 42081 / NBRC 108919 / NRRL 18488 / 9993) TaxID=1114943 RepID=I2N  ali  43  2..............................................................RSGARADGRDPLPLGAAINRLITERGWETPAAVGGVMGRWPQIVGEGLANHCVPQRYDERVLTVQCDSTAWATQLRLLAPRLVARLNEDLGQGTVKLIKVLGPGAPRRGFGPLRAPGSGPGDTYG 129
199 7.000e-33UniRef50_D3PTX0 Uncharacterized protein n=7 Tax=Actinobacteria TaxID=201174 RepID=D3PTX0_STANL  ali  45  5...................................................PRRKRRRPTGAWSGPGPDGRDPQPLGEVLGKLIKDRGWRDPAAKAGLFANWPQIVGPEIAEHCRPVSCADGELIIEAESAAWATQLRLFKTQILARLASHSGPQVVTRLRIQGPSQPSYVTGPRRVRFR....... 133
200 1.000e-32UniRef50_A0LQS0 Uncharacterized protein n=2 Tax=Acidothermus cellulolyticus TaxID=28049 RepID=A0LQS0_ACIC1  ali  38  34.......................................................QPPLWSTRRDPQTSTGEPELLGASVHRILRDLGWLDRITITRLVDEWPKIIGPELAQHCRPESYDRGVLHIQADSTAWATQLRLLLPQLTARVQEAAG-DLIRLVDVRGPTAPSWRHGPLRVRGAGPRDTYG 164
201 1.000e-32UniRef50_UPI00040FB2A0 DUF721 domain-containing protein n=1 Tax=Pseudoclavibacter soli TaxID=452623 RepID=UPI00040FB2A0  ali  36  25......................................................KAASTPDQGQEAFEPGRDPRGLGRVLDRLAHERGWEPTLEKARLATEWHTIVGDDVAQHTSA-RLNGTVVEVQCASTAWAANLKLMKSRLLGRITELLPDLKVSDMRFIGPDAPSWKRGIRSVPGRGPRDTYG 156
202 2.000e-32UniRef50_A0A1G6H348 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=4 Tax=Micrococcales TaxID=85  ali  39  69.................................................PGKQRRRILAEQPRSGPGKDGRDPKLFAETLAALLQQRGWVQEVSVGGVIGRWREVVGDDIADHCEPETFENNALVVRASSTAWATQVRLLIPRLLELMEQEVGPDVVQDITVLGPVGPGFGRGFRSVKGRGARDTFG 206
203 3.000e-32UniRef50_Q2JH43 Uncharacterized protein n=9 Tax=Frankia TaxID=1854 RepID=Q2JH43_FRACC  ali  42  124.....................................SRTRLGARRADPSDDQVPRRPRMPGIAPPGREWREPVGFGTAINRLLAARGWKAQASDANVLARWDAIVGPDIADHCTPVSLRDGDLELVAESTAWATQLRMLSRQLLGILHRELGPHVVRRIVVRGPTAPSWRHGSIRTGGRGPRDTYG 273
204 3.000e-32UniRef50_A0A1H8DNJ3 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=4 Tax=Actinobacteria TaxID=2  ali  37  1.......................MAREKLAQAKADAARRGQLPRREPRKRA------------SGPRRENGDPQLFGRAISELLAARGWERSAAVGGVFGRWPDIVGPDLAAHTKPESFEDGEVLIAADSTAWATQVRLLARTLVRRLNEELGEGTVTKVKVRGPQNAPRPSGGLRVTGKGPRDTYG 153
205 3.000e-32UniRef50_G0H9N8 Uncharacterized protein n=6 Tax=Corynebacterium TaxID=1716 RepID=G0H9N8_CORVD  ali  38  35..........................................PLRQPFNPRRRGAKPKRMKTRYDGRMDRRDPGRFGDLVQREVRRNGWNRNFAVGTIRGNWEGIVGEDVARHTRVVMYKEKQLHIECDSTAWATNLRLMQTFILQTIAKKIGGDVVAELRIYGPRPPNWRKGRYHVKGRGPRDTYG 183
206 5.000e-32UniRef50_A0A1H1N6E1 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=6 Tax=Actinobacteria TaxID=2  ali  45  122.................................................................AGPDDRDPQVLDATIGRLVDERGWSTDVAVAGALARWDHIVGPDVAAHCRAERYVDAELTVRADSTAWATQVRLLAPSLVRRLNEELGDGTVRRVVVLGPSAPSWQRGLRSVRGRGPRDTYG 244
207 6.000e-32UniRef50_UPI0003674F21 DUF721 domain-containing protein n=1 Tax=Corynebacterium ciconiae TaxID=227319 RepID=UPI0003674F21  ali  36  1MSEQPPATGEGPESQPE----ADLVTRSFKAVRAEAKKRRYFVPDLSRQRRDTTRRWRLRRGSRATGPDGRALRTVGEVLSEEIKARGWGKDLAHGWVQTNWPELVGPVIAGYTMVERVKGTVVYVRCSSTPQAVNLRSMQRIILAKIAEKVGTNVVTALKIYGPEAPSWRHGRLHVKGRGPRDTYG 219
208 6.000e-32UniRef50_A0A1F9EXS3 Uncharacterized protein (Fragment) n=5 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9EXS3_9DELT :  ali  18  13.....................................................................MNKPQSIRSILEKTIKTLEIDAPLKTYSIMGAWKEIVGEPVAIHSQPYSIRNRILFIEVSHPTWMQQLQFLKITLLEKINHFLGEPLIQDIRFKVGKISPPIPAPP............ 118
209 7.000e-32UniRef50_C4LGB3 Uncharacterized protein n=4 Tax=Corynebacterium kroppenstedtii TaxID=161879 RepID=C4LGB3_CORK4  ali  36  82.................................KNSRNSQGLPRAKTTSATSVFREFSRTSRVYPTGPDGRRYESLGSIVNREVVRRGWTEKISHGWITANWSTVAGDYLGAHSRIRMIKDTTLFLECDSTAKASELRYLQTELLSRIAHHVGPDVITAVKIFGPRPPSWRHGPLHVKGRGPRDTYG 241
210 8.000e-32UniRef50_UPI000939B2B4 DUF721 domain-containing protein n=1 Tax=Arcanobacterium urinimassiliense TaxID=1871014 RepID=UPI000939B2B4  ali  31  27.......................LPLQILEKMRVMAEAQGWVRIRKSGSATRNKEMAPQERVGSGARKSYLDPKPLGMLVERTLKEKAWQEKIDVAAIAENWEAIVGKVVAANSCVQEYEEKVLTIRARTVSWETQLRALSLELDKRISSQLGEGVVKEIRIVGPHRPSWRHGKYVVPGRGVRDTY. 203
211 8.000e-32UniRef50_T0MHW0 Uncharacterized protein n=3 Tax=candidate division Zixibacteria TaxID=1379697 RepID=T0MHW0_9BACT  ali  27  5......................................................................KAPESLSSVLGNLLKKRGWERKIKEFQALANWPKIVGPKVAENSKPVRIEGQKLFVRVENSVWKNELVFMQKEIKEKLNKSVNGEVIKDIIFV........................ 97
212 8.000e-32UniRef50_A0A2G4FGB2 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2G4FGB2_9ACTN  ali  35  29.......................................AAAGALRRATVGGQPKTKKSTSRKKSTGSQGRDPQLLGAAVDDFLIEKGWEHSSTAAVLMANWPDIAGADLANHVAPESFIDGELALRAESTSWATQVRLLLPHLRTVIDEAVGKGVVKNITVAGPSAPSWVAGPRRVKGRGPRDTYG 176
213 1.000e-31UniRef50_C3PE75 Uncharacterized protein n=32 Tax=Corynebacteriaceae TaxID=1653 RepID=C3PE75_CORA7  ali  31  2.................TEQDFDPVKALFERTRSNSKNPPKLNKPAPKAPTSSEKQPKPYQRGRPSGPDGRRRRSLGAQIQREIGKRGWEHELAHGWVMGNWENLVGERIAAHTQPLTIKEQVVYVACDSSSWATELRYLQRPILQKIADRLGPDVVVKLHIQGPKQHRNYEGRQWVKPQGSQDTYG 180
214 2.000e-31UniRef50_UPI0003C7DD52 DUF721 domain-containing protein n=1 Tax=actinobacterium LLX17 TaxID=1229203 RepID=UPI0003C7DD52  ali  35  1...........................................................................MADVMAELVNQQGWTDQLAAQRVFTDWAGVVGPDIAQHSTVEGYADTIVHVRAASTAWKRELQLLAPRIVARLNDELGQGSVTRIEVRGPETPTWRHGKRTVRGRGPRDTYG 113
215 3.000e-31UniRef50_A8LB20 Uncharacterized protein n=21 Tax=Frankia TaxID=1854 RepID=A8LB20_FRASN  ali  41  1...........................MLARAKQDARARGTTRPGGGAGDGSXPPARQRLPGIAAPGREWRTPMNFGSAVARLVAERGWQTRATDASVLARWDVLVGPNIAAHCSPVSLRDGELELVAESTAWATQLRMLSRQILGILRKELGPHVVRRITVRGPAAPSWNHGGMYAPGRGPRDTYG 177
216 3.000e-31UniRef50_K0YZI5 Uncharacterized protein n=5 Tax=Actinomyces TaxID=1654 RepID=K0YZI5_9ACTO  ali  31  8........................ARAALRKAQQDAWEKGQARLSAKQLAHVRSPKERSERGGTGPRPSRRDPKKVSVVASFLTRKNGWNKQLRSASIEAKWPEILGPKLLEHAQIETIQAPKLVIRASSTPWANALRMQIPTLLNRIDQKIGAGFITEVTILAPAAPKWTHGRLRVKGRGPRDTYG 191
217 3.000e-31UniRef50_K4IYR5 Uncharacterized protein n=13 Tax=Bifidobacterium TaxID=1678 RepID=K4IYR5_BIFAP  ali  39  39...........................................................RKAWYAFGKPGRDPAKLGGVVTSLAAGSGWTSHLKVARLRNQWDSVVGPGIAAHSRVVSYQEGVLIIQAQTTVWATQLTYLVPQLKATIVKRLG-MPVKQIRVTGPHNYSFRRSRFDPPGRGVRDTYG 165
218 3.000e-31UniRef50_A0A0M8YNE4 Uncharacterized protein n=14 Tax=Actinobacteria TaxID=201174 RepID=A0A0M8YNE4_9PSEU  ali  61  20........................................ERGARGVRKXXXXXXXXXXXXXWSGPGPDDRDPQPLGRLASRMAADRGWAERLAGGQVFARWPKLVGEDVAEHAQPVALSDGELTVQADSTAWATQLRLLQRDLLKRIAAGVGNGVVQKLKVQGPAAPSWRYGPRHVPGRGPRDTYG 166
219 3.000e-31UniRef50_A0A0W8I412 RNA-binding protein n=4 Tax=Intrasporangiaceae TaxID=85021 RepID=A0A0W8I412_9MICO  ali  43  1.....................MEAAREALSRARRTARDKGLRPGSPXXXXXXXXXXXXEEPDPRA----RRDPQLLGDEMERLVAGRGWAGEVQVGGVVGRWRAIVGDQVADQVEVVAFEGSTLTVRARSTAWATQMRLLTSTVLARIEELVGEGVVAEIVVQGPAGPHWRKGPLSSGGRGPRDTYG 162
220 4.000e-31UniRef50_A0A171DJX7 RNA-binding protein n=17 Tax=Actinobacteria TaxID=201174 RepID=A0A171DJX7_9ACTN  ali  35  1MPGAVPGPTGGAAKNAAARGAA-LAREKLAQAKADAAKRGQLPREPRKKA-------------AGPRRESGDPQLFGRAITDLLADRGWREPVAVGGVFGRWHEIVGPEMAAHTTPQSFADGEVLVVADSTAWASQVRWLAGQVVRRLNEELGDGTVQRINVQGPQNGPPRSGGLRVTGRGPGDTYG 174
221 5.000e-31UniRef50_C0XTI3 Uncharacterized protein n=16 Tax=Corynebacteriaceae TaxID=1653 RepID=C0XTI3_CORLD  ali  39  2.....................ADLVSSTFDTLRATARQRGGRVPDLRRQGHSEMPRRARSKRELPTGPDGRQVKGFGALVRTEINKRAWTEKMAFGWVMGNWAGLVGEKIAQHTEVQMIKDGEVFIACDQTAWATELKYMQATVLSEIAQKIGPGVITKLHVYPPKTKNWRKGPLHVKGRGPRDTYG 201
222 5.000e-31UniRef50_A0A1L7CVD4 Uncharacterized protein n=2 Tax=Corynebacterium TaxID=1716 RepID=A0A1L7CVD4_9CORY  ali  39  30..PDPLAGRPRRDDAGAVVPGLGPVGERLAETGFFAEARDRAGTRIPEHLQGRGAGGPRVRRY-----RRNEPQPLGTVLIRQILDRGWAPQMARGMILTRWPEIVGEELAAQVRIDSFDEGTLLLRAASTAWATQLRYLQDRILARIAEEVGDGVVTRLRIIGPPAPTWRKGRYGVRGRGPRDTYG 209
223 6.000e-31UniRef50_E2S7F1 Uncharacterized protein n=11 Tax=Corynebacteriaceae TaxID=1653 RepID=E2S7F1_9CORY  ali  28  3...........EDQGGVGKQRIDPVTQYFKLVRSTSKNPPKLTRPVPKMPVPSLEKAQKQQRGIPTGPDGRKKRSLGSQINREVVNRGWEHDLANGWVMGNWEHLVGERIAAHTQPQRIKDKIVYVSCDNSTWATELRYLQRQILRKISDRLGPDVIVELRIHGPKQRRNYEGRQWVKPQGSQDTYG 189
224 7.000e-31UniRef50_A0A1X6WXK1 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives n=4 Tax=Brevibacterium TaxID=1696 RepID=A0A1X6WXK1_9  ali  34  7..PGVPIPDAGGGLGSVDRTRAPLSGAALDALDRVRRMADIEPRAGAGSWRSSKRWQDGRAAYTGSGHDARDPRPLAGLFTKLAHKRGWETSLDVAQVTSRWSDLVGRDVAANCTVERFDPPTLVVRTSSTTWATQLKILKDGLLDKIEREIGRRVVEDIEIHGPAQRSFTRGRKSVRGRGPRDTWG 201
225 7.000e-31UniRef50_A0A1W9RXA7 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium 4484_93 TaxID=1970780 RepID=A0A1W9RXA7_9BACT  ali  24  3...................................................................RRRGRPEAIGDILGRILERHGLKKRVEESGAVLIWDDVVGEQVSKHTTPVKIERGVLFIHCESASWRQEISFLKSDLIKKLNKHLGKKLIKDIVI......................... 97
226 9.000e-31UniRef50_K6WB79 Uncharacterized protein n=3 Tax=Micrococcales TaxID=85006 RepID=K6WB79_9MICO  ali  42  19................................REGARSAGLRPTSGRG----RTRPRIRPSEYSGARADGRDPVLVGDHLGRLLSERGWQVEVAVGSVISRWPAVVGPEVAQHVTPETFEDGVLTVRADSPSWATNLRYMVPLLLEHLAADLGEGKVTDLRIVGPASQTRRRGQRYLPGRGAQDPY. 169
227 1.000e-30UniRef50_E6KT09 Uncharacterized protein n=31 Tax=Actinobacteria TaxID=201174 RepID=E6KT09_9ACTO  ali  34  97.........EAPASFPEEDPGGDLA--ALRRALE-----------------GTGASWSRSPGMAAMRPRYRRANSLGAILARTISSRAWDTPTKMGSIMAKWRKIVGPQVADHARIETFEGHRLVVRTDSTAWAKQLQLLLPTIERRIVEEVGSGVVEQVIIRGPVAPSWRKGPYVVRGRGPRADYG 255
228 1.000e-30UniRef50_D5NX05 Uncharacterized protein n=14 Tax=Corynebacteriaceae TaxID=1653 RepID=D5NX05_CORAM  ali  33  58...............................................KTPQKRYRGKGRETGADGRRRRKGDIPKLGSHIAREVTSRGWEHELAHGWITGHWHKLVGEKIAQHTHPDRIENGIIYVACDNSNWGTQLRYLQRQILQRISEQVGVDVITQLKISGPKQHKNYQGPMWVKPQGSKDTYG 198
229 1.000e-30UniRef50_A0A1R4F9E8 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives n=2 Tax=Actinomycetales bacterium JB111 TaxID=143482  ali  34  64......TPRPGRGSPWRESAPADAAGTATGTANADRRRAGTVPPPSDGEPEDPKAWRPGPGAGSGAHPSRRDPQAIGRLGEQLVNRRGWRREMETATVVNRWQEIVGDQVAEHCEVETFADGELVVRTSSTAWATQVRMLIPQLERRIGEVAGPDAVTKITVLGPGGPSWKHGRFSVRGRGPRDTYG 262
230 1.000e-30UniRef50_A0A1M3EKQ6 Uncharacterized protein n=2 Tax=Cellulomonas TaxID=1707 RepID=A0A1M3EKQ6_9CELL  ali  37  14.................................................RPGQRSRAPLIAPPTAAGPDGRDPQPLGRIVGRLVNEHGWQGGLVAGQLQNRWAELVGPMVAENLRFVSFEAGLLVAQASSTSWRTQLVGMEQELLRAFAARLGEDVVLEVRVLGPSTPTFNRGPRTVRGRGARDTWG 151
231 2.000e-30UniRef50_UPI00082C9817 DUF721 domain-containing protein n=1 Tax=Corynebacterium provencense TaxID=1737425 RepID=UPI00082C9817  ali  41  66..........................................................KTRYDGRPDRSYRDPGVFGELVQREIRRNGWNRNFAVGTLKGNWAGIVGEDVARHTTVAMYKEKQLHIECDSTAWATNLRLMQSMILQTIARKVGPDVVAELRIYGPRPPNWRKGRYHVKGRGPRDTYG 196
232 3.000e-30UniRef50_A0A2N5XGN0 DUF721 domain-containing protein (Fragment) n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2N5XGN0_9ACTN  ali  42  1...............................................................SGARADGRDPLPLGAAVNRLISERGWEAPAAVGGVMSRWPQIVGAEVAQHCAPESYRERVLVVRCDSTAWATQLRLLAPRLVARLNEDLGQGAVRLIKVLGPAGPARSYGRLRAPGRGPGDTWG 127
233 3.000e-30UniRef50_X8CFK1 Uncharacterized protein n=5 Tax=Actinobacteria TaxID=201174 RepID=X8CFK1_MYCIT  ali  86  1.................................................................................................MLGNWTSVVGHQIADHAVPTALKDGVLSVSAESTAWATQLRMIQAQLLAKIAAAVGNGVVTSLKITGPAAPSWRKGPRHIAGRGPRDTYG 90
234 3.000e-30UniRef50_UPI00047DCCDE DUF721 domain-containing protein n=1 Tax=Actinomyces suimastitidis TaxID=121163 RepID=UPI00047DCCDE  ali  27  53...............PSDDVGDDEGLRALGRAADVDGDLTSVVTPSAQGETM----WRSQVGRAATRIRYMPVKSLRTTLRRAIEHNGWRQETGMGMVMQQWPHIVGTTVAQHCGVETFEGSTLIIRCTSTAWTKQLRLLLPTIERRIDEVVGPGIVTQVIIRGPLTPSWKKGAISVPGRGPRDTYG 220
235 3.000e-30UniRef50_A0A2W2F6U2 DUF721 domain-containing protein n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A2W2F6U2_9ACTN  ali  40  1.......................MAREKLAQAKADAERRGRLPRREP------------RRKRAGGRRDASDPQLFGTAIRELLAYRGWEQEIAVGGVFGRWRDIVGADLAAHTRPESFTDGEVVVSADSTAWATQVRLLATTLVKRLNEELGEGTVRRVKVQGPQRGPRPRGGLRVTGRGPGDTYG 153
236 3.000e-30UniRef50_UPI0009FC5F5F DUF721 domain-containing protein n=1 Tax=Corynebacterium sphenisci TaxID=191493 RepID=UPI0009FC5F5F  ali  39  112..PDPLAGRPRRDDAGAVVPGLGPVGERLAETGFFAEARDRAGTRIPEHLQGRGAGGPRVRRY-----RRNEPQPLGTVLIRQILDRGWAPQMARGMILTRWPEIVGEELAAQVRIDSFDEGTLLLRAASTAWATQLRYLQDRILARIAEEVGDGVVTRLRIIGPPAPTWRKGRYGVRGRGPRDTYG 291
237 4.000e-30UniRef50_A0A0J6DGJ6 RNA-binding protein n=11 Tax=Cellulomonas TaxID=1707 RepID=A0A0J6DGJ6_9CELL  ali  36  14........................AAAALGRAKESARRRGLRPGDAP-------RGARREVQLGDARPGGRDPRTVGEALDALVGQLAWSPGVTAGTIQARWAELFGAEIASHTQYVSFEAGVLTMRAESTAWATNLTWTVPTMLRTLADELGEGVVVQIQVQGPGGPGFGRGPRSVKGRGVRDTYG 169
238 8.000e-30UniRef50_A0A151DRM3 Uncharacterized protein (Fragment) n=2 Tax=Streptomyces TaxID=1883 RepID=A0A151DRM3_9ACTN  ali  40  2....................................................QKKQARRGGLRSGARADGRDPMALGSAINRLITERGWETPAAVGGVMGRWPQIVGEDVAKHCVPERYDERVLVVRCDSTAWATNLRLLAPTLVARLNEDLGHGSVRLIKVLGPGGPGGRYGPLRAPGQGPGDTYG 142
239 1.000e-29UniRef50_A0A1W9RR97 Uncharacterized protein n=1 Tax=candidate division KSB1 bacterium 4484_87 TaxID=1970772 RepID=A0A1W9RR97_9BACT  ali  24  6.........................................................................ETIGDALAKLLSQLGLEKEVQRSQLLVDWPEVVGEQIAKVTEAERIEDRILFIKVKHSVWRNELYFRKADLIKKLNKHAGQNLVKDIRF......................... 94
240 1.000e-29UniRef50_A0A1E7J0S3 Uncharacterized protein n=2 Tax=unclassified Desulfobacterales TaxID=1403365 RepID=A0A1E7J0S3_9DELT  ali  27  3.......................................................................KPALLGTILQQAIKASGIQVDLDAHRLWQQWKGIVGPAIAENTRPEVIRGQLLLVNVSSAPWMQQLQFLKPELIEKINETLGKKLVGDIRFKIGPV.................... 98
241 1.000e-29UniRef50_B1VDX5 Uncharacterized protein n=3 Tax=Corynebacterium TaxID=1716 RepID=B1VDX5_CORU7  ali  34  16...................................AEPATDSGSTGNTARTSSGVQRIKTRMDGRADRSYRDPGSFSALLSREIRRQGWEENVGVRRLMQDWEHLVGPTIAAHTRPVKFKNKFLHVQSDSTPWATQLRLIQATILSKIAQELGPDVVVELKIHNPDYGPRQTGRLRVQGRGKRDDYG 169
242 1.000e-29UniRef50_P35925 UPF0232 protein SCO3875 n=253 Tax=Actinobacteria TaxID=201174 RepID=Y3875_STRCO  ali  33  1MSADAPEPGPGQSPGERASGGPEPSGVDLARVALRAAREAARARGDAAQQKKQARRGGLR---SGARADGRDPMALGSAINRLITERGWETPAAVGGVMGRWPEIVGADVAKHCVPERYDERVLVVRCDSTAWATNLRLLAPTLVARLNEDLGHGSVRMIKVLGPGGPGRRYGPLRAPGQGPGDTYG 190
243 2.000e-29UniRef50_F8E091 Uncharacterized protein n=17 Tax=Corynebacterium TaxID=1716 RepID=F8E091_CORRG  ali  29  15........................ALAHLRKAGANPVVNSVSKGASEKKRQSYRKGKISTRLDGRADRSYRQPKRFGSLIMPEINRKGWSQQYAVGMIMNSWEELVGETIGSKTRPIKYDAETLHIQCDSTPWATQLRLIQTKVLQTITRRVGPDIVAELKILNPEFKRPGRGKFRVPGRGPRDDFG 179
244 2.000e-29UniRef50_A0A1Z8TBR6 Uncharacterized protein n=1 Tax=bacterium TMED46 TaxID=1986782 RepID=A0A1Z8TBR6_9BACT  ali  24  2.........................................................................QHIASALKXLIKSNGLQKGLDQQRAVDXWPEVVGESXNKNSEPLSVENGVLSIKTKNSAWSQELQLQKPQILEKLNKKLDKKVIKDIRFV........................ 91
245 2.000e-29UniRef50_D2RCN6 Uncharacterized protein n=8 Tax=Terrabacteria group TaxID=1783272 RepID=D2RCN6_GARV4  ali  31  25..............................................RKAERENNREKNAEQAWENFGKPGRDPKSFCGILKNFASESNWNSQLSIAKLRSSWYKVVGESIAKHCEISQVVNGVLIVRAQSTVWATQLSYLIPQLKEKINNNLENIEIKEIKVIGP...................... 143
246 2.000e-29UniRef50_D6Y207 Uncharacterized protein n=18 Tax=Actinobacteria TaxID=201174 RepID=D6Y207_THEBD  ali  35  35.......................................AEAKADAARRGRLPRTEPRRDGGARPQPRGSGDPQPFARAIRELLAARGWERQAAIGGVFGRWAEIVGPELAAHTRPVSFADGELVVATDSTAWATQVRLLAGTLVRRLNEELGDGTVARVKVHGPGTGPRPAGPLRVRGRGPRDTYG 183
247 2.000e-29UniRef50_A0A2E8GDE7 Uncharacterized protein n=1 Tax=Nitrospiraceae bacterium TaxID=2026770 RepID=A0A2E8GDE7_9BACT  ali  26  13..........................................................................PLSVAVNHFIRNCGLEGKLREYTLKDRWDEIVGEPISSHARPDTIRFGTLYVLVDSSAWLQQLTFLKPELIRKIENNMNENIIKDIIFRLGLQPPSR................ 109
248 3.000e-29UniRef50_A0A239NZC2 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=6 Tax=Streptosporangiaceae T  ali  39  104.........................REKLAQAKSDAAKRGQLPRREP------------RRKAYGPRRDSGDPQLFGRAIADLLADRGWEQPAAVGGVFGRWHEIVGPDMAAHTTPETFADGEVLVVADSTAWATQVRLLARTLVRRLNEELGDGTVQRVKVRGPQNGPRPSGGLRVTGRGPGDTYG 254
249 6.000e-29UniRef50_A0A2D5KC05 RNA-binding protein n=1 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2D5KC05_9FLAO  ali  21  3....................................................................RNKDEKPLKDLVNQMLRAYGLGTKLDEMSLVKSWEKVVGKMIAKHTSDIFFKEGKLYIELDSAPLRQELSYAKSKLIEKLNEEAGKKMVNEIIFR........................ 97
250 7.000e-29UniRef50_A0A1T3P7H1 Uncharacterized protein n=2 Tax=Streptomyces scabrisporus TaxID=159449 RepID=A0A1T3P7H1_9ACTN  ali  34  2......PSAPGNAGAAEPTRGIDLARAALTQARAQARTRHDLRQDQDRARRGLKR--------SGSGPDDRDPQPLRQIMGRLVSERGWQTPAAVHGVLQRWPEIVGAALAANCRPERFEDGELVVRAESDNYATHVRWLAPKLLARLNQELGDGTVTYIRVLGPAQERRRGQWRAQP......... 165
251 8.000e-29UniRef50_A0A2H0P7S6 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_49_13 TaxID=1973976 RepID=A0A2H0P7S6_  ali  26  6.................................................................KRPRLKNPLPVANILDRMFKNKGFGKKLVQYSVFEIWSDVVGSTIAAKTTPRKMQGDTLVVTTTSAAWANELSFMKPVILKKIQEKIPEIEIKDIRFT........................ 103
252 1.000e-28UniRef50_A0A1I2K4F4 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1I2K4F4_9BACT  ali  22  2....................................................................RRSNTQKLSEVLRDYIEENKLQKKLTEVDLIASWEQVVGKTIARYTESLRISNGTLFVKTSSPALRSELVMMKEQLKARLNEQAGEQLIKEIIFR........................ 96
253 1.000e-28UniRef50_UPI00093ED775 DUF721 domain-containing protein n=1 Tax=Actinomyces bouchesdurhonensis TaxID=1852361 RepID=UPI00093ED775  ali  34  134..............................................RQALEDTGTSWSRSPGMAAMRPRYQRANSLGAILARTISARSWDTPTKMGSVMAKWRDIVGPYNADHTHVETFEGHKLVVRAETTGWAKQLQLLLPTIERRIAEEVGAGVVEQVIILGPVAPSWKKGPYVVRGRGPREDYG 274
254 1.000e-28UniRef50_A0A0P1LZS3 Uncharacterized protein n=4 Tax=Candidatus Kryptonia TaxID=1855361 RepID=A0A0P1LZS3_9BACT  ali  30  2....................................................................RRKGPVLLGAVLDEFLKNIGVERKVKEGMVLERWNEVVGPYIAKVSKADRIENGVLYVKVINPSWKHHLFMFRREIIKKLNDSLKLDVVREIVFI........................ 96
255 2.000e-28UniRef50_UPI0009F54895 DUF721 domain-containing protein n=1 Tax=Actinomyces vulturis TaxID=1857645 RepID=UPI0009F54895  ali  31  4..................SSDDALAKRLLHQVRAQAWDKGLSRIPVRALSSKRDEQVNSVAPWDLALRRRQEITSLHHTSKKLTSERGWTAHLAAAHLLNSWSTIVGPTVAEHCVVVSLDEQTLMLKASSSSWAQQIRLITPSIQRQIDDLVGVGVIKKLIVHGPSQRSWTHGKRSLRGRGPRDTYG 202
256 2.000e-28UniRef50_X1KDD0 Uncharacterized protein n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1KDD0_9ZZZZ  ali  24  2...................................................................KRDSFPSPVGEVLGRVFSRRGISKKMKEMSVLGLWKEVVGKKIDRHTHPFSIKKGRLFVSVDNSGWLVQLTYLKDKIIAEFNKKEGGKPIKDIHFRLGEIKKSTKGKIRKP......... 112
257 2.000e-28UniRef50_I4MB05 Uncharacterized protein n=6 Tax=Gardnerella vaginalis TaxID=2702 RepID=I4MB05_GARVA  ali  29  26...............................................KAERENNRSVRADKAWENFGKPGRDPRTFCGILQSFASNNNWNKQLNIAKLRSSWNEVVGENIANHCEISQVINEVLIIRAQSAVWATQLSYLLPQLKEKINNNLSNIKIREIKVIGPGLGSWRR............... 153
258 2.000e-28UniRef50_C7QFM1 Uncharacterized protein n=2 Tax=Catenulispora TaxID=414878 RepID=C7QFM1_CATAD  ali  33  1MNPQPVDNGSGAEGGDPQDSGVDXXXXXXXXXXXXGKDNGAGW-------SGNRRRNSNSGQRSGSGPDERDPQLLSSAIPRMIEARGWSVPAAVGGVMGRWGEIVGSHISAHCTPVEFHDGVLMVRTDSAAWATELRMLAPQLLAKLNAELGAGAIATLKVVGPGGR................... 172
259 3.000e-28UniRef50_A0A0V8T977 RNA-binding protein n=5 Tax=Cellulomonas TaxID=1707 RepID=A0A0V8T977_9CELL  ali  40  38.........................................................PARPVSSGSAPGPRDPQPLAISAGLLARDLGWEPGLVVGDLVHRWAQIVGPQVADHCEFVSFTAGLLTVRASSTAWAANLRLLAPAMLARFDEALGSGVVVQVDVLGPVGHGFGRGARRVAGRGPRDTYG 167
260 3.000e-28UniRef50_A0A094KI71 Uncharacterized protein n=14 Tax=root TaxID=1 RepID=A0A094KI71_9DELT  ali  25  2................................................................RRRKQQTQLQSIGEVLFSALKKKGLNLKIEENALLKLWPKAVGPQIASKTQPDCLRGGILFVKTISSVWVQQLHFMKEEIRDKLNKLAGKNVIKEIRFLVGHTP................... 105
261 4.000e-28UniRef50_A0A2N6BV88 Uncharacterized protein n=1 Tax=Desulfobulbaceae bacterium TaxID=2053307 RepID=A0A2N6BV88_9DELT  ali  27  30....................................................................RRHKPDHISSLLGEMVERRHWQERFELHEVFTFWEKAVGKDIARHARPAKFRGKVLWLDVSDSIWMQQLQFLKTTLLAKINSQFDSVEVEDIRFQL-QLPKEPRVPLRQPGPGP..... 147
262 6.000e-28UniRef50_A0A2J6J6B0 DUF721 domain-containing protein n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2J6J6B0_9DELT  ali  23  3...............................................................RDKRPPMRQAASVGSLLQQLFQDKDMSDRLSRYQAWTVWDSVVGEQIARRARPLRFREGILEVRVDNAVWMQQLQMLKPKILQKLNAKLPHANIEDIFLRRGTLPQPETAPKATAPPA...... 121
263 8.000e-28UniRef50_A0A2E2UUE7 RNA-binding protein n=5 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E2UUE7_9FLAO  ali  20  2...................................................................KRKSNQQSLGDIIQDFLKQSGWERKLDEVNIMTEWDKVLGPTLAKYTEEVFIKNKKLHIRLNSSTLRQELSYKKSEIVKDLNAAVGKDVINDIVLK........................ 97
264 1.000e-27UniRef50_UPI000A0407FD DUF721 domain-containing protein n=1 Tax=Frankia symbiont subsp. Datisca glomerata TaxID=656024 RepID=UPI000A0407FD  ali  38  124..DGTQRNENEGGSGEQPARGADLARLVLARAKEDXXXXGAASGDGRSDPARRPARRPRLPGMAAPGREWVEPVTLGATVQRLLAERGWQDQATDASVLARWEALVGPNISARCHPVSLRDGELELAAESTAWATQLRLLSRQLLATLRTELGPDVVRRIIVRGPTAPSWRHGPLQAPGRGPRDTYG 324
265 1.000e-27UniRef50_A0A1B7LVH6 Uncharacterized protein n=2 Tax=Micrococcaceae TaxID=1268 RepID=A0A1B7LVH6_9MICC  ali  33  5..............EHDEQDQIDAAAAALQRVRQAAAEAGFRPG----MAGQHQRRRKKKRAAYDKPVQTAGPQPLGDVFSKFIAQRGWKEPVAVGSVLADWSSIVGEQIAQNAKVESFENAKLVLRASSTAWATQLRLLTPQLMHKFDERLGPGVITKLEIKGPGG-----SGYSRRGRG...... 162
266 2.000e-27UniRef50_A0A2E4JSA6 Uncharacterized protein n=17 Tax=cellular organisms TaxID=131567 RepID=A0A2E4JSA6_9ARCH  ali  25  2.........................................................................QHISRAIEKFLRKSGLEKGVAQQKALFVWSNVVGEKVAENTEAEKVDHGVLMVKTSTPAWRQELQLQKKDIIKKLNKELRKKVIKDIRFL........................ 91
267 2.000e-27UniRef50_G9PGG8 Uncharacterized protein n=4 Tax=Actinomyces graevenitzii TaxID=55565 RepID=G9PGG8_9ACTO  ali  31  119...............................................RRRQERHAEIVNGQPVSQARVYWRDPRSGKRELDGFFHRQGWEESLRIASVKVRWEEIVGKDMAENCSIYSFKNGRLVMRAHSTNWAQQLQLMMPQLEALFEREVGPGIVKSIKVRGPNAYTWRHGKLAVPGRGVRDTYG 260
268 3.000e-27UniRef50_A0A0F8YRH3 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8YRH3_9ZZZZ  ali  21  2.......................................................................RPRRIRRILNTILRRLGLEKRIKECAILSFWNDAVGESIASHTKPVKVYDGRMTVLVESSSWTQELTFLKSGIMERLNSTIGKKVIKDIYFKIGEI.................... 97
269 3.000e-27UniRef50_A0A1F9HY18 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_02_FULL_47_10 TaxID=1797880 RepID=A0A1F9HY18_9DELT  ali  24  2.................................................................SRKVMRQPEAISEILGNLLKRRGLARKMAQYEVFEIWEDVVGSTIAKQTTPQKMQGDILVVAVKSAAWAQELTFIKPLILKRIREKSPDAKIADIRFTAGRL.................... 103
270 4.000e-27UniRef50_Q47U19 Uncharacterized protein n=8 Tax=Nocardiopsaceae TaxID=83676 RepID=Q47U19_THEFY  ali  32  1MNGEHPAPERTDSPPPTPLRGVELARQALAKARAEAKARGAAPQGQDRKPQRSLV------------RSRGEPQQFGDAIRAWLIEHGWQEQVAIGGIFGRWSRIVGERLAEHVRPCSYADGELVVAVDSPAWATQIRAMAPQLVRKLNEELGHGAVRVIKVNGPGGYRTSRGQWRVR......... 173
271 4.000e-27UniRef50_UPI000DCE2525 DUF721 domain-containing protein n=2 Tax=Corynebacterium heidelbergense TaxID=2055947 RepID=UPI000DCE2525  ali  30  32......AGGKGPALPPQPTPAAQTGGGALPASEVSRGARAAGGSPGRLRARAGVRRYRRTRLDGREDRSYRDPAPAGSVLSREIRRHGWQHNIAAGRLVQDWSSIVGPEVAAHTHVLAYHERELIVQCDSTPWATQLRYMAPMVLASIAETVGSGVVEHLQINNPNYGPKSTGRLRWQGRGKRDDWG 214
272 4.000e-27UniRef50_A0A2E6JHP8 Uncharacterized protein n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E6JHP8_9BACT  ali  17  10...........................................RLGRCRSARDKPQQPKQQNNSSFEK----LEKLNTSIQNFLESYGLKKGVKQNSAILYWEEVVGKKISKNTEPQGVEHGTLTVSVSNPAWRQELVFKKEEIIKQLNKKIGENTIKEVRFI........................ 125
273 4.000e-27UniRef50_A0A0F2NC28 Uncharacterized protein n=3 Tax=root TaxID=1 RepID=A0A0F2NC28_9DELT  ali  22  12...........................................................................IAGVLPRLLRDNGWEKQIDLHSIFPNWRKLVGDEICEHAQPLKIERGVLWIEVENSSWLQQFQYEKLDLLDNLNRFLKLSTLNDIKMVLPKGETWKKVEKPLKK........ 115
274 4.000e-27UniRef50_A0A1W9X641 Uncharacterized protein n=2 Tax=unclassified Desulfobacteraceae TaxID=231684 RepID=A0A1W9X641_9DELT  ali  22  2................................................................NKKKKNREFVHIGNVLNKTLKRYRYGADAELTKVWKVWNSVVGEAIAENVQPAAFKGKLLLVHVSNPIWIQHLQFEKAVIIENINQALGKPLVEEMKFKVGPLR................... 105
275 5.000e-27UniRef50_A0A1Y1RED8 Uncharacterized protein n=1 Tax=Candidatus Cloacimonetes bacterium 4572_55 TaxID=1971726 RepID=A0A1Y1RED8_9BACT  ali  23  4...................................................................PRRENFTRIGSLFEDYFRQIGMFQRYKQGQVLAYWEEVVGERVARHTTPTSCRDRILFVEVDSPTWMNELQYRKRDIVTQINRFLNGSFIKDIRFVAPRG.................... 103
276 6.000e-27UniRef50_A0A0G0Y9S0 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A0G0Y9S0_9BACT  ali  20  2.........................................................................QKISGILSKLLKQYGLEGKMLEYTMADKWEAIVGNTIATHTCPAGIRYKKLYILVDSPVWVQEMSFYKDELIEKVNNYFGKKIINDVYLKTGNI.................... 95
277 7.000e-27UniRef50_F0R4L5 Uncharacterized protein n=14 Tax=Bacteroidales TaxID=171549 RepID=F0R4L5_BACSH  ali  21  2....................................................................KRNNTEQVGDVIRRLLRQEGLETPLNEYRLVEAWKDVVGPVIARYTQNLYIKNQVLYVHLSSSVLRQELSMSRTLLIRNLNTHVGAQVIVNIVFR........................ 96
278 7.000e-27UniRef50_A0A0X8JGX9 Uncharacterized protein n=9 Tax=Actinomyces TaxID=1654 RepID=A0A0X8JGX9_9ACTO  ali  39  8......................................................RGPGLPPGRGRPGPSPFDPRPGGKDLRRYADEHGWAGKLAIASVSVRWSEIVGPQIAEHAVIESFEVGRLTIRASSSSWAQQLRLLMPTIERSVTEELGGSAV-EIRVLGPAGPTWRHGRAARGGRGPRDTYG 141
279 7.000e-27UniRef50_A0A095ZB48 Uncharacterized protein n=1 Tax=Arcanobacterium sp. S3PF19 TaxID=1219585 RepID=A0A095ZB48_9ACTO  ali  25  10.......................LPLLALERMRQMARSHGWVKKYNPLNLTKTEKPSPGQEVGSGARPSRRDPKLFAVLMHRVMQDFRLDGRMSVADLHNRWEKIVGSRVAANCTIEKFDKGVLTVAAQSSSWAAQLQMLSGELEKRIAQEIGEGTVKEIRIVGPSSAKRRYG-RYVAGRK...... 179
280 8.000e-27UniRef50_A0A257B337 Uncharacterized protein (Fragment) n=1 Tax=Armatimonadetes bacterium JP3_11 TaxID=2012635 RepID=A0A257B337_9BACT  ali  27  1.....................................................................MREMQSVGSALQSLLQKLGLERQFRTYDALAHWSDIVGKQVAQVARPLRLDADTLWVAVKSHTWAQELNFQKGTILRRLNERAGEERFKEIRFLV....................... 95
281 9.000e-27UniRef50_A0A2I1M415 DUF721 domain-containing protein n=10 Tax=Alloscardovia TaxID=419014 RepID=A0A2I1M415_9BIFI  ali  23  41.............................................................AAQSFGQKGRDWVNFGTVLAAITSNPQWKNHMAVAHLYDDWAQIVGETIAQNSRVGRFHGSELTVFVNSPAWATQLGFMKEQMITKINEQIEGLEISDIRFIGPQPEPYKRKRYPR.......... 156
282 9.000e-27UniRef50_A0A2N6DMP1 DUF721 domain-containing protein n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6DMP1_9DELT  ali  34  4................................................................PRRPPMKKAAHVGGLLDQLLAKLGLEERLEQAKALVIWESVVGPQIAAHTRPLKIRDGVIEVCVDQPVWMQQLQLMKPQILGKLNAALGEAPLRDIKVTGRSGPSVRQS.............. 117
283 9.000e-27UniRef50_A0A2D9LDA8 Uncharacterized protein n=10 Tax=Bacteria TaxID=2 RepID=A0A2D9LDA8_9RICK  ali  25  5.........................................................................QQLKTAIKIFLRKSGLEKGVKQNTALLLWDEVVGENIAENTNPEKVEHGTLLVTVENSSWRQELVFKKKEIIDKLNNKIGKKTIKDIRFI........................ 94
284 1.000e-26UniRef50_A0A0M3QGB3 Uncharacterized protein n=3 Tax=Desulfuromonadaceae TaxID=213421 RepID=A0A0M3QGB3_9DELT  ali  21  3.............................................................TKRSERPRMKSAATAKSLILDLLRKRGFEEKIREYRAWELWDDTVGPQISARTKPVRIRDGILEVRVDHPVWMQQLQLLKPKILTRLNERLDGAVIKDLFLRCGAVEAKTEVPREPPGPP...... 122
285 1.000e-26UniRef50_A0A1F7F8Z2 Uncharacterized protein n=1 Tax=Candidatus Raymondbacteria bacterium RIFOXYD12_FULL_49_13 TaxID=1817890 RepID=A0A1F7F8Z2_9BACT :_  ali  27  3..............................................................MTRPRRRTAEPVQIKEIVADLLREAGYENAVKEQQVLTAWSEIAGAEIAKNSQPTEIRNMVCFIKVKNSVWRTQLSFFRESLVDKINAYAGKKIVTSIHF......................... 102
286 1.000e-26UniRef50_A0A2M6ZHB3 Uncharacterized protein n=3 Tax=Candidatus Desantisbacteria TaxID=1819803 RepID=A0A2M6ZHB3_9BACT  ali  23  17.....................................................................RREPEKIGDILKRVVRNLGIDARMREQTLFSIWNEVVGNKIAGHARPSHIRRGRLTVLVENSGYIQEYSFLKKELQRKLNAILDKAIIKEIVFRVG...................... 112
287 1.000e-26UniRef50_A0A1W9IWJ5 Uncharacterized protein n=3 Tax=Nitrospira TaxID=203693 RepID=A0A1W9IWJ5_9BACT  ali  28  8.........................................................................VSFGTILTSVAKQLGLETRLVEVRIQQQWPALVGEPISSHTWPVQIRFHKLYLLVENSVWLQQLTFLKPALLAKLNAEAGSELLTDIVLRVGEIPS.................. 103
288 2.000e-26UniRef50_A0A1E7H5C8 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1E7H5C8_9DELT  ali  19  5..................................................................RRKLKRPVALGEILQDVLRASKIDINLEMVKLCDLWDNTVGPVIARNAQPGAIKGGLLVVHVSGASWMHHLQFEKEELIQKLNDALGKAAISDMRFKIGRL.................... 105
289 2.000e-26UniRef50_A0A1F4Y3R4 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium RBG_16_48_11 TaxID=1802785 RepID=A0A1F4Y3R4_9BACT  ali  22  3......................................................................KEPEKLQTVLERIIKGKGWEKRLKEASILTSWEKLFSPPLSKIAKPLKIESGRLFLQVKEPVWKSELSFQKPEILKKLNQFTGSDVVKEIHFV........................ 95
290 2.000e-26UniRef50_A0A2E3RHU1 Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E3RHU1_9PLAN  ali  21  3....................................................................KKRGPIPIGNIVADLLSRKGLGQPQTLGEIEAIWGKVVGEAIAPMTHCGKIHHGKLNVVVTNSTIMQELMFQKQEILEAFNKKMQRDLVQDIRFRVGRLP................... 102
291 2.000e-26UniRef50_A0A1F9AT33 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_61_14 TaxID=1797834 RepID=A0A1F9AT33_9DELT  ali  24  2.........................................................................EKAGEILDHLFQRLNLKRPLREQGVFAVWDACVGETVAGHTRPASIQQGRLLVTVSDPAWMNQLQFLKEEIKQKLNSGLGRGVVREIRFRVGEIKRPEKPAPASSGSRP..... 110
292 2.000e-26UniRef50_X1BN46 Uncharacterized protein n=7 Tax=root TaxID=1 RepID=X1BN46_9ZZZZ  ali  24  3.....................................................................MKEFEDIGSIIGDVIENLNMKRKLNISNIFNCWEEIVGTEIYKKAKPKKVTAGVLYVSVTTSTWANELSLMSSQLIEKINSFIGEEVVKSIRFK........................ 96
293 2.000e-26UniRef50_A0A1G1H2F4 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RBG_19FT_COMBO_42_15 TaxID=1801709 RepID=A0A1G1H2F4_9BACT  ali  22  2...................................................................AREKPLTKISDVLLKIAKKFDLEIKIVEQTINKNWGKLVGERISAHTKPDAVSYRKLLVYVDSPAWMQQLMFLKEDIIKNINEAAGRQIIKDIKFQIGDI.................... 101
294 3.000e-26UniRef50_S7TZS1 Uncharacterized protein n=2 Tax=Desulfococcus multivorans TaxID=897 RepID=S7TZS1_DESML  ali  23  1..............................................................MTRKREPLKKPVHIADVLKNALTAYRAEGDTELMKVWSLWKGVVGHGIAENTRASAFKGNLLIVHVSSSAWIHHLHFLKQELISKLNDALGKDLVGDIKFKIGPL.................... 105
295 3.000e-26UniRef50_A0A0E3ZE87 Uncharacterized protein n=12 Tax=Hymenobacteraceae TaxID=1853232 RepID=A0A0E3ZE87_9BACT  ali  17  2.........................................................RYYKKKEEIDKRKADIQPIGESLKALMQAYRLDGKLSEVQLVQNWEKIMGKPIALKTQQLYFKDGKLFVRLTSAPLKHELNMSKSKVIEILNTEAGSNVVKDIVFL........................ 107
296 3.000e-26UniRef50_A0A2M7AFM7 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium CG07_land_8_20_14_0_80_40_9 TaxID=1973916 RepID=A0A2M7AFM7_9BACT  ali  29  2.................................................................PRAKVRSPQRLGDFLEGVLKEKGFLRRLKEEEVLGVWEEVAGKETALHTCPLRVKGGTLLVACSSSPWVQELTFLREKMVASLNEKIGEKVVKEIRFVV....................... 101
297 3.000e-26UniRef50_A0A0F9NHT2 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9NHT2_9ZZZZ  ali  27  4......................................................................KEPILIKEALERTIKEMGLRQGIEQCEAISCWSEAVGQKIAEKSKAHKIIKGTLYVKAKNPIWSQQLSLMSEDLKKKINEKMGNKVVKQIRFR........................ 96
298 3.000e-26UniRef50_W0EP24 Uncharacterized protein n=8 Tax=Bacteroidales TaxID=171549 RepID=W0EP24_9BACT  ali  14  2....................................................................KKQDALSIGEIISQFIAENKLEQKLDETQVMRLWPRIAGETVNAYTQSMHVHNRTLYVQLSSAVLRNELMMLRNDLLRRFNDEFGHPVIDNIVFR........................ 96
299 3.000e-26UniRef50_L0K7E7 Putative RNA-binding protein containing Zn ribbon n=1 Tax=Halobacteroides halobius (strain ATCC 35273 / DSM 5150 / MD-1) TaxID=748449  ali  29  2........................................................................AESIKKLLDDTLNKLGLSRRLKEEKVLNLWSQLIGDKIGAHTQAKYINCGVLFVTVDNSTWAHQLLFMKKNLIQKINQKMGQQIVKEIRFQVGKL.................... 96
300 4.000e-26UniRef50_A0A1F9F6S5 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_40_11 TaxID=1797858 RepID=A0A1F9F6S5_9DELT  ali  26  3.................................................................RRPLKSIPVSIDSFLEQFLKQRGWDTKLQEYKIWTHWETIVGPQLAKKCSPKHLKNGLLTLEVSQSTWMTQLQFIKPQLIDKIKTSFGVH-LKDIKLK........................ 99
301 4.000e-26UniRef50_A0A261EUJ2 Uncharacterized protein n=3 Tax=Pseudoscardovia TaxID=1302778 RepID=A0A261EUJ2_9BIFI  ali  27  35...................AAADRSRMPVAEAMGLDPTRPAEIFSRYCTELRKTDEERNLKARENFGKPGRDPVKITIAFSLLTRDPIWRRGLAVAQLSQHWSDLVGEGIAMNSTPVSFRDGVLTIKPKSTVWAQQLRLMAPQIAAKLRERVDGLDIREVHVAAANNITFRRGKWDVKGRGVRDTY. 202
302 5.000e-26UniRef50_E1YIN7 Uncharacterized protein n=1 Tax=uncultured Desulfobacterium sp. TaxID=201089 RepID=E1YIN7_9DELT  ali  19  1...........................................................................MGNILGNILNKFRMELGFETENISGIWKNIVGEAIYKNTKPAGFKGQTLLVNVSGSVWMQELQYYKKDIISKLNNEFGKEMVRDIKFKIGAI.................... 92
303 5.000e-26UniRef50_A0A1Z9LFF1 Uncharacterized protein n=3 Tax=FCB group TaxID=1783270 RepID=A0A1Z9LFF1_9FLAO  ali  23  2.........................................................................KHIHQVISRAIKKTGLEQVLNQQEVLDRWGEVVGKKISENSEAIKITNGVLSVKTKSPTWRQELQLQKTEIIKKINYELEKKIIKDIRFI........................ 91
304 5.000e-26UniRef50_B3QWU8 Uncharacterized protein n=3 Tax=Chlorobiales TaxID=191411 RepID=B3QWU8_CHLT3  ali  23  2...................................................................PYTDEPRSFGSVLEVLYKKLGLEGYAKEFKAVSVWGTVVGPHIARVSEVEKIVNGVLYVKVKNSAWRNELNFKKVTIIHQLNKHIGQELVIDIVFR........................ 97
305 6.000e-26UniRef50_E8WRX5 Uncharacterized protein n=7 Tax=Geobacter TaxID=28231 RepID=E8WRX5_GEOS8  ali  26  2..............................................................TSNKRPKMKRPAPVTDLLSSLLRGTPAELRLKEGRIWEVWDEAVGSKIASHAQPATFREGTLTLNVDSAPWLQQLTYLKKDLLAKVNEALEEELVKEIQLKGGKV--RKSSPIEVKKPAKR.... 120
306 6.000e-26UniRef50_A0A271IYA1 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A271IYA1_9BACT  ali  28  2...................................................................PSSNQPQSLGSVLSELVDRYGYRERFDAARAVEAWPEVVGEAIANVTEQVWMRHGTLHVKVRSSAWRHQLQFQRQQWRERMNQHLGREVVDEVVFR........................ 97
307 6.000e-26UniRef50_UPI000BA9AC68 DUF721 domain-containing protein n=1 Tax=Rubrivirga marina TaxID=1196024 RepID=UPI000BA9AC68  ali  23  5....................................KSTPRGGQRAGGVASGWEGDLACQRRSAAPVPSSNQPQSLGSVLSELVDRYGYRERFDAARAVEAWPEVVGEAIANVTEQVWMRHGTLHVKVRSSAWRHQLQFQRQQWRERMNQHLGREVVDEVVFR........................ 131
308 6.000e-26UniRef50_A0A087D884 Zn-ribbon-containing RNA-binding protein n=9 Tax=Bifidobacterium TaxID=1678 RepID=A0A087D884_9BIFI  ali  29  8.........................RLHLDQTKLAREVFERISRRGALLNDRQHLQQRREEAIENFGKPGRDPTELGNVMSTIAGNGVWSTNLKLAQLRNHWDQVVGPGVAAHSAVADFSGGVLTIRAESTVWATQLTYLIPQLTETIHGNLKGLTINEIRVTGPAVGYSRKWARR........... 158
309 6.000e-26UniRef50_A0A136P0J4 Uncharacterized protein n=1 Tax=Chlorobi bacterium OLB7 TaxID=1619898 RepID=A0A136P0J4_9BACT  ali  21  7........................................................................PNSIGSIIQQWLRDNGLDDKLKEQSVPTYWVEIVGETIAKHAIVDRIDKGTMFISVQSATWRNEIMLRREEIQRKVNERFGADVVQEIVVR........................ 97
310 6.000e-26UniRef50_A0A1H1CJW0 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=2 Tax=Thermostaphylospora ch  ali  40  2..............DDVTARGLALAREKLAQAKADAARRGRMPRREP------------RRKTGGTLRETGDPQPFARAIRELLAARGWEREVAMGGVFGRWAQIVGPDLAAHTKPESFADGEVVVSADSTAWASQLRLLAPALVKRLNEELGDGTVRRVRVRGPQGHRPSGGLRARGGRGPRDTYG 163
311 8.000e-26UniRef50_B3EJI2 Uncharacterized protein n=4 Tax=Chlorobiaceae TaxID=191412 RepID=B3EJI2_CHLPB  ali  20  2...................................................................KSSRTPRKITDIVDDIYSIYGMNQAKEEHQALRVWNHIVGDTIAKMTEVEKFVQGVLFVHVMNPSWRTELSFRKKNIISRLNKALGKNLVKDIVFK........................ 97
312 8.000e-26UniRef50_A0A2K2VRW5 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium TaxID=2049433 RepID=A0A2K2VRW5_9DELT  ali  23  3....................................................................KKRRPEHIGSILKQLFQDQKWENNIEAALPLLRWQEIVGSQLARQTQPEFLKDGVLQVRVENSVWLNHLRFLAEELRQKLNEELPSLEIKELRFRQGTLDKVQSGRPST.......... 111
313 1.000e-25UniRef50_A0A1F4RBU2 Uncharacterized protein n=1 Tax=candidate division KSB1 bacterium RBG_16_48_16 TaxID=1798559 RepID=A0A1F4RBU2_9BACT  ali  24  2....................................................................RKTPTKTLGQSIEYLLAELGIDRKVKACRVMQLWPQIVGEKIDQVTKPIKVQDKILFIKVQSATWKTELFFHRQEILQKIKKDVGDDIIEDIRL......................... 95
314 1.000e-25UniRef50_A0A2P8CV38 Uncharacterized protein DUF721 n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A2P8CV38_9BACT  ali  27  4.........................................................................VSVGDALSSFLKSARLKARIDEIRVKGEWEKIMGNTIAKYTRDVSLKDGVLHITTDVAPLKQELQFGKAQIVANINEYFKEQVVKDVVIR........................ 93
315 1.000e-25UniRef50_A0A1Y0BNI6 K203 n=1 Tax=uncultured bacterium TaxID=77133 RepID=A0A1Y0BNI6_9BACT  ali  24  3.....................................................................RKDPERLGDVLETSLKRLDLNARLDDYGIWTIWNQTVGAAIARNAQPEKIRNGTLMVKVSSPVWMQQLQFMKEMIADKLNEQLQSTVVKNIFFVVGRI.................... 102
316 1.000e-25UniRef50_A0A1Z8YY19 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1Z8YY19_9ACTN  ali  21  2.........................................................................EKLNTSIQGFLESYGLKKGVKQNSALLHWDSVVGKKISQNTEPQNVEHGTLTVSVTNPAWRQELVFKKDQIIKKLNKKIGENTIKEVRFI........................ 91
317 1.000e-25UniRef50_A0A2J6ICK1 Uncharacterized protein n=2 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2J6ICK1_9BACT  ali  26  10...........................................................................LKDLLEQLVKAYRWSGKMDEMKVRDSWEKVVGNMIDRHTSELKLKDKTLFVKLDSSALRNELMMARTKIAESINKELGKKIVDDIIFR........................ 97
318 1.000e-25UniRef50_A0A2H0PDK6 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_47_16 TaxID=1973975 RepID=A0A2H0PDK6_  ali  27  6.....................................................................KTKLETISDILSNFAKDPTAQKKLKQYSVFAVWNDVVGARIAKHTQPVKMMDLTLVVRVESAAWLQELQYMKPQILKKIHAHVEPSLVQDIRLEIGRL.................... 104
319 1.000e-25UniRef50_A0A1Q7VSN0 Uncharacterized protein n=1 Tax=Catenulispora sp. 13_1_20CM_3_70_7 TaxID=1805055 RepID=A0A1Q7VSN0_9ACTN  ali  44  50.....................................................RRRGSTPGQRSGSGPDERDPQLLSAALPRMIEDRGWAVPAAVGGVMGRWGEIVGSHIAAHCTPVEFNDGVLTVRTDSAAWATELRMLAPQLLAKLNAELGAGAIANLKVVGPGGR................... 175
320 2.000e-25UniRef50_A0A2D5UKA7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2D5UKA7_9BACT  ali  21  8..........................................................................SLKDVLQMLFDSYGWTEKMDGIRVVNLWEKVVGGIIAKHTTNKYVKDGIFYVAVDSSVLRNELYMKRSSIVKELNDEMGKKVIKEIIF......................... 95
321 2.000e-25UniRef50_A0A235BTU5 Uncharacterized protein n=3 Tax=unclassified Bacteria TaxID=2323 RepID=A0A235BTU5_9BACT  ali  17  14.....................................................................MSRPISIKDVLPNVLSTLGIKKGIERQKAIFVWDKVVGRDIRRHTKPRYVRGKKIWVDVDDPIWIQQLSFLKSKILKKLNGELGGKHIVDIIFK........................ 107
322 2.000e-25UniRef50_A0A2G6FT37 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2G6FT37_9DELT  ali  23  10...........................................................................LAAIIPDLARENGWQGRLEQYSLFTHWEKIVGQEIAKHAAPLKIVQNVLWLEVGSSAWMQHFQYQKLTILQTCNEFLPGLPLTDIRFVGPSNPQEKEPEL............ 113
323 2.000e-25UniRef50_A0A2N6EJS4 Uncharacterized protein n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6EJS4_9DELT  ali  22  3...............................................................RSKRAPMRKAISIGSLLQQVIDDQGMNDRLSRYQAWLVWDQIVGEQIARRARPLRFREGILEVRVDNPVWMQQLQMLKPKILQKLNDRLPNARIEDIYLRRG-----KHAPRTV.......... 111
324 2.000e-25UniRef50_A0A1F8Y979 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium GWC2_42_11 TaxID=1797816 RepID=A0A1F8Y979_9DELT  ali  23  2..................................................................RPKLQKPIPISAVLEGSFARLGIKRRVNEFAILKDWGRLAGSSISKFAVPVKLVGKTLYVAVSTSVWMEELKYVKPDLINKINENLGKDCVSDIIFKLGSI.................... 102
325 2.000e-25UniRef50_A0A0S7WUL4 Uncharacterized protein n=3 Tax=candidate division TA06 TaxID=1156500 RepID=A0A0S7WUL4_9BACT  ali  22  4........................................................................PEHIRAILERVVKGLDLERGMREQGAVLSWDEVVGERVACCTRAVAIRRSVLFVEVESSAWMHELVFLKPMIVKRLNERLGAGTVRDIVFSV....................... 95
326 2.000e-25UniRef50_A0A2M6YW87 Uncharacterized protein n=1 Tax=Ignavibacteriales bacterium CG07_land_8_20_14_0_80_59_12 TaxID=1974045 RepID=A0A2M6YW87_9BACT  ali  20  1..............................................................MAASRRARSNPKQIGNVLEKLFRDLGLNRRLKQYDVLTQWGEIVGETLARVSEAERIDNGILFVRVKSSAWRNELALRKREIIKKICSRTPRGTIKDIRFQ........................ 101
327 3.000e-25UniRef50_A0A1V4RN76 Uncharacterized protein n=1 Tax=Candidatus Latescibacteria bacterium 4484_181 TaxID=1956174 RepID=A0A1V4RN76_9BACT  ali  25  2..................................................................RESKGHPSSISELLRELISDLGIEKRLAETRVCQIWKEVVGEGLSRETAVVSIKRGRLFVKVRTPSWRNELTFLRSQIISKLNRRVGKKVVREIVFL........................ 98
328 3.000e-25UniRef50_A0A087CHL4 Uncharacterized protein n=3 Tax=Bifidobacterium TaxID=1678 RepID=A0A087CHL4_9BIFI  ali  28  8.........................RLQLDVRKLPARTFERFTKRSLSLRLLRERS---ERAWFNFGKPGRDPNSLAGVVTGIVQQEDWTPHLKIAQLRNHWDSIVGTAIAQHSSVVGYEHGELTIRTESTVWATQLTYLVPQLKNTISQRLGDLPVERITVTGPHSQSFR................ 150
329 3.000e-25UniRef50_A0A1C0ACT5 RNA-binding protein n=4 Tax=Halobacteroidaceae TaxID=53434 RepID=A0A1C0ACT5_9FIRM  ali  25  5...........................................................................IENILNKTLNKLGIEEKIKEKRALDLWSEINGSEIIKHTEAKYINQGILFVVVDSPVWAHQLLFMKREFISKINSKMGKPIVKDIRFQSGKV.................... 96
330 4.000e-25UniRef50_A0A1F4MME2 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1F4MME2_9BACT  ali  21  1.....................................................................MSSAKPLNQLIHQFLESIGIGGKIEENLAMVYWDSVVGKEISQHTNPFKIAEGILYVKVNDPVWRNELQFFKNEIIEKLNTKMGKHLVKDVKF......................... 93
331 4.000e-25UniRef50_A0A1G0WHY7 Uncharacterized protein n=1 Tax=Ignavibacteria bacterium RIFOXYC2_FULL_35_21 TaxID=1798452 RepID=A0A1G0WHY7_9BACT  ali  26  7......................................................................KSPQPLKEVFNNLISGLGWEELVKQERVPELWKEIVGDRIAEKAGYVRFENGILFIRVDSSVWRSELFLRKESFKNEINKRYGSKIVDEIVIR........................ 99
332 4.000e-25UniRef50_A0A1V5S7S4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin302 TaxID=1852811 RepID=A0A1V5S7S4_9BACT  ali  24  2....................................................................RKEHIQPIGDILKEYLKVFRLQSKIDETTLITSWKQVLGPSINSYTRDLSIRNKILYVSLTSSALRNELMLMRTRLIKELNDVVGTDVIEDIKFR........................ 96
333 4.000e-25UniRef50_B4S938 Uncharacterized protein n=2 Tax=Prosthecochloris TaxID=1101 RepID=B4S938_PROA2  ali  23  2....................................................................SKRSPRKLDAIVHEICHDLGMDEAYEQHRTIKAWPEVVGESIARVSKVRHCKDGVLYVRISNPSWRNELHFQKRSVIDKLNKFIGKELVRDIVFQ........................ 96
334 4.000e-25UniRef50_UPI0009F8FFE9 DUF721 domain-containing protein n=1 Tax=Desulfosarcina cetonica TaxID=90730 RepID=UPI0009F8FFE9  ali  18  4.............VEDNAKLGVDFVWDTSYR----PWHSGKIRIPDAVAQISTDASKRNLHPMEKKNPPKIPFTPIGQVLKSIIDQCRAENKDGILQLIEVWDKTIGPPISDNARPFAIMGSHLVVHVSSSAWLHQLQFLKNTLLEKFNHGLPGGPITDIKFKIGR..................... 152
335 5.000e-25UniRef50_A0A2M7XRP3 Uncharacterized protein n=3 Tax=Candidatus Marinimicrobia TaxID=62680 RepID=A0A2M7XRP3_9BACT  ali  23  9.......................................................................RPKTLGEALLEAFRHFEIEKPIEQHRALYLWDNVVGDQIARVTTPQKIEKNVLFVAVDSPVWRNELIFLKRNIIRDLNQVLTGNAIKDIKFT........................ 100
336 6.000e-25UniRef50_A0A2N6E306 Uncharacterized protein n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6E306_9DELT  ali  27  2..............................................................KRPERPSLRKPLNAGSVLSDLLTGAGLGDKMKGYRAWQCWDEVVGPQIADHARPKRLRNGVLEVSVDQPIWMQQLRLMAPQILERLNRALKGEIVKEIYWRRGK-PTRPIEELSEPDRP...... 119
337 6.000e-25UniRef50_A0A0A8WTR3 Uncharacterized protein n=2 Tax=Geobacter sp. OR-1 TaxID=1266765 RepID=A0A0A8WTR3_9DELT  ali  26  4................................................................PSRPKMKRPVAVSQLLATLFSGTPAENRLKEGAIWEVWNSAVGAQIASRAKPVAIRNGVLTIVVSSAPWLQQLNFMKSQIREKLNEATGEELVKDIYLKAGTLRKDPAVRRPLPKKKPR.... 124
338 6.000e-25UniRef50_X5DE24 Uncharacterized protein n=6 Tax=Bacteroidetes TaxID=976 RepID=X5DE24_9BACT  ali  15  2....................................................................RRSNTQSLSEVLKQYIEENRMERKLKEVDIVQGWENLLGKTIARYTRNIYIRNRILYVEITSAVVKNELFLMREEICRRINENAGDEMITRIVFK........................ 96
339 7.000e-25UniRef50_A0A1Q6DNQ5 Uncharacterized protein n=1 Tax=Desulfobulbaceae bacterium DB1 TaxID=1920419 RepID=A0A1Q6DNQ5_9DELT  ali  22  8.....................................................................MSKPTPIRTLLSSLIAAKGWEGRVELNQVFLFWDELVGPDIAKYAQPHLIRKDILWLRVSDSVWMQQLQFLKIMLLEKLNQRLKKARFVDLRFQLDSTLGEEIAGRSEPPR....... 118
340 7.000e-25UniRef50_I9FYQ4 Uncharacterized protein n=28 Tax=root TaxID=1 RepID=I9FYQ4_9BACE  ali  17  2....................................................................RRNDAEQIGEMIRKFFRQNALEAPLNEYRLIQAWKDVVGPAITKYTSNLYIKNQILYVHITSSVLRQELMMGRDLLVKNLNKQVGAQVIVNIIFR........................ 96
341 7.000e-25UniRef50_A0A1G9XV50 Uncharacterized protein n=2 Tax=Dendrosporobacter quercicolus TaxID=146817 RepID=A0A1G9XV50_9FIRM  ali  22  4...........................................................................LRDILPSTLQNLGLAKRYNTESAILHWPEIVGKDIAVHAVPTSVQRGTLLIAVNNSVWCHHLSMMKEEIIYKLNAFIGEKAIIDIRFQAG...................... 93
342 7.000e-25UniRef50_F7NFV9 Uncharacterized protein n=1 Tax=Acetonema longum DSM 6540 TaxID=1009370 RepID=F7NFV9_9FIRM  ali  27  5..........................................................................SLKDILSGTLKQIGIKEKYNSQSVIVHWGSIVGQDIASQAYPTHVRNQILFVAASSPVWAHHLSMMKEQILEKIRQFTGQKSIKDIRFHAGKLPA.................. 101
343 7.000e-25UniRef50_A0A2M7F5J9 Uncharacterized protein n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A2M7F5J9_9BACT  ali  17  3......................................................................RTPVAAGRTVKAILKEFGMDWIIERHAIWSCWEEIVGPEVASKTRPEFFSGKCLFITVEHSSWMHQLNFLKDPIIRNINRKLGFEAASEIRFRIGTLDGPEPRPQKTRSEKIR.... 115
344 8.000e-25UniRef50_A0A2G9ZR70 RNA-binding protein n=1 Tax=Desulfobacterales bacterium CG23_combo_of_CG06-09_8_20_14_all_52_9 TaxID=1973984 RepID=A0A2G9ZR70_9DE  ali  26  12........................................................................PVPLNKVLNQVLASCRRKPDLGLTRIWDHWDVVVGTVTAENAQPAAFKGRLLIVHVTSSVWIQQLCFMKDEIKKKINEALGEPLLDEIKFKIGPV.................... 106
345 8.000e-25UniRef50_Q3AP18 Uncharacterized protein n=4 Tax=Chlorobium/Pelodictyon group TaxID=274493 RepID=Q3AP18_CHLCH  ali  19  2...................................................................KQRKEPKPFGLLISGVYRSLGLEEPYQQFKALQVWREVVGEAIAEVTTLERFTAGQLYIKVNNAAWRLELNFRKRDIIQRLNKELGSPLVQEIIFR........................ 97
346 9.000e-25UniRef50_A0A0J7HR24 Uncharacterized protein n=1 Tax=Chitinispirillum alkaliphilum TaxID=1008392 RepID=A0A0J7HR24_9BACT  ali  28  2..................................................................RRKKKQPEKLGNILESILQERGYATICREYEVVSRWSGVVGERIAKETECNRVEDGRLYVKVFSASWRQELVYLKEQLLDTIRRETGCDSIKEIIF......................... 97
347 9.000e-25UniRef50_A0A1W9N5V0 Uncharacterized protein n=1 Tax=Desulfobacteraceae bacterium IS3 TaxID=1934248 RepID=A0A1W9N5V0_9DELT  ali  23  4..................................................................KKNTNDFVHIGNIIPNALKNYRRQPDSGMGKVWEVWNDAVGKMIAENARPSAFKGKLMIVNVSSSAWIQNLQFEKDEIIKKVNAGLGKRQVQDIQFKVGPL.................... 104
348 9.000e-25UniRef50_A0A101GGT4 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A101GGT4_9BACT  ali  21  5.......................................................................DATPLKKVIEELLRIYNLKSGLTQVKIYQIWARVVGRHIAKSTRDIRLKNGILFIQLDSPALRNELSFAKTKIIRNLNRQLGEEIIQDIVFV........................ 96
349 9.000e-25UniRef50_J1FFN6 Uncharacterized protein n=43 Tax=Cytophagales TaxID=768507 RepID=J1FFN6_9BACT  ali  17  2.........................................................RYYKKKEEIAKRKADVQTIGDSIKGLLKAYRLQGKLNEVDLVQRWEEIMGKPIALKTKELYFKDQKLFVRLTSAPLKHELNMSKSKVVELLNRAMGDEVVKEVVFL........................ 107
350 1.000e-24UniRef50_I9LAZ1 Uncharacterized protein n=4 Tax=Pelosinus TaxID=365348 RepID=I9LAZ1_9FIRM  ali  21  2.........................................................................QKMKDIVSNTIRNLGLQKPYNDQSVIVHWSEIVGDDIAANAYARSVQQGTLMVSVNSSVWSHHLSMMKESIIDKINQFIGYKLIFDIRFQAG...................... 93
351 1.000e-24UniRef50_UPI00068658B1 DUF721 domain-containing protein n=1 Tax=Desulfosarcina sp. BuS5 TaxID=933262 RepID=UPI00068658B1  ali  19  1.....................................................................MKKPVHIGSFINEVLFSCRSEIENGIFEIWDMWANLVGEVIAKDSKPAAFRKKILIVHVSDSAWIQQLQFLKKDIIKSINDFFGKRLVEDINFRIGPV.................... 98
352 1.000e-24UniRef50_F8A1L8 Uncharacterized protein n=19 Tax=Micrococcales TaxID=85006 RepID=F8A1L8_CELGA  ali  30  6.PPAAEAPRPLRELVELTPERL-VAAAALGRAKENARRRGLRPGEAPRRRADVQLG--------DARPGGRDPRTVAETLDSLVGQLAWAPGVAGGTIQARWAELLGAEVAARASYVSFDAGVLTMRADSTAWATNLRWAVPTMLRTLATELGEGVVLQIEVQGPGGPGFGRGPRSVRGRGVRDTYG 182
353 1.000e-24UniRef50_A0A1F9KCN6 Uncharacterized protein n=11 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9KCN6_9DELT  ali  20  9.........................................................................EKVGEILDQSLKRLELAGQLSDYGVWPIWNDKVGPTIARNAQPEKIRNGTLFVKVSSPIWMQQLHYMKDTIADKLNQELGREAVKNIFFFVGKVEAESVGEQTAEP........ 114
354 1.000e-24UniRef50_A0A1G1EFZ2 Uncharacterized protein n=1 Tax=Nitrospinae bacterium RIFCSPLOWO2_12_FULL_45_22 TaxID=1801687 RepID=A0A1G1EFZ2_9BACT  ali  23  12.........................................................................QPVGKVLKETLRELQLEKGIDQGKIWLVWEEAVGKTVAQVAQPDSIKFKTLFVKVTDSIWLHQLSCYHDLIVNKINDQVGAEVINKIHFKLGEVR................... 106
355 1.000e-24UniRef50_D9RYX4 Uncharacterized protein n=4 Tax=Firmicutes TaxID=1239 RepID=D9RYX4_THEOJ  ali  20  2.........................................................................EKIKNILLKILKKTDLERRLREAMVFVHYEEMVGEKIARVSKPVFFRGDTLFIGVESPIWAHQLLFFKSDIINRINSRFSPPLVKDIRFQVCRVDGRPES.............. 101
356 1.000e-24UniRef50_A0A2T6L9A4 Uncharacterized protein DUF721 n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A2T6L9A4_9MICO  ali  45  2...............................................................................VGRLLREKGWTEDVSVGGVMGRWREVVGPEIADHCTPETFEDKVLVVRADSTAWATQLRMLAPTLIRRMAEEIGEGVVEEVTVLGPAGPGFRRGPRSVRGPGPRDTWG 109
357 1.000e-24UniRef50_A0A2P8C7Y8 Uncharacterized protein DUF721 n=2 Tax=Prolixibacter TaxID=314318 RepID=A0A2P8C7Y8_9BACT  ali  24  2....................................................................RRSETQSLGSVIKEYLKESRMDGKLAEVEAVNSWETIIGKTIARATTNIYIKNGVLYVHLRSSIVRNELFMMRHQIVDAMNNHVGRQVIREIILR........................ 96
358 1.000e-24UniRef50_A0A1G5AYT8 Uncharacterized protein n=1 Tax=Desulfoluna spongiiphila TaxID=419481 RepID=A0A1G5AYT8_9DELT  ali  19  12.................................................................RREKKDGATHVGDILSKHMGTLAGRADLELLSLWKTWTEAVGEEVARHTRPKAFKGALLLVTVDSSVWIHHLSMMKDEIMARINTQLGEDTLREIRFSIGHVEEDGRG.............. 119
359 1.000e-24UniRef50_A0A2S8LNG9 Uncharacterized protein (Fragment) n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2S8LNG9_9MYCO  ali  75  1.............................................................................................................IADHAIPTSLRDGVLTVSAESTAWATQLRMVQAQLLAKIAAAVGDGVVTTMKIQGPVAPSWRKGNRSVPGRGPRDTYG 78
360 1.000e-24UniRef50_UPI000881A7B6 DUF721 domain-containing protein n=1 Tax=Sporolituus thermophilus TaxID=608505 RepID=UPI000881A7B6  ali  30  3..........................................................................RLGETIGPTLEKLGLAKKFKAQSVIYHWREIVGDDIAAHARPAAVERGTLILVVTSSVWSHHLSTMKQVLLDKINAFLGDKVIVAIRFQAG...................... 93
361 1.000e-24UniRef50_A0A2G6FYN9 Uncharacterized protein n=1 Tax=bacterium DOLZORAL124_64_63 TaxID=2044883 RepID=A0A2G6FYN9_9BACT  ali  26  2................................................................NRRGESTGPQPVSSILGDVLKNCGLQERFDERSPLLSWPEIVGAKIAEHSRAVDITDGVLILEADHGVWRQEVSLLVPMIIQKFNALHGVGTVTEIRWRNRPGQSRKRFPR............ 112
362 2.000e-24UniRef50_A0A2E8GWT9 Uncharacterized protein n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2E8GWT9_9BACT  ali  22  2.........................................................................RSLKQALNDFIGRADIDKPIAQGSALLMWDEIVGPKVRKNTEATAIESGVLIVRSTNAVWRQELQLKKRKIIEKLNKKIGNEIVKDIRFL........................ 91
363 2.000e-24UniRef50_UPI0009D6BD24 DUF721 domain-containing protein n=2 Tax=Sporomusaceae TaxID=1843490 RepID=UPI0009D6BD24  ali  25  11....................................................................KERRMQPLSSVLAQAIRKMNIAKPFAMHSLICHWRQLVGDDIADHSQPQKVEFGVLVVTVDSSVWTHHLTLLKSDILKKIHQYTGEKLISDLRFQAG...................... 107
364 2.000e-24UniRef50_A0A2E8Q2C4 Uncharacterized protein n=1 Tax=Nitrospinae bacterium TaxID=2026769 RepID=A0A2E8Q2C4_9BACT  ali  26  14..........................................................................PLGRILNRSFKSMGIDFKIAQQKVIDQWLEIVGEPIDSVSKPRYFKFRTLFVNVSDSMWLHQLAFMEDQIKGKINKSMGRKLVQKIYFKIGEL-SASKPKKPLKKEDSRDLYG 126
365 2.000e-24UniRef50_A0A2H0XRZ9 DUF721 domain-containing protein n=1 Tax=Candidatus Marinimicrobia bacterium CG08_land_8_20_14_0_20_45_22 TaxID=1975524 RepID=A0A  ali  23  4..........................................................................SLGDALQKLFRKYDIDKSIRQNQAMDTWNQVVGRTISIHAVPEKVAFSKLFVRVDSPAWRNELSYRKIEIMKKINKKLHGEIIKEIVLR........................ 92
366 2.000e-24UniRef50_A0A2E8SG22 RNA-binding protein n=3 Tax=unclassified Flavobacteriaceae TaxID=61432 RepID=A0A2E8SG22_9FLAO  ali  17  4.......................................................................DAKKIKSILGEFISKNALTDGIDSARIQESWRELMGENIDAYTKKISLQQDILVVKLTSSILRQELSYGKDKIIEMINESLGKDKVRDIRFV........................ 95
367 2.000e-24UniRef50_A0A2A4TYN7 Uncharacterized protein n=1 Tax=Rhodospirillaceae bacterium TaxID=1898112 RepID=A0A2A4TYN7_9PROT  ali  21  2....................................................AKKATPKPKGIIPSDRRGRSPRALSQTINKLTKSMLGRHGLTKGTLLTKWVDIIGEAMAEYTIPEKISGGTLHLRCSSGAHATQLQHQEPQILDRINTFFGYQAIVRIKLIQAPLPHKTRPRRKTPKPLSKD... 140
368 2.000e-24UniRef50_A0A1W9TH26 Uncharacterized protein n=2 Tax=unclassified Desulfobacteraceae TaxID=231684 RepID=A0A1W9TH26_9DELT  ali  23  2................................................................QRKTKYGPPVAIGRILPRVLQSCRGHSDQTLIRVWDLWDAAVGAVIAADAQPEAFKGKILIVKVSSSTWIHHLQFLKKDIIVKINDALGQDLVEEIKFKIGTI.................... 104
369 2.000e-24UniRef50_Q8KA82 Uncharacterized protein n=4 Tax=Chlorobiaceae TaxID=191412 RepID=Q8KA82_CHLTE  ali  25  5....................................................................KAKPPRELGGIIADVFCKIGMTEAYDEYKTLHAWKNVVGETIAKVTSVEKMKDGNLYVKVKSPSWRMELNFRKRDITKRLNKAVGYEMIRTIIFK........................ 99
370 2.000e-24UniRef50_UPI000A011954 DUF721 domain-containing protein n=1 Tax=Mycolicibacterium holsaticum TaxID=152142 RepID=UPI000A011954  ali  79  1.............................................................................................................MAAHATPTTLNEGVLTISAESTAWATQLRMVQAQLLAKIAAAVGDGVVTSLKIVGPVAPSWRKGPYHIAGRGPRDTYG 78
371 2.000e-24UniRef50_A0A1F8XSC9 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F8XSC9_9DELT  ali  22  14....................................................................SKKDPAKVDSILAASFPNLGIAAKLKEYKLLKAWKECVGPNIAKRAAPTRLIGGTLYCAVSSSPWMTELNYQKREIIERLNRTLGESAVKEIILRVGEV.................... 113
372 2.000e-24UniRef50_A0A1V6ELI5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin090 TaxID=1852803 RepID=A0A1V6ELI5_9BACT  ali  23  2....................................................................RRKNTQRLAEVLDEVLKNQQLRGKLNETAAIRLWPEVVGKALAEHTDNLYFKHSVLHVHVKSAIIRNELMLIRPQLLKRLNEKIGSQAVKNI........................... 93
373 2.000e-24UniRef50_E4TNS6 Uncharacterized protein n=2 Tax=Marivirga TaxID=869806 RepID=E4TNS6_MARTH  ali  19  3..........................................................KKKNPHPASIRKSEATPLGQVINEMFDAYHLNRKVDQTQVVNLWPKIMGKAIASRTKGVFMKDSKLFVTVESSALKQELHMSKERIIYLFREELGKEVVKEIVLL........................ 107
374 2.000e-24UniRef50_A0A2M9DW07 DUF721 domain-containing protein n=3 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A2M9DW07_9DELT  ali  23  6...................................................................KKKPGLTSIGNILSNSLHAFRGEKDACMTEVWGIWKSAVGDNIAENAGPAAFKGGTLLVHVTSSTWLHHLGFLKNEITQKVNAALGQEMVTELKFKIGDITGNDPFPASRKPR....... 118
375 2.000e-24UniRef50_A0A1I1FDQ9 Uncharacterized protein n=1 Tax=Flexibacter flexilis DSM 6793 TaxID=927664 RepID=A0A1I1FDQ9_9BACT  ali  22  6..............................................................WNKHAPRKNGARPLGDVIDELLNVYKLRGKLNETQIVDAWPKVMGAAIANRTASTFIRNQILYVKLTSAPLRQQLSMHKSNIISMLNESVGAEVIRDVIFQ........................ 107
376 3.000e-24UniRef50_A0A1E7IQM6 Uncharacterized protein n=2 Tax=Desulfuromonadales TaxID=69541 RepID=A0A1E7IQM6_9DELT  ali  20  1.....................................................................MKQAAKVANLLKQVLGDKGLEDRLSRYQTWLIWDKLVGKQIALRARPLRFRQGVLEVQVDHPVWMQQLQMLKPKILEKLNQQLPDAEITDIYLRKARTPTAKQQPATEP......... 109
377 3.000e-24UniRef50_A0A2A5A3H9 Uncharacterized protein n=3 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2A5A3H9_9BACT  ali  24  2.........................................................................QSLKQAISSLLKSAGIDQPIEQNKALIIWGDVVGESIASNTEAKEVKHGILIVKVSTPVWRNEIAMRKREILKKLNAELGSTAIKNIRLT........................ 91
378 3.000e-24UniRef50_A0A1M7YFX7 Uncharacterized protein n=2 Tax=Desulfopila aestuarii TaxID=231440 RepID=A0A1M7YFX7_9DELT  ali  21  11.........................................................................KRMAAILPGVLRDRGWQAQMELHSIFLQWAKVVDETVSAHAQPLKIVKGTLWVEVENSAWLQQLQYQKVSVLKSINDFFQEKKISDIRFVLPQPPKEHKVRFAAPPP....... 122
379 3.000e-24UniRef50_A0A1M6E8J2 Uncharacterized protein n=2 Tax=Desulfuromonadaceae TaxID=213421 RepID=A0A1M6E8J2_MALRU  ali  25  3...............................................................RKDRAPMKKAERVGPLLKKVLGDRGMEDRLNRYQAWLIWDQVVGKQIAERARPLRFRQGILEVQVDHPVWMQQLQMLKPQILQKLNQQLPNANISDLFLRKAPTP................... 107
380 3.000e-24UniRef50_G2GB87 Putative Tra3-like protein n=3 Tax=Streptomyces TaxID=1883 RepID=G2GB87_9ACTN  ali  28  2...........TDTTAPQLSGVDLARVAFLAAKESARKNGGATESRTPRPRSRQEGGRQTS-------DGRDPRGLAAVIQGLITDRAWEAPTVGGSAVDEWPAIAGPRLAGHVRAVKFRAGELEVQVDSPAWFTQLRLEKPALLARFAEALGTDVVKDIVRSRPGAAGGDLASERPAARG...... 166
381 3.000e-24UniRef50_A0A2E4G3A0 RNA-binding protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2E4G3A0_9BACT  ali  22  2....................................................................PNKEEKPLKELVDKMLRAYGLSHKLDEMDLIKNWEKLVGKMIARHTTNIYLKDRVLCISLDSAPLRQELSYAKSSLIQRLNEASTKNLIDDIKI......................... 95
382 4.000e-24UniRef50_D8F0D9 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=D8F0D9_9DELT  ali  23  2.........................................................KKRPEKSVRKRPKSELIPVGDVIHSLMTDGTLPYRPDDVEIWRVWKEVVGGTYAENSRPSKIRKKQLTITVSDSIWLQELTFYRETILEKINLKLGRKAVTSIKITVGSL.................... 111
383 5.000e-24UniRef50_A0A1Z8NCD7 Uncharacterized protein n=1 Tax=Planctomycetaceae bacterium TMED10 TaxID=1986833 RepID=A0A1Z8NCD7_9PLAN  ali  19  2....................................................................KKRGPVPIGNIVADVLAQRGLGRPQATIQLDQIWXEVVGSAIAPMTHCGKIHRQQLNVIVKNSTVMQELTFRKQEIIQKLNTRTPXYPIKDIRFRVGQXPNR................. 103
384 5.000e-24UniRef50_C7R4R0 Uncharacterized protein n=10 Tax=Micrococcales TaxID=85006 RepID=C7R4R0_JONDD  ali  43  39...................................................RPSSVAQRDDAVSGAARTRRDPQLLGEALGTLLTERGWTADVAVGNVVARWAEIVGTEIAEHSTAEQFVDGVLFVRAHSSAWATQLRFLAANILAAIARDVGEGVVEELRVVTPDARTGSKGRLRVQGGRPR.... 170
385 5.000e-24UniRef50_A0A2H6EXA5 Uncharacterized protein n=1 Tax=bacterium BMS3Abin05 TaxID=2005713 RepID=A0A2H6EXA5_9BACT  ali  19  1.....................................................................MKRPYELGTVINKVLRDLHIEKKVYQSQALVVWNEAVGEKISKISKPERVVNGKLFVRVDSPGWRIELIHLKGSIIKRLNTRIGVDAITDIIFI........................ 94
386 5.000e-24UniRef50_A0A0S7BR23 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A0S7BR23_9BACT  ali  22  3...................................................................KRTTNNQSLRQVIEELIEAYRLSDKLNQARVISLWDNVVGKMIARDTTHLYIKHKTLYVKLNSPALREELRYAKSKLIKSLNKAAGAEVIEDIAFI........................ 98
387 5.000e-24UniRef50_C0QAH3 Uncharacterized protein n=3 Tax=Desulfobacteraceae TaxID=213119 RepID=C0QAH3_DESAH  ali  26  2.....................................................................KQKLTPLGSILSKVLDNLRPSSDLDMTRIWDLWDEALDQTVAANSKPGAFKEGVLIVHVSSSVWIQHLRFMEKDLKAQINLALGRPLVKELKFKIASLHS.................. 101
388 5.000e-24UniRef50_A0A1F3QBV2 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3QBV2_9BACT  ali  20  8..........................................................................SLKEVIDKLLKVYKLDDKLAERRLISSWDSVMGEMISKHTKDLYIKNKQLFVTLDSSALRNELSLAKTKIIKMLNDATGQNVINEVIFK........................ 96
389 6.000e-24UniRef50_A0A2M7WHH9 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium CG_4_9_14_3_um_filter_46_8 TaxID=1975520 RepID=A0A2M7WH  ali  19  2................................................................RKSRSHGGFSPIGDILNAQLSSIGLFEKLREQGAIMRWEEIVGEGLARYTKATRIHDHCLFVKVDSPILRNELTFLKPELLEKIKIQIPESTIEDIKFR........................ 100
390 6.000e-24UniRef50_A0A0S8DGR5 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A0S8DGR5_9BACT  ali  19  8...................................................................KETKRPVKISRLLSSVFEHKKWRSKLELHRVFQFWDSVVGKEIAAVAQPSLIRGHVLWVKVADSVWMQHLHLQKMLLLEKINQNLHEEKIIDMHFQLNSSLTPQPKPEPT.......... 117
391 6.000e-24UniRef50_A0A2G6FGA9 Uncharacterized protein n=1 Tax=Desulfobacterales bacterium TaxID=2044940 RepID=A0A2G6FGA9_9DELT  ali  19  49....................................RGRSGAGIPGRREGHQMARHPETGKPLHPAYLKPARFTPVGSVLAEILESCRKSGGGDLEDILSAWEAICGPAIAANTRPESLRKKTLTVHTTGSVWIQQLAFLKQDLICNINGRLERNAVSDVRFRVGPV.................... 179
392 6.000e-24UniRef50_A0A1F9J4Y0 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_02_FULL_55_12 TaxID=1797883 RepID=A0A1F9J4Y0_9DELT  ali  17  3............................................................QRPRRPRRTGSDA-TISSVLDATLGHLNLGARLREFRLKKLWPDCVGEAIAKRACPERLMGTVLFCSVESSPWMTELNYQKTIIIGRLNETLGPGAITEIVFRAGQVKGRKARKPEVPTRP...... 122
393 7.000e-24UniRef50_A0A2E4EFC5 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E4EFC5_9FLAO  ali  15  8..........................................................................TIKDLIQKMLKSYQIEDKVQETELRQSWEKLMGSMIDKHTVQLAIKNEKLYLKVDSPVLRQELSYGKSLIIEKVNDHYGKAVIKDVVLR........................ 96
394 7.000e-24UniRef50_A0A2E0FIE2 RNA-binding protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E0FIE2_9FLAO  ali  22  2..................................................................GKRDSNMSSLEDSIKRLLKAYKLSDKMIEIDVVKAWPEVMGPLIASKTEEVFLKDSVLLVRLNSSALRQELSYGKPQIIKNMNLYLGHNHIKDVILK........................ 98
395 7.000e-24UniRef50_A0A1V4RUE9 Uncharacterized protein n=2 Tax=unclassified Desulfobacteraceae TaxID=231684 RepID=A0A1V4RUE9_9DELT  ali  20  3...................................................................KDSNSMTPLKDIITDLFKEKTLPFNIKDARIWMVWDEIVGPSISKNAQPSGINDKKLKVIVSNPIWLQELQFTEESIRNQLNRKLGRKAIRKIDFRVG...................... 100
396 7.000e-24UniRef50_A0A229VVY0 Uncharacterized protein n=4 Tax=Bifidobacteriaceae TaxID=31953 RepID=A0A229VVY0_9BIFI  ali  33  24...........................................RYTQRAAGIAKRKERAEEAWLNFGKPGRDPNTLGAVLAGIAKRDHWRPHLMIAQLGQHWDQVVGAGIARHTSVASYNRGVLTIRAESPVWATQLTYMIPQLKEKIASRLEGMPIDRIVVTGPRADTVRHG.............. 153
397 8.000e-24UniRef50_A0A2N2LC19 Uncharacterized protein n=11 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2N2LC19_9DELT  ali  28  11.........................................................................QPVGEILFAALKDKGLGAKLEENALMKLWPKAVGSQIAAQTQPDSFRAGTLFVKTTSSVWVQQLHFMKEDIRRKLNELAGKTAVREILFTVGHRP................... 105
398 8.000e-24UniRef50_A0A101GB41 Uncharacterized protein n=1 Tax=Atribacteria bacterium 34_128 TaxID=1635291 RepID=A0A101GB41_9BACT  ali  15  4......................................................................NQPKHIAEIMQQFFKERNWGQRIEGYNLLDCWVDILPPKIALNTKPIKIQNDTLFLMVKNNIWAQEITLRKGEIINTINKKIGKILITNIVVKI....................... 97
399 8.000e-24UniRef50_A0A2A4QI56 RNA-binding protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2A4QI56_9BACT  ali  17  4..........................................................................SIKDSIKEFLQTHNLEEKLMEVQLRNSWEKLMGKTIADHTTKIYIKDKKLHLRFDSPALKQELTYAKEKVIDSINKEFESEVVTEIVIR........................ 92
400 9.000e-24UniRef50_A0A1G1H516 Uncharacterized protein n=3 Tax=Nitrospirae TaxID=40117 RepID=A0A1G1H516_9BACT  ali  22  66..........................................................................SVSSILEGLARRLGLESKLLENRLRRDWVAIVGEPIASNTWPDQIRYKKLYLLVHNSVWLHQLTFLKPTLIQKLNTVAGTEVVTDIVLRVGELP................... 159
401 1.000e-23UniRef50_A0A0S8KAV3 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium SM23_81 TaxID=1703428 RepID=A0A0S8KAV3_9BACT  ali  29  1.........................................................................MSLGQVLHSLLRNWGVDEKVRERQAVALWSKTVGSQIAENTEAVGVEDGRIFVRARSSTWKTELVFVKPEIIDRLNHAVGKKVIRDIIFVSDSWGS.................. 96
402 1.000e-23UniRef50_A0A1V5YX97 Uncharacterized protein n=3 Tax=unclassified Candidatus Hydrogenedentes TaxID=1046981 RepID=A0A1V5YX97_9BACT  ali  18  2....................................................................KKSELEHIGDILNRMKKTTPLGLTLEQAQIWEHWTELVGEHLAPHCRPYDIRDGELRIMTDSTVWMHKISYVKWDLLRRINRMAKKELVSDIYFMLDSDETEKKGRKKRKP........ 112
403 1.000e-23UniRef50_A0A2E7U3P8 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E7U3P8_9BACT  ali  17  5......................................................................RGPVQVGSLVPDVLEQHGVKDQIKRMTVLDLWPEIVGEHVASVTQARGVSERTLFVEVSTSAWLMELNMMKSEFLSEVNRHLEEVSLERIIFVLGE..................... 100
404 1.000e-23UniRef50_A0A1M4SZJ3 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1M4SZJ3_9BACT  ali  20  2....................................................................RKSNTQSISAVLREYVSAMKFDRKLKEVDVVQSWETLLGKTIASYTRNIFLSKQVLYVEISSSVVKSELVMMREEIRRRLNEHAGEEIVKKIVLK........................ 96
405 1.000e-23UniRef50_A0A1F5RH97 Uncharacterized protein n=1 Tax=Candidatus Edwardsbacteria bacterium GWF2_54_11 TaxID=1817851 RepID=A0A1F5RH97_9BACT  ali  22  1.....................................................................MKKLETVGDILSRVLKSLEIDQRMDETRALTAWPEAAGPKIAANTRAVSVIRGRLMVEAKSPAWVQECTLLKVRLKGKINQLIGAEAVKDITFKVGP..................... 97
406 1.000e-23UniRef50_A0A098S272 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A098S272_9BACT  ali  16  4....................................................................RGNNQTTLKEALKAMLEHYKLKGKLNQSRIRHQWEEMMGPSIANYTRDIKLYQGKLFIIIDSAPLRQELSYGKEKIKRLLNEQLGEEAIQEVIIR........................ 98
407 1.000e-23UniRef50_A0A1W9S7V3 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium 4484_95 TaxID=1970781 RepID=A0A1W9S7V3_9BACT  ali  22  21..........................................................................KIGELVKKALKSAGIAERVEKQQAIVFWPEIVGPEIAQKTSAIRIEKDILIVKVVSATWRNELVFFKKEILKKIGKRIGNGKIKDIYF......................... 108
408 1.000e-23UniRef50_UPI0004253E98 DUF721 domain-containing protein n=1 Tax=Actinospica robiniae TaxID=304901 RepID=UPI0004253E98  ali  32  36...............................................RPQRGAAARRAGAQKRSGSRADDRDPQLLQATIGRLMAEHGWETPVAVGGVVHNWAEVVGERIAEHCVPVSFAEGVLTIQADSPAWAVEMRNLSPQLAQRLNETLPGGAVKRINVLGPARPR.................. 161
409 1.000e-23UniRef50_A0A1V5PHT1 Uncharacterized protein n=1 Tax=bacterium ADurb.Bin363 TaxID=1866927 RepID=A0A1V5PHT1_9BACT  ali  29  3..........................................................................SIKDLIEGAFDNPHIAAKARENMIFPFWSVIVGPKIAAHAKPYKLENGILKVIVTSSTWSQQLSFMKDQILRGYLDMIGEELVRDIRFQIGRLPDTKKG.............. 102
410 1.000e-23UniRef50_A0A1V5LPP6 Uncharacterized protein n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A1V5LPP6_9BACT  ali  30  3.....................................................................RDDSQHISRGLAQLVHQLGLEQRLKQQRVIDQWPQLVGEKIGRISRPERLQDGVLYVRVASMTWRTELLFQKQTILANISSAMGEGLVKDIRFI........................ 96
411 1.000e-23UniRef50_A0A1F8WG06 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium GWA2_45_12 TaxID=1797805 RepID=A0A1F8WG06_9DELT  ali  18  3....................................................................KKSSLTKASHIIEETLKNLKADRSFKVYPIWKQWPQIVGETIAAKCEATYVQGKILVVTVTNSVWMNELGFQKRQILEKIKELIPESTVEDIRFQ........................ 97
412 1.000e-23UniRef50_A0A0R2VIU1 Uncharacterized protein n=2 Tax=unclassified Sphingobacteriales (miscellaneous) TaxID=203473 RepID=A0A0R2VIU1_9SPHI  ali  21  6..................................................................RVRRSNEQDIGEVLKDFFKAFKIDGKVNEIRIKEVWEEVMGKTMARYTSDVRLHNGQLKVFINSAPLKHELTYNKDVIIQRINEAFGEEIVNKLII......................... 101
413 1.000e-23UniRef50_A0A1W9WWW8 RNA-binding protein n=1 Tax=Desulfobacteraceae bacterium 4572_89 TaxID=1972445 RepID=A0A1W9WWW8_9DELT  ali  21  3.................................................................RKEKNSNLIHISDILNSALGKYRPARDTDMTQIWDIWDAAVGRPIAMNAKPDAFKDGYLTVNVSSSAWIHQLKFLEKEMISNINKNLGKTLIKKIRFKIGKIHS.................. 106
414 1.000e-23UniRef50_A0A1W9P3R5 Uncharacterized protein n=1 Tax=Candidatus Cloacimonas sp. 4484_209 TaxID=1968525 RepID=A0A1W9P3R5_9BACT  ali  23  2.........................................................................KRVGKILEKVIKDLGIYKRFNEQKSLLYWNESVGDRISGKTKPLYAKNGKLIVEVENNVWMNELSFLKPEIIKKINQKIGSNAIDDILF......................... 90
415 1.000e-23UniRef50_A0A1V4MJX8 Uncharacterized protein n=1 Tax=Firmicutes bacterium ML8_F2 TaxID=1775675 RepID=A0A1V4MJX8_9FIRM  ali  21  2.........................................................................KQVGSLVEKMLKNCGLWQGYQQHLLVENWEQIMGPALSEVTRAEKLDHGIIWVSVKDSVWSYHLSLMKTQLIDKLNRYTGNKMVRDIFFVI....................... 92
416 1.000e-23UniRef50_UPI0009784CC5 DUF721 domain-containing protein n=1 Tax=Chlorobium sp. KB01 TaxID=1917528 RepID=UPI0009784CC5  ali  18  3....................................................................RTKDPKKISSVVGAMCQSLGLTEAYEQYKTLQIWNSVVGEAIAGATSIERFTGGQLFIQVKNPSWRMELNFRKQDIRNKLNAALERPIVEEIIFK........................ 97
417 1.000e-23UniRef50_A0A0N0D6J0 Protein containing DUF721 n=2 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A0N0D6J0_9DELT  ali  20  4..................................................................KKAKQEPLHIKSIVEGLMKKYSNTKGADLFQISEIWESVVGKTIANDARPWKIKGKELEIHVSGSVWLHQLNYMKADMIQKLNDRIGDTAIEKIRLKIGNI.................... 104
418 2.000e-23UniRef50_X1JCY9 Uncharacterized protein (Fragment) n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1JCY9_9ZZZZ  ali  24  3........................................................................PSRVGSVLERVFKNLGIDKKVRQLKALSQWREVVGEKINLHTRPLAIRKRSLFVLVDSSPWLAQLSYIKHEIISEFNRRYGEGVVENIYFRLGEVKKAKSGKTRA.......... 107
419 2.000e-23UniRef50_D1NWD2 Zn-ribbon-containing, RNA-binding like protein n=3 Tax=Bifidobacterium TaxID=1678 RepID=D1NWD2_9BIFI  ali  28  23...........................................RLSKRAGMLSDRRARNERAFEEFGQPGRDPNAFGGVMAQIAQRNGWLPYMKTAQLRMDWASVVGDLIAQHTWVQGFVDGVLYIGVESPAWATHLQYMMPDLYRVVPQRLQGLDITDIRIS-GNQQRTRKGKAH-PKRFPG.... 160
420 2.000e-23UniRef50_A0A0C2EGZ0 Uncharacterized protein n=4 Tax=Desulfuromonadales TaxID=69541 RepID=A0A0C2EGZ0_9DELT  ali  26  6..................................................................RGRMFRALPLGEILEQVLKERGLSDRLHKYRAFSCWARAVGPQVAAQTQPLRIRDGILEVRVAHPVWMQQLQLLKPRILARLAEYLGPGVINDLYLRQGRI.................... 106
421 2.000e-23UniRef50_A0A0U1KRL4 Zn-ribbon-containing, possibly RNA-binding protein and truncated derivatives n=6 Tax=Sporomusa TaxID=2375 RepID=A0A0U1KRL4_9FIRM  ali  18  3..........................................................................RIKDVMPSTLKSLGVTKQYNAQSVIVHWQEIAGEEIASHAWPISIQRGIMLLAVNNSVWSHHLMMLKSGIINKINAFLNEKMVIDIRFQAGDLR................... 96
422 2.000e-23UniRef50_A0A1Z5SG63 Uncharacterized protein n=1 Tax=Chitinophagaceae bacterium IBVUCB1 TaxID=1985173 RepID=A0A1Z5SG63_9BACT  ali  28  34..........................................................................SIGDALKLLMEKNGWKPKAVELRLRDEWEQIAGKTIAKYTRNLYLSGATLTIYTDVAALKQELLLAKPQLAATINEYFGEEVVREINIK........................ 122
423 2.000e-23UniRef50_A0A098LED0 Uncharacterized protein n=2 Tax=Sporocytophaga myxococcoides TaxID=153721 RepID=A0A098LED0_9BACT  ali  19  3.........................................................KKPEKIKTPTSRNSDVASLKDCIDDLINVYKLRGRLSEAEITGNWEKIMGKTISSRTEEIYFKDKKLFIKINSAPLKNELSFSKNKIIEKINEAVKSDVVSEIIFL........................ 108
424 2.000e-23UniRef50_A0A1F3NSV2 Uncharacterized protein n=4 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3NSV2_9BACT  ali  21  2....................................................................RRSKTISLAEAMKDYIKEMNLEGKLNEIGLINSWEETVGKAIASRTSKVYIKDQVLYVHLTSSVVRNELLMLRQALKEKLNEKAGCEVIRDIVLK........................ 96
425 2.000e-23UniRef50_Q9WZT8 Uncharacterized protein n=12 Tax=Thermotogaceae TaxID=188709 RepID=Q9WZT8_THEMA  ali  22  4...........................................................................LRQLLDELSTKQPLFFELKIKMLLSEWDKIVGPVIARHTKVEKVENGTVYIVCDDSLWMTELTMQKDRLLKILNERSGKELFRDIKFRRGKV.................... 95
426 2.000e-23UniRef50_A0A2M7SHV3 Uncharacterized protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2M7SHV3_9DELT  ali  21  3..........................................................................RIGSVLEDALRELKYNTKLKEHLVLEVWDEVVGEYIAKQTQPESIRDNKLFVRVSTLPWIRQLESLKQMIIERLNRRVGKTVLKEVQFSLSETPGPK................ 99
427 2.000e-23UniRef50_A0A2E2BJG2 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2E2BJG2_9BACT  ali  20  2.........................................................................KSIKTVLNTYLFKAGLESGIKQQQAVSLWPKAVGKKISDKTSVQDVKHGILIVHAESSAWAQELQLKKKEILSNLNSALKKNIIKDIRFV........................ 91
428 2.000e-23UniRef50_A0A2E7QCQ9 Uncharacterized protein n=3 Tax=unclassified Rhodospirillaceae TaxID=41296 RepID=A0A2E7QCQ9_9PROT  ali  20  4....................................................................KRFEIRTIGASVAKLTKPIFGKRGFGQGEIVTEWPNIAGKTLASHTLPEKIHEGTLHLRIDSAGLALELQHLEPQLIERINTHFGYRAVASIKIIQGPIQRKEKPEFRVKK........ 121
429 2.000e-23UniRef50_A0A1H3ZJV0 Uncharacterized protein n=3 Tax=Desulfuromonadaceae TaxID=213421 RepID=A0A1H3ZJV0_9DELT  ali  26  2..............................................................KRSDRPPMKHAEKVSFLLKRILGQPGFGEQLNRHQAWLVWDQLVGEQIAARARPFKLRQGVLEVQVDHPVWMQQLQMMKPQILEKIAAKIPNAGITDIYLRQPQTYSPKKTPEPQPWEG...... 126
430 2.000e-23UniRef50_UPI0006E1E5E8 DUF721 domain-containing protein n=1 Tax=Streptomyces diastatochromogenes TaxID=42236 RepID=UPI0006E1E5E8  ali  31  20.TGAHPAPEQTPAAGDPSASGADLARIMLRRAKADAKNRPVI-------------SKPKTRQRSHPRGDGRDPNPLGGIIKQLVVDNQWERGKAGGNLKNAWPSLVGEAQAAHWKADAYDEGILRVICDSPAWAASLRLMAPQMITKINGKVPGKPLRGLDVQTRTGHTSR................ 179
431 3.000e-23UniRef50_UPI000A32A9C7 DUF721 domain-containing protein n=1 Tax=Hugenholtzia roseola TaxID=1002 RepID=UPI000A32A9C7  ali  22  38......................................................................RNPISLNEAISQFLKAYGLDKHLEEQKIVAAWHQVLGKTVSKHTQQIALKEGTLFVKIEAPALKNNLSLMRNQIIERLNQQAECQRLKEIVFL........................ 130
432 3.000e-23UniRef50_Q1JX89 Uncharacterized protein n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=Q1JX89_DESA6  ali  22  3...................................................................KRSSGKKSLSNIIEGLFSQLGIADKIEQHRVWLIWKECVGPQIAAQASPLRIRDNILEVRVSHPVWMQQLQLLKPRLLERLNAELGDTPLKDMFFRRGKP.................... 105
433 3.000e-23UniRef50_A0A0B7ICK4 Uncharacterized protein n=7 Tax=Capnocytophaga TaxID=1016 RepID=A0A0B7ICK4_9FLAO  ali  19  8...........................................................................LSSVIKQIIQQNKLEYGLHKVEVQEIWARIMGISIAKYTKSVELKGDVLYVELSSPALSEELTYGKETIVRSINEEIGKEVVKKIVFR........................ 95
434 3.000e-23UniRef50_A3U9N3 Uncharacterized protein n=121 Tax=root TaxID=1 RepID=A3U9N3_CROAH  ali  15  3...................................................................KRTNEHLSIADALKEFVDKNKLQKGLDKVQVRDVWNDQMGPAIAKYTTNIKLDRDTLYVQLSSSVLREELSYGKQRIIDNLNETLGKTLITKLILR........................ 98
435 3.000e-23UniRef50_UPI000DA5F3D3 DUF721 domain-containing protein n=1 Tax=Massilibacillus massiliensis TaxID=1806837 RepID=UPI000DA5F3D3  ali  18  2.........................................................................EKIKEILPKMVTGLGIHKKYKAQMAIFHWEEIVGKDIAAQSSPIQIEYDVLLLSVNNSVWCHHLSMMKADIIFKVNQFIGEPFVKDIRFR........................ 91
436 3.000e-23UniRef50_A0A2D7PK87 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=A0A2D7PK87_9DELT  ali  24  23.............................................................TPARGRKRQGQPKVLGTVVGQVLDELGLDVAAAAWKIGEHWESAVGPEVARHSRPLGLRGKVLEVAVETSVWSHHLQLQRHQILEALRDRLGEEAPRDLRFRVGYTP................... 129
437 4.000e-23UniRef50_B2A2Z0 Uncharacterized protein n=1 Tax=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) TaxID=457570 RepID=B2A2Z  ali  22  2.........................................................................QGIRNDLKKFLAKSGLLKKFYQEKAMNYWVDVVGEEIATNCQPKVFQGKKMIVVCSNSIWIQELSMRKKNLIKKLNEKVGKTVVTDIKFVTGQIP................... 96
438 4.000e-23UniRef50_C0GI70 Uncharacterized protein n=1 Tax=Dethiobacter alkaliphilus AHT 1 TaxID=555088 RepID=C0GI70_9FIRM  ali  18  2.........................................................................KTIATVLDQALKRLPNAKKIKGQMMIDAWPHVVGGQIAKKTMAVSFENGILFVWVNDSVWAQHLALQKKQIIAQLNRYAKTRALTDLRFQAGGKRPSLSGE............. 102
439 4.000e-23UniRef50_W5IHL4 Uncharacterized protein n=1 Tax=Scardovia inopinata F0304 TaxID=641146 RepID=W5IHL4_SCAIO  ali  28  26...........................................RYQRLFKPKIDYALRNEKARDSFGQKGRDPKQLGSALEKLFSGQDWKKNLMLAKLHNQWSLVVGEHIGSHTEVGSYRNGLLIIKADSPVWATQLTYMVPNLKKVIGKRLPGLPIDAIKITGPQTARKKYRGRSQAGR....... 167
440 4.000e-23UniRef50_N1JKV2 Uncharacterized protein n=8 Tax=Mesotoga TaxID=1184396 RepID=N1JKV2_9BACT  ali  17  6.........................................................................RTIGQIFNDLAKSSSLFRKIRVFELNKDWEEIVGEPIANHSSIVDFSEGTLIIRVDDGMWLNEMKLREKILLERMNSSLGVEAIKRIRFRIGR..................... 98
441 4.000e-23UniRef50_A0A2N6F5U5 Uncharacterized protein n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6F5U5_9DELT  ali  20  2................................................................GKPSKSKQVLQINSLLEQILADKGLDSKLKKYKTWSIWDDVVGPQIARHAQPLRIRDSVLEVRVAHATWMQQLQLLKPRILKELNDRLGDKTLSDIYWKRGDI-SIEQEPVQPKQRP...... 117
442 4.000e-23UniRef50_UPI000697EDEC DUF721 domain-containing protein n=1 Tax=Nitriliruptor alkaliphilus TaxID=427918 RepID=UPI000697EDEC  ali  24  41.APKPPRTDQTSEVRKAGAADRDMYLYERKRARHARERAELDRRAYDPAAPDPDAEWTIPDDNESGLARTHAPSPVGDALQQFLERRGWGERLTGATASQRWEDIVGADLAARCEPVRLAGGTLVVRAESQVWAAQLRYLLPQLAANANDVLGGHQVRDVRLVVGPL.................... 206
443 4.000e-23UniRef50_F4C7T4 Uncharacterized protein n=36 Tax=Sphingobacteriaceae TaxID=84566 RepID=F4C7T4_SPHS2  ali  24  7.........................................................................KTLKEAISQYLDALKLRRKFDETSILAAWPDLMGTAIANRTRQLFIRDKKLFVRVESAVIKNELILMRSQIIGKLNEYVGRVVIEDVVIL........................ 96
444 5.000e-23UniRef50_A0A1F5RJA7 Uncharacterized protein n=1 Tax=Candidatus Eisenbacteria bacterium RBG_16_71_46 TaxID=1817856 RepID=A0A1F5RJA7_9BACT  ali  27  2.........................................................................EPAGGVLARVLRDLGLERDVLGWKAVQEWPRLVGARVARHARAVAYREGTLHVEVEGSAWMHELGFLKRELIRKINQQLDSGVVRDVRFVLPHGGGWK................ 99
445 5.000e-23UniRef50_A1AN07 Uncharacterized protein n=5 Tax=Desulfuromonadales TaxID=69541 RepID=A1AN07_PELPD  ali  22  4........................................................................PRPMADLLQEGVAIAGLAGRLRDVEIWRHWPEVVGPVVASRSQPLRIINGTLTVVVSSGPWMQELSFLKGVMKEKLNERLGAEVVREIVLRSGKVAVAEPAPVEEPPR....... 111
446 5.000e-23UniRef50_A0A0S8IQ09 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium SM23_73_2 TaxID=1703426 RepID=A0A0S8IQ09_9BACT  ali  20  2...............................................................................LEKTLKKRGLEKKILGEKAVLLWERVVGPQIAQKSSAFKVEGSILFVRVKSPCWRNELFFIKKKIIDKLNQHIKKRLIKDIVFVH....................... 86
447 5.000e-23UniRef50_R5YAG8 Uncharacterized protein n=1 Tax=Bacteroides sp. CAG:144 TaxID=1262736 RepID=R5YAG8_9BACE  ali  20  3.....................................................................RKDAQKLSELLPQILADQQLDRRLDETQAAVLWKEIFGEAVARYTTQVYVRAGVLYVSLSSAVLRNELLSCKKSLLHRLNEEMGRLVVKDIILR........................ 96
448 5.000e-23UniRef50_G1W8Y9 Uncharacterized protein n=2 Tax=Prevotella oulorum TaxID=28136 RepID=G1W8Y9_9BACT  ali  22  3.....................................................................KRDVKPLGDLLQTFLRNEGLETPLKQKRLLDVWPTVAGATVARLTGERFIKNQTLYVKVLNPALRQDLSMMRQRLVQQLNAAVGGYIISDIHF......................... 95
449 5.000e-23UniRef50_A0A1N7JTQ4 Uncharacterized protein n=12 Tax=Cyclobacteriaceae TaxID=563798 RepID=A0A1N7JTQ4_9BACT  ali  17  10....................................................................RKKEIAPLQEAFEELLKAYRLKDKYDERMLIQAWPEMMGKTVASRTTSVYIKEKKLFVKVTSGAIKNEMSMNRSKIIEIIEQKFEKGVITDIVFL........................ 104
450 6.000e-23UniRef50_A0A1H9D7H2 Uncharacterized protein n=2 Tax=Flavobacterium TaxID=237 RepID=A0A1H9D7H2_9FLAO  ali  12  2...................................................................KRFNDDYSISDVMKEFMKTNKLESGLDIVNVKETWNKMMGPAIKNYTSAIELKKNTLYIQLSSSVVKQELEYGKSKIITMLNEELGKELIKEIVFR........................ 97
451 6.000e-23UniRef50_A0A2P7TGM0 DUF721 domain-containing protein n=2 Tax=Sphingobacteriales bacterium UPWRP_1 TaxID=2116516 RepID=A0A2P7TGM0_9SPHI  ali  17  4....................................................................RNHNEQTLKEALREFFTLFQLNTKMNNARVQTCWEEVMGKTIAHQTGNLQVKNGVLYLSITSAPLKQELYFNREKIVQRLNERIGEEHIKEVVFR........................ 98
452 6.000e-23UniRef50_A0A1W9U1E0 Uncharacterized protein n=1 Tax=Desulfobacterium sp. 4572_20 TaxID=1971621 RepID=A0A1W9U1E0_9DELT  ali  19  28............................................................RRLSDHGKPP-GFASIKEVIDTIFTTSALPINFDDMRIWKLWDAVVGKKIAEHARPFSIKKGILLVMVTDSIWLQELEFKTEGIKERLNNKLQRRAIKKIRFRVG...................... 131
453 6.000e-23UniRef50_A0A2E7MNZ6 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E7MNZ6_9BACT  ali  21  5............................................RSSLLHPENWENRPREDSKKSVSPTEEQAEQLGGLLEALVADLGLKQKLGEYRARQVWEDAVGPTLAAQSRPLKVHNGRMEIAVPSAVWRTQLSFMKKEIVDKINQLTGKKTIKELILR........................ 123
454 6.000e-23UniRef50_A0A2M8FXV6 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium CG_4_9_14_0_2_um_filter_42_21 TaxID=1973964 RepID=A0A2M8FXV6_9DELT  ali  19  5....................................................................KTNRLTPIANVFSSSAKKAGWEKGIERYALWEKWAKITGASVAKHTSPAKWLGRTLLIHVSNSSWLQELTFMKQDIIKKIKESYPELVLNDLKFQVGPLQKPAR............... 108
455 6.000e-23UniRef50_UPI0009F1B8D2 DUF721 domain-containing protein n=1 Tax=Crocinitomix algicola TaxID=1740263 RepID=UPI0009F1B8D2  ali  18  18.................................................................KKDRNKESIPMKDALSNYFKAMGMEDKINETRLLSQWGDIMGEAIAKRTEDLYIKDEKLFIRVNSSVIRDELQQQKAEIVKKLNTIAGRKIISEI........................... 112
456 6.000e-23UniRef50_D9QSA1 Uncharacterized protein n=2 Tax=Halobacteroidaceae TaxID=53434 RepID=D9QSA1_ACEAZ  ali  20  4..........................................................................PINKVLEKTLQNLNLTHKIKEKKVLNIWSEVIGDKLKKHTKASYINQGILFITVNNSTWAHQLLFLKEDLISRLNKKLDQKIVEDIRFKLGSI.................... 96
457 7.000e-23UniRef50_A0A1W9PVG2 Uncharacterized protein n=1 Tax=Desulfococcus sp. 4484_241 TaxID=1968522 RepID=A0A1W9PVG2_9DELT  ali  21  1..............................................................MDQKKARAGEFEHISDILRNLIDSLVSGPRADLISIEQVWNGVLGEETAMNTSPESLKQGLLVVNVSASAWIQHLRFLKQNIIDDINRAVGKTLVKDIKFKVGAI.................... 105
458 7.000e-23UniRef50_D5EW37 Uncharacterized protein n=155 Tax=Bacteria TaxID=2 RepID=D5EW37_PRER2  ali  19  3.....................................................................KRDVHNVKDLILKNLRAQGLETPLLQKRLMDSWAEVVGEFVANYTESMYIRNQTLYVHLTNPAMRADLSMMRREIVNKLNAHVGTQVIADVRF......................... 95
459 7.000e-23UniRef50_A0A254Q861 Uncharacterized protein n=1 Tax=Bdellovibrio sp. SKB1291214 TaxID=1732569 RepID=A0A254Q861_9PROT  ali  26  6..............................................................PSNPKNKKRKLTLGSEVLQSLFEKSPLSEQFMRWKLWAKWEEVVGPTIAKNAEPVGFQRGVLYVWVRNSSWMQQMIFLKDQIRNTINEKFENNFVRYIKFT........................ 108
460 7.000e-23UniRef50_A0A087B7Y3 Zn-ribbon-containing, possibly RNA-binding protein n=1 Tax=Bifidobacterium magnum TaxID=1692 RepID=A0A087B7Y3_9BIFI  ali  23  34.....................................................RLREQNEEAFENFGKRGREPKTVGSTLNAMFSGEGWMQKLDVGALYGNWPQIAGPDIAAHSRIVRVEEGTLTIRADSPAWQQLLHSMETQFVEALRTAVPHLNIEHVVVLGG...................... 145
461 8.000e-23UniRef50_A0A255ZCK8 RNA-binding protein n=1 Tax=Flavobacterium aurantiibacter TaxID=2023067 RepID=A0A255ZCK8_9FLAO  ali  17  7..........................................................................SIAAVLQELIARNKWQRGLDKTEVPAAWFDVMGSGVKSYTLSVDFNEGTLYVQLSSSVLRQELQFGKDKIVKMLNEHLRRDVVKEVVLR........................ 95
462 9.000e-23UniRef50_A0A0P7BER6 RNA-binding protein n=2 Tax=Jiulongibacter sediminis TaxID=1605367 RepID=A0A0P7BER6_9BACT  ali  17  8.................................................................PTSRRTKAVSLKDAIDGFLESFNLQTKYSETHLIVSWEKLMGKTIASRTEKIYIRDNKLFLKISSSPLRQELVMAKSKLIKLINKEMGNYPVEDVIF......................... 104
463 9.000e-23UniRef50_E6SV65 Uncharacterized protein n=167 Tax=root TaxID=1 RepID=E6SV65_BACT6  ali  20  2....................................................................KRNNAEQIGALIRNFLRQESLESPLNERRLISAWPEVLGTTIASYTREIYIKNQVLYVHLTSAALRQELMMGRELLVRNLNRHVGAQVITNIIFR........................ 96
464 9.000e-23UniRef50_K9Z6I6 Uncharacterized protein n=6 Tax=Chroococcales TaxID=1118 RepID=K9Z6I6_CYAAP  ali  19  5..........................................................................SIDKLLNSILSQPQWEKQRRYYELKKIWYEIVNQKIAQHTSPIYLKEEVLFIATQSAVWAQELSLQRRTLIIKINRRI-QNPIKDIYFVFGKWYSQNTPPIP........... 105
465 9.000e-23UniRef50_A0A2D8UDD9 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2D8UDD9_9BACT  ali  29  4............................................................RGGEKVDEIPRKVTPLNMLVREIVSELGISEKIVECEALLVWNDVVGPSLAKNAKPIRINNGILEIAVPSAVWRTQLSFMKTDIVRRMNCHVGGKIIRELRLI........................ 106
466 1.000e-22UniRef50_A0A1F9ARK8 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_49_15 TaxID=1797827 RepID=A0A1F9ARK8_9DELT  ali  25  5........................................................................PVHLKNIIRRVLDSCRKEPDAGLLKLWDLWDSAVGSIIAENAQPAAFKGRLLIVQVSSSTWLQHLHFLKRDLIRKINDALGEEMLDEIKFKIGSV-DWRR............... 103
467 1.000e-22UniRef50_A0A2E0VVE4 Uncharacterized protein n=1 Tax=Saprospirales bacterium TaxID=2026790 RepID=A0A2E0VVE4_9BACT  ali  20  39.........................................................................QSLKEVLRMMVSEMKWDHKLSETRIKEFWTKKMGTTINQYTKELKLRGGKLFITLESSPVKQELSYEREKLRKTLNQLLGDEVIKDIIIR........................ 128
468 1.000e-22UniRef50_A0A1G1FBV7 Uncharacterized protein n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A1G1FBV7_9BACT  ali  27  2.....................................................................GKRVEKISDTIGRVLARRGMAGKLKEYRIFGQWEKVVGKVVARHARPLSLRGKKLTVLVDSSAWMQQLSQLRPEIIEKANRAFGQDAVESIILKIGEVPYSGSMVRETREAPP..... 114
469 1.000e-22UniRef50_A0A0N1JZR3 Zn-ribbon-containing RNA-binding protein (Fragment) n=1 Tax=Thermoactinomyces vulgaris TaxID=2026 RepID=A0A0N1JZR3_THEVU  ali  51  19........................................................PRFRKEWSGPGPDKRDPETLGSLLPQVVRKNGWTRKVADASVFGSWEAIVGPEIAGHCSPKSLENGELLVVAESTAWATQLRL................................................ 101
470 1.000e-22UniRef50_A0A142L7N5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium UKL13-3 TaxID=1690483 RepID=A0A142L7N5_9BACT  ali  20  2.................................................................KKPRNTNEQSLKDVISELFENNHMGGKLKEINIINNWEKLVGNLIAKNTQKIYIHQGKLFLHIESAPLRTELSYSKAKLIEVVNKEAGEVLIDDVVVR........................ 99
471 1.000e-22UniRef50_A0A1Q6XHE7 Uncharacterized protein n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A1Q6XHE7_9BACT  ali  25  2...................................................................AKRPGLIAIPDVLGRLLKSHGMESRMLECTLQQHWPEVVGEHIGHHTWPESIRHRKLYLVAENSVWLQQLRFLKPELLAKLSSCAGGDAITDIVLRVGTKPAPE................ 105
472 1.000e-22UniRef50_D8P7F2 Uncharacterized protein n=12 Tax=Nitrospirae TaxID=40117 RepID=D8P7F2_9BACT  ali  25  9..........................................................................SFGSILAGVAHRLGLESKLFEARLRRQWPDIVGKPIAAHTRPDQIRFKKLYVLVHNSVWLQQLTFLKPVLLEKVNAMAGEPLVTEIVLRIGEV.................... 101
473 1.000e-22UniRef50_I0W7M1 Uncharacterized protein n=34 Tax=Flavobacteriaceae TaxID=49546 RepID=I0W7M1_9FLAO  ali  16  3...................................................................KRNNDHLSLSEVLKAFVETNKLDKGIDKIQVQNAWSDLMGPGVNNYTQEVTLKNDILYVQLSSSVLREELSYGKDKIVQMLNESLGKDVVKSIVLR........................ 98
474 1.000e-22UniRef50_A0A1H4ICA1 Predicted nucleic acid-binding protein, contains Zn-ribbon domain (Includes truncated derivatives) n=1 Tax=Streptomyces misionens  ali  28  2...TDTTRIERAGADGPELSGVDLARVALRSAREAARKRG-----------DSEAAMPRRRTQRAVKRDGREPTGFAAVLQGLMTERAWAIPAAGGSVLDRWTDIVSPRMPEHVQAVAFESGQLDLRPDSPAYATQLRLITARIIATVNQEVGTDAVRTIRVLAAGATPEPPAVKPAP......... 170
475 1.000e-22UniRef50_A0A1F9MTV7 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFOXYD12_FULL_50_9 TaxID=1797902 RepID=A0A1F9MTV7_9DELT  ali  24  9..........................................................................SIAGVLAVLFKEKDWLRRLGLHAVFLFWDELVGKSVAAHARPNLIRGRVLWVGVSDSVWMQQLHLQKMIFLEKINERLAGETLEDIRFIGGVMPIEPEQEIKRTKRPP..... 119
476 1.000e-22UniRef50_A0A2D5ZN46 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2D5ZN46_9BACT  ali  34  26........................................................................PQPLASLLPRVIKHLGLKDQLADRKILGDWPKIVGPRIAATTTPTKLREGRLYVEVSNPAWLQELSLMKPILLRQIRRATGRDLVKDVILV........................ 116
477 1.000e-22UniRef50_A0A1F3EKC6 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3EKC6_9BACT  ali  17  2....................................................................RRSNTQPISAILKLVFSDLNIEKKLKEVELMNSWEEVTGKFIASKTKNMYIKNKVLYVNIESSVIRNELILLREGLINRLNDKCKQEVITGIVIR........................ 96
478 2.000e-22UniRef50_A0A2E3A9N3 RNA-binding protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2E3A9N3_9FLAO  ali  17  2................................................................TKKKRSFEPQTISDVLGELIDQKNIKGGITKIRVEKAWNTTMGKSVAQYTQRVNYRGTTLFVNLTSSALREELSYGKEKILLHLNESLGANLVTKLVLR........................ 100
479 2.000e-22UniRef50_Q3A2E2 Uncharacterized protein n=1 Tax=Pelobacter carbinolicus (strain DSM 2380 / NBRC 103641 / GraBd1) TaxID=338963 RepID=Q3A2E2_PELCD  ali  24  2..................................................................RSSRSGIDGVQHILQKWLSARGMDTKFSRYRVWQFWEAVVGTQIAARAKPVRLRGAILEVRVDHPVWMQQLQLMKPRILAKLNEQLGEHLIDDLFLRHGRTGTSR................ 106
480 2.000e-22UniRef50_A0A1H0X7H9 Uncharacterized protein n=4 Tax=Mucilaginibacter TaxID=423349 RepID=A0A1H0X7H9_9SPHI  ali  22  7.........................................................................KSLKDAIDQMLNVYKIKRRFDETAVVAAWPELVGKPVANRTKELFIRDKKLFLRIESSVIKNELMMMRAQIMDKINEKANGILVEEVIFL........................ 96
481 2.000e-22UniRef50_A0A1F3J0G9 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWE2_42_42 TaxID=1797339 RepID=A0A1F3J0G9_9BACT  ali  23  34..........................................................................TLGEVLQQLIDKFRLRNRMNSESLQAAWPEIAGALVARHTKSVQLDGPVLYIEVDEPALRNELLYMQSDIISAVNKRLHNDVVEKIVIR........................ 122
482 2.000e-22UniRef50_A0A2M7S4D0 Uncharacterized protein n=1 Tax=Candidatus Desantisbacteria bacterium CG_4_10_14_0_8_um_filter_48_22 TaxID=1974543 RepID=A0A2M7S4  ali  23  2....................................................................RKERAEHISGILRRILKRMHIEDRVEEAGLFQVWDDVVGSRIARHTKPDRIIKGRLAVIAENSSYIQEYSFLRNEIKKKLNARLGKDIVKEVVFRTGEIKHEPRPRRPKTKRK...... 114
483 2.000e-22UniRef50_K5Z441 Uncharacterized protein n=51 Tax=Bacteroidales TaxID=171549 RepID=K5Z441_9BACT  ali  24  4......................................................................RNAQTLGDAIREFFEDNALRGKILEIRVIRAWGEILGPMVAQYTRNIYVKDKVLYVSLTSSVLRSELVLCRERLVKSLNDYAGSEVIQDIVIR........................ 97
484 2.000e-22UniRef50_A0A1V5T7A7 Uncharacterized protein n=1 Tax=bacterium ADurb.Bin270 TaxID=1866926 RepID=A0A1V5T7A7_9BACT  ali  19  2..................................................................KRKRSQPSSIASIIGKNARKMNIERRMDIYRLTKAWPEIVGPAICAHTSPERLLGKTLLVRVDGSSWMNELVYFKKEITKKIGARIPELKIQDLKFEIGEIRR.................. 104
485 2.000e-22UniRef50_A0A1E5T696 Uncharacterized protein n=10 Tax=Flammeovirgaceae TaxID=200667 RepID=A0A1E5T696_9BACT  ali  19  2............................................................KQKRVYKSRKSEPETVGSAISQMLKAFKIEGKFFETDLVNSWERVMGKAIANRTSKLYIRNKKLYVHISSAPLKHQLSMSREKILVLLTKEFGQQVVNEVIIK........................ 104
486 2.000e-22UniRef50_A0A1K1M0I5 Uncharacterized protein n=6 Tax=Prevotellaceae TaxID=171552 RepID=A0A1K1M0I5_9BACT  ali  19  3.....................................................................KRNVQSLRELVLRNLHEQGLETPLLQKRLVEAWPKIAGPVIARYTLNTYIYNQTLFVRLSNPALRSDLSMRKQELTKKLNDFVGEQVIADIRF......................... 95
487 2.000e-22UniRef50_A0A1V5W6N3 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin217 TaxID=1852809 RepID=A0A1V5W6N3_9BACT  ali  22  2....................................................................KRSNFQPLSEVLDEFFKKNGIEDKIIEAQIKDSWKTVVGPMFANATKQIRISKGTLTVHMQSSAVKQEILLHRTIIMTRLNEIVKKPYIREIIVT........................ 96
488 2.000e-22UniRef50_UPI0004211A55 DUF721 domain-containing protein n=1 Tax=Desulfatiglans anilini TaxID=90728 RepID=UPI0004211A55  ali  26  5.....................................................................KKTLMPIKDILAEILESRSSPLGQGLYPILRIWEQVMGKAIAEHARPVYFKDAVLKVSVTDPVWMQELTYREPEIKEKLDLALGRNVVRKVVFRMGH..................... 101
489 2.000e-22UniRef50_B3EDN2 Uncharacterized protein n=2 Tax=Chlorobium/Pelodictyon group TaxID=274493 RepID=B3EDN2_CHLL2  ali  22  7...................................................................RQKKDPRHIALIVEEVCDRLGMTEACEQYKALQSWKDIVGDTIAAQTTIERLTQGQLHVRVKNSVWRMELNFRKKELAEKMNSLSGTTVVREIIFR........................ 102
490 2.000e-22UniRef50_A0A2G6GZF1 RNA-binding protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2G6GZF1_9BACT  ali  18  3.....................................................................RKDFKRIDSLLDAFVKAHHLEQGLAEYRLKKAWPELLGITIAKKTRKLYIRDKKLFVELYSSVVRNELEMIRPTLVSRLNKEAGMQVIDDIVLR........................ 96
491 2.000e-22UniRef50_E4RQ33 Uncharacterized protein n=12 Tax=Cytophagaceae TaxID=89373 RepID=E4RQ33_LEAB4  ali  17  5...................................................................ARKTQAQSVGEAFEAFLNAYKLRSRYNETYLVAYWEKLMGTSIAQRTEKLYINRGVLFLGISSAPLRQELVLAKSRIIALLNKEMGSEIITDVVFI........................ 100
492 2.000e-22UniRef50_A0A170YVR9 Uncharacterized protein n=1 Tax=Paludibacter jiangxiensis TaxID=681398 RepID=A0A170YVR9_9BACT  ali  21  2....................................................................KRQNAQTLGEAIKVFLAEKKFNRKLLENRVVSSWGEIMGSTVASYTSNVEIRRQKLYVTLTSSVLRHSLSMSKDEIVKKINRALGDDVVTEVVFR........................ 97
493 2.000e-22UniRef50_A0A0S8K2Q2 Uncharacterized protein n=4 Tax=Bacteroidetes TaxID=976 RepID=A0A0S8K2Q2_9BACE  ali  21  3.....................................................................RSNTQNIGDVIRAYLKESGLDKPLKERQLIQSWETLLGRSVARATTRIFIRDRKLFVYLSSSVIRNELFMLQEEILKKLNEAAGEEMVKEIILK........................ 96
494 2.000e-22UniRef50_A0A1E7HNM2 Uncharacterized protein n=3 Tax=Desulfuromonadales TaxID=69541 RepID=A0A1E7HNM2_9DELT  ali  28  6....................................................................RSRSIDGVGAVIGKLFQQRGMEDKMRRYRAWQLWDKVVGPQIAARARPSRMRDNTLEVWVDHAVWMQQLQLMKPKILARLNAALGEDLIQDIYLRRGRPR................... 105
495 2.000e-22UniRef50_H6L874 Uncharacterized protein n=2 Tax=Saprospira grandis TaxID=1008 RepID=H6L874_SAPGL  ali  21  21...........................................................................FGNVLGKMLQVYGLSDKMREFQIRNYWEQQMGPMIAEHTQSIFVKRRKLFVRMRSAPLRQELLYGKAKLLELLNRHLGEEYLKDVVIL........................ 108
496 2.000e-22UniRef50_A0A2E5UMJ7 Uncharacterized protein n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E5UMJ7_9BACT  ali  23  4............................................................QGRQGTSVKKSDPEKIGDFLSLVLEKGGLAKQISRNGILEKWESVVGTKIARVTEASAVQGDTLFVEVRSSIWLTELSFIKNALLVKINQGLDDEAIERIIFR........................ 107
497 2.000e-22UniRef50_A0A1R0IKQ6 Uncharacterized protein n=8 Tax=Sulfobacillus TaxID=28033 RepID=A0A1R0IKQ6_SULTH  ali  23  5.........................................................................EHLQHILDRLVETYSWQPAKSLWILETSWNDVAGEYIAKNTRVIGYKPKILTVAVKSSSWAQELQFFIPELKQKINELLGSVFVEDIHTRIPPVYRMGTGEVSVRGRKPR.... 122
498 2.000e-22UniRef50_A0A2E2TE46 RNA-binding protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A2E2TE46_9FLAO  ali  14  8..........................................................................TLKQLLDQMLDKYKLTDKLDEVDLESHWEELMGTMIYKHTTQLKVQNKKLYIKLDSPVIRQELIYGKTLIIQKVNNLVGKELITDVVFR........................ 96
499 2.000e-22UniRef50_E3D7Q7 Uncharacterized protein n=27 Tax=Bacteria TaxID=2 RepID=E3D7Q7_GARV3  ali  25  26..............................................KRGEKKTINEQNAYKAWESFGKPGRDPQNLYSLLGNFANKKHWNEPLAIARMREDWWKIVGKSASLNCYIDQIKDGILIVRTKSNVWYTQLSYCKPMLEKKIFEYSKNINIKEVKIVGPSLQKNRQ............... 151
500 2.000e-22UniRef50_X8BK27 Uncharacterized protein n=2 Tax=Mycobacterium TaxID=1763 RepID=X8BK27_MYCXE  ali  68  9..............EPSAPADMDLVRRTLEEAREAARLRGRDIGRGRSATAPRRVAAGNRRRWSGPGPDPRDPQPLGIAARELAKKRGWSARVAEGTVLGQWASVVGHQIADHATPQ...................................................................... 112
501 3.000e-22UniRef50_A0A2H6F519 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2H6F519_9BACT  ali  19  2.........................................................................EPLHNILRNFVKDFGIEGGAGLNAIRRLWPDIVGQTIAVHTFPDTIKGKVLTITVDTPQWMHHLSFYKEDI----SEKLGSYNIGGIRFRIGRIP................... 92
502 3.000e-22UniRef50_A0A0E9LU85 Zn-ribbon-containing, possibly RNA-binding protein n=2 Tax=Marinilabiliaceae TaxID=558415 RepID=A0A0E9LU85_9BACT  ali  17  7....................................................................RSNNTQSIQAILEQIIDSPALSKGIRETRAVQAWKKVLGPTVANITKQIYIRGGVLYVSLHSSVIRNDLMMHKDKIIHSLNTEAGGRVVYDIVIR........................ 101
503 3.000e-22UniRef50_A0A2D9H3A7 Uncharacterized protein (Fragment) n=1 Tax=Nocardioides sp. TaxID=35761 RepID=A0A2D9H3A7_9ACTN  ali  45  1............................................................................................................EVASHTTPETFAEGRLVVRTDSTAWKTQLTLLAPQLVARLNQDLGPGTVSVIEVVGPHLPTWRKGPRSTRGRGPRDTYG 80
504 3.000e-22UniRef50_A0A286IH48 Uncharacterized protein n=1 Tax=Cytophagales bacterium TFI 002 TaxID=1945892 RepID=A0A286IH48_9BACT  ali  16  6....................................................................RSSKATPLKEAIDDFLKSFKLTQKYNETYLIAYWEQIMGKSIASRTEKIFVKNGVLYLKISSSPLRNELFLAKSKMIKLLNEEMKNELIREVVFI........................ 100
505 3.000e-22UniRef50_C7M7L3 Uncharacterized protein n=21 Tax=Capnocytophaga TaxID=1016 RepID=C7M7L3_CAPOD  ali  15  7..........................................................................TLSEVIQQIVKQNHLTYGLQKASLPELWNELMGKAIAKYTSSVELKGSTLYVHLTSPALSNELSYGKSKIIDNLNERLGEPLIQKLIFL........................ 95
506 3.000e-22UniRef50_A0A060REB7 Zn-ribbon-containing protein n=2 Tax=Rikenellaceae TaxID=171550 RepID=A0A060REB7_9BACT  ali  26  3.....................................................................RTDPQSLSELLQDFFEQRKLRGALIEGRAVEVWAEVVGEYVASFTEDVYIRDGILYLSFSSAAVRSEIHIRKRFFVAKINEAIGAKAVKNIVIR........................ 96
507 3.000e-22UniRef50_A0A2G9XPE4 Uncharacterized protein n=1 Tax=Syntrophobacteraceae bacterium CG23_combo_of_CG06-09_8_20_14_all_50_8 TaxID=1974096 RepID=A0A2G9X  ali  23  16........................VRLTPQDSRALPAELFTKPVLSLSKGRPIRQVFRLFTSSSTMRKKNSKLQRIDEILSRALKKRRVPFRSEDRRLLDIWLKAAGPQIASQCRPESLRRDVLFVKVSSPVWMHQLHFLKGELIEKVNALMEKTSVKDIRFSIGQLPSSE................ 164
508 3.000e-22UniRef50_A0A1V4WRM2 Uncharacterized protein n=2 Tax=Syntrophorhabdus TaxID=513557 RepID=A0A1V4WRM2_9DELT  ali  26  5..........................................................................PLQKTLTKVLKGYRIND-LESIRLFAMWDRIAGEKMASHCQPVRITRGTLFVEVDDPLWLTQLKYMKADIQAKIEEILQKDSVKDIRF......................... 91
509 3.000e-22UniRef50_A0A136NKC4 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A136NKC4_9BACT  ali  11  3....................................................................RKSNEESLKEVIDQLLDTYRLRDKLNQVKLIRSWDKIMGEGISKRTEKIQFRNDTLFIYLNSAPLKEELNYGREKIVKLMNEELGGDYIKEVIIR........................ 97
510 4.000e-22UniRef50_A0A0S4PHT5 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A0S4PHT5_9BACT  ali  28  3.......................................................................DLRPIGSGLSRLLEDWGLAESFRVAAALRDWRAIVGAAIAQVARPLRIEGDTLWVAVKSQAWAQELNFQKAVILQRLNERIGRERFHNLRFIVPAEPAPPSAEPETPSRKPAD... 119
511 4.000e-22UniRef50_A0A1G1GS39 Uncharacterized protein n=2 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A1G1GS39_9BACT  ali  30  2.....................................................................GKRPQRLSTTLGALLNAHGLRARLSEYRILGQWEKSVGSLVANHARPVTIRANKLYLIVDSPAWMQQLSMLKPEIIGKVNRSLGRDAIKDLVLNLGELPA.................. 101
512 4.000e-22UniRef50_A1ZXC7 Uncharacterized protein n=2 Tax=Cytophagales TaxID=768507 RepID=A1ZXC7_9BACT  ali  14  13...................................................................PRKASTTTMKDAVYELLNNYKIKNKYDEAHIIQVWGDLMGEEVACRTEWVYIKNHTIFIKISSPPLRTELLMRKTNILDRINHNLGEEKLQEIVFR........................ 108
513 4.000e-22UniRef50_A0A1I4TCW1 Uncharacterized protein n=1 Tax=Thermodesulforhabdus norvegica TaxID=39841 RepID=A0A1I4TCW1_9DELT  ali  30  6......................................................................REPVPVSELVQRLIEK----QPFSLGGVLGRWEDIVGEQVARYAVPVSLKKGVLKIHVLDSVWKHHMELNARDLICKINSRFPVEVVSKLVVKVGPVEAWDKG.............. 104
514 4.000e-22UniRef50_Q8G6K4 UPF0232 protein BL0636 n=125 Tax=Bacteria TaxID=2 RepID=Y636_BIFLO  ali  30  23...........................................RLSRRGATLKDYRRRREEAIENFGKPGRDPAELGSVMTTIAGNGVWAANMKLAQLRNHWDQVVGQAIASHSAVADFTDGVLTIRAESTVWATQLTYLIPQLTDTIRRNLKGLTITEIRVTGPAAGYTRKWARRR.......... 156
515 5.000e-22UniRef50_A0A2E7TNX1 RNA-binding protein n=6 Tax=Flavobacteriales bacterium TaxID=2021391 RepID=A0A2E7TNX1_9FLAO  ali  23  3....................................................................KRKDNQKIGDALKELMDTYKLNVKMNEVRLYEAWGKVLGPTIENHTISKQLIDGKLLIRLDSAALRNELSFGKSKIVKSLNDELGAEIVKEIIF......................... 97
516 5.000e-22UniRef50_A0A2U2RXK1 DUF721 domain-containing protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2U2RXK1_9BACT  ali  15  5...................................................................KRNFNPISLKNILKSFVTQKSLQKGITNVRVCNAWKDVMGENVSKYTTQIRFSRKTLIVGIKSAALAMELSYKKDMILEKMNEHLNGEYINKIII......................... 99
517 5.000e-22UniRef50_A0A1F4SEG2 Uncharacterized protein n=2 Tax=Candidatus Saganbacteria TaxID=1703751 RepID=A0A1F4SEG2_9BACT  ali  19  3.............................................................................ELLKNIFCDSKLLKCLNGVLL---WEKVVNKKIAKHTQAVKILNKVLYVVADSSVWAQELNFLKREIIDKINKEANEILVKDIRFKVGGL.................... 89
518 5.000e-22UniRef50_A0A1F9FT49 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_44_16 TaxID=1797862 RepID=A0A1F9FT49_9DELT  ali  20  12....................................................................RVKKPKRLDHILETTSSRLGLRKKMKQYHLWHQWESIVGPTLAANTEPSSWRGSLLVIKTKNSSWLQELSFMKAELLSKIQAASPQYPIRDIRFEIGTIST.................. 115
519 5.000e-22UniRef50_A0A2N2WCS7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium HGW-Bacteroidetes-6 TaxID=2013696 RepID=A0A2N2WCS7_9BACT  ali  20  9..........................................................................SLKEVLQQLVDKYKLRSKMQSEALVASWPEIAGKLVAKHTKSVRLDGPVLYIEVSEPALRNELVYMQSVIIKAVNDYLKDNVVDRLVIK........................ 97
520 5.000e-22UniRef50_H8XUW0 Uncharacterized protein n=1 Tax=Flavobacterium indicum (strain DSM 17447 / CIP 109464 / GPTSA100-9) TaxID=1094466 RepID=H8XUW0_FLAIG  ali  16  2...................................................................KRLNDDYSISDVMKEFIKSNKLEKGLDEVQVKELWLSLMGTTIANYTTQVDFYRNTLYVTLNSAVLKQELLLGKHKIIELFNKELGKELVKDLIFR........................ 97
521 5.000e-22UniRef50_A0A2V5PDC1 Uncharacterized protein n=17 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V5PDC1_9BACT  ali  26  16..............................................SMASSLRSAVIAEWRGLPEKKTKADRWQSPAEVVPKLMQRLGLRERLHETEVIDAWSKIVGEFIAAHSAPVALREGVLYVRVLQPALHYELQISKSEILRKLKQRFGGKTIRDIRFRVG...................... 135
522 5.000e-22UniRef50_A0LZH2 Uncharacterized protein n=32 Tax=Flavobacteriia TaxID=117743 RepID=A0LZH2_GRAFK  ali  16  2.................................................................KKKRKNEEMKLGDLLKSFVDENKLDKKLNEVKVRDVWNNQMGPAIEKYTTGLKLKNDTLFVQLSSSVLREELSYGKEKIIRNLNEAMGRDLISKLVLR........................ 100
523 5.000e-22UniRef50_F4Y0C1 Zn-ribbon-containing protein n=4 Tax=Moorea TaxID=1155738 RepID=F4Y0C1_9CYAN  ali  23  3.........................................................................KSLNQILDRITNQPEWQGIQRLSSLIKCWSEIVGVNIANHTRPYAISRDILYVATSSSVWAQELKFQRRMLLKRLNAGWSEPLV-DIHFSPAQW.................... 95
524 6.000e-22UniRef50_H8KN40 Uncharacterized protein n=2 Tax=Solitalea TaxID=929509 RepID=H8KN40_SOLCM  ali  14  3....................................................................KKSNEQTMKEAIDLLLETYRIKDKYNEVNIVQSWADIMGPMVANRTSEIFIRNKKLFVRLDSAALRHELTRAKEKIVEVVNDKAGTKVIEEVVFL........................ 97
525 6.000e-22UniRef50_A0A154BQC2 Uncharacterized protein n=2 Tax=Anaerosporomusa subterranea TaxID=1794912 RepID=A0A154BQC2_9FIRM  ali  26  5............................................................................KDILPLTLKNLGVKRQLAVQTIILHWPDIVGNDISLQSRPTSAKNGVLFVAVKTPVWGHHLSMLKEQLLAKIHDYLGQKLLADIKFYAGN..................... 94
526 6.000e-22UniRef50_A0A2D7BBH3 Uncharacterized protein n=1 Tax=Pedosphaera sp. TaxID=2024890 RepID=A0A2D7BBH3_9BACT  ali  15  11................................KQNARQRKRTPKRSAGCDQVLREWRRASCDDQEKLAQFKPNQT-SDLVNKALKTLRLDQRTSESQILKAWTHLIDPTLTAHAQPVGIRKGTLFVNVDNSVWLSEIRYRREEILERLQTCFGKEMIQRISFRIG...................... 143
527 7.000e-22UniRef50_A0A077JEJ7 Uncharacterized protein n=2 Tax=unclassified Cyanobacteria (miscellaneous) TaxID=1983111 RepID=A0A077JEJ7_9CYAN  ali  19  5..........................................................................SLNHLITALTTQPGWAQYQRYYRLCQCWNEVIDPKIVFHTRPLYIQRNLLWVATSSSVWAQHLSLQRPLFLKSINARFPEEPLVDIRFSSAKWHDSK................ 101
528 7.000e-22UniRef50_A0A2M7T8J2 Uncharacterized protein n=1 Tax=Actinobacteria bacterium CG_4_10_14_0_8_um_filter_50_43 TaxID=1973889 RepID=A0A2M7T8J2_9ACTN  ali  27  15..........................................................................GLGETIRELTSNEEMRAKLEESKVLSLWAQVVGPAISDNAAPEKIKNGILYIKTKSPAWAQELKVLDSKIKKQINALLGSHTVHEIRFIHGPL.................... 107
529 7.000e-22UniRef50_A4ASS1 Uncharacterized protein n=54 Tax=root TaxID=1 RepID=A4ASS1_MARSH  ali  15  3...................................................................KRKNDNLPLSEALNDFIQKNKLQQGIDKVNTREAWVKLMGNGVNNYTTAIELRNETLYISLSSSVLREELSHGKSKILDMLNEELGKDLVKKIVLR........................ 98
530 7.000e-22UniRef50_A0A1J0LPB6 Uncharacterized protein n=1 Tax=Flavobacteriaceae bacterium UJ101 TaxID=1150389 RepID=A0A1J0LPB6_9FLAO  ali  17  1.....................................................................MSDAKPLKGVFDAMIERYKMKDHFKVEQIKSLWEETVGAYIANYTEKLVIKKHILYVKLKSPELRNELQYAKTKLIKSLNHKIGEDYIKDIKF......................... 93
531 7.000e-22UniRef50_I4AMJ9 Uncharacterized protein n=2 Tax=Cytophagales TaxID=768507 RepID=I4AMJ9_BERLS  ali  15  10.................................................................PSRRTPDPKPIGEALKAFLDAQKWSVKYESNRLKVDWAKIVGEFVAQQTEKVEIRNKKIFIRVAQPTLRYELLMQKTSIIYRVNSHFGKRMIEDVVLL........................ 107
532 7.000e-22UniRef50_A0A2G6MUR6 Uncharacterized protein n=1 Tax=Desulfobacterales bacterium TaxID=2044940 RepID=A0A2G6MUR6_9DELT  ali  23  12...........................................................................LAAVLPDIISHKGWKVKLDMYSFFPDWEQIVAGNAAACSRPLKIKKDTLWVEVENSSWMQQLQYEKYQILADINARLKFSRIKDIKFTLPEGDRKEPKPERAR......... 114
533 8.000e-22UniRef50_A0A1F3TVL4 Uncharacterized protein n=1 Tax=Bdellovibrionales bacterium RIFCSPHIGHO2_01_FULL_40_29 TaxID=1797389 RepID=A0A1F3TVL4_9PROT  ali  18  9.....................................................................KSKFQTGAEVLQKLLESQAVSDQYLRWKLWLNWKDIVGPTVSAHSEPVSYRNGLLWLWVENSVWMQQMGFMAESIKDAINKKFRPGFVREIRFTQ....................... 105
534 8.000e-22UniRef50_R7PBG9 Uncharacterized protein n=1 Tax=Prevotella sp. CAG:617 TaxID=1262933 RepID=R7PBG9_9BACT  ali  20  2....................................................................RRNNSESIAHVIQRFLREYGLESPLNQYRLLSQWENVMGPEVARLTERVFVKNQTLHVVVSSPALRADLMLKRKQLVQKLNHAVGAQVIVDV........................... 93
535 8.000e-22UniRef50_A0A2G2F724 Uncharacterized protein n=4 Tax=Crocinitomicaceae TaxID=1853230 RepID=A0A2G2F724_9FLAO  ali  17  11...................................................................KRTSNEQPLKEVLDRWMKAYGFEERAKNLEVVEAWPELMGTAVANRTREISIRNKMLYLKMDSSVMRDELAHGKQIIIQRVNEFVGSEVIVDVWF......................... 105
536 8.000e-22UniRef50_A0A2M7K2G6 DUF721 domain-containing protein n=4 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2M7K2G6_9BACT  ali  18  2....................................................................RRSNTRSISEVIKEYVEAFKLQGKLGEVKVINGWSDIVGEKIAARTLEIKIFNRKLYVKIQSSIIRQELFMIRTELVKRLNEKAGDNVIDDLAF......................... 95
537 9.000e-22UniRef50_A0A2H5X2L2 Uncharacterized protein n=1 Tax=bacterium HR16 TaxID=2035411 RepID=A0A2H5X2L2_9BACT  ali  30  1.....................................................................MSHPDLLRDILDETVDALGLRERLRAFRALLNWEEVVGKTVAAAAQPEALKEGKVFVAVKSSAWIQELRFQQQTILQKLNEYAGAPIFTELVFRV--KPRSRKSP............. 103
538 9.000e-22UniRef50_A0A2E0WDZ0 Uncharacterized protein n=1 Tax=Micrococcales bacterium TaxID=2026762 RepID=A0A2E0WDZ0_9MICO  ali  30  6.................ADDSVDPAVQALARARSVSGSQ-------------SRRRAVKPTHYSGAAPDDRDPGALGRILDDWARSHGYSHRLAVSALLDRWEQIVGSEVAAHVSVGEYRGGTVVLTADSPSWALQMKYLKDTVLVRIEEEVGPGVVSHISIVGPKESSRRAGRLRVRRRSPR.... 164
539 9.000e-22UniRef50_A0A1Q7JYZ6 Uncharacterized protein n=7 Tax=unclassified Nitrospirae TaxID=1298915 RepID=A0A1Q7JYZ6_9BACT  ali  24  2.....................................AAPGAARPPSPEANFAPLDRLLQAAYHATMRPASFFAPVASILKAVAHRHGIETPLFEHRLRRRWSEIVGDQLAAHTRPDLIRFKKLYLIVENSVWLQQLTFLKPTLIEKINAAADGPVVSDIVLRVGEARAPREGERPMEG-GNRDEAG 151
540 1.000e-21UniRef50_A0A2J6JCQ3 Uncharacterized protein n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2J6JCQ3_9DELT  ali  23  3...............................................................RPKRSSLKRAVPASEVLGDLLEQRGMSEKLRSYRVWKIWDETVGPLIAQHAQPVRLRGTTLEIRVDQAVWMQQLQLLKPMLLGKLRQKSGGADISELFLRLG...................... 104
541 1.000e-21UniRef50_A0A1V5N9W2 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium ADurb.Bin408 TaxID=1852813 RepID=A0A1V5N9W2_9BACT  ali  20  9...........................................................................LKDAINDFLNTYFIKDKVRENRIKELWEKLMGKMISNHTQALYLRNGVLFIEVNSASLRTELSYAKEKIKNTINSEIGDNSITEVRIK........................ 97
542 1.000e-21UniRef50_A0A1F5UHP9 Uncharacterized protein n=2 Tax=Candidatus Firestonebacteria TaxID=1817802 RepID=A0A1F5UHP9_9BACT  ali  25  3...................................................................RNNKPLVSIAQLLGKTLKRIEIFDKVKEYTIYVVWREAVGDEIARHAAPIDFNHGVVTVEVDSSVWVNELKFMKAKLIAGLNEKLGMKKVKDILFR........................ 109
543 1.000e-21UniRef50_A0A2T4DRS2 DUF721 domain-containing protein n=1 Tax=Marivirga lumbricoides TaxID=1046115 RepID=A0A2T4DRS2_9BACT  ali  14  3.........................................................QYKKKPHPASIRKSQATPLGEVINDMIEAYHLNKKFDQTTVINLWPKLMGNTIASRTKGIFMKGDKLFITVESSPLKQELHMNKERIITLFEEALGKKVIKEVVLL........................ 108
544 1.000e-21UniRef50_A0A1G1HYF0 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RIFCSPHIGHO2_01_FULL_66_17 TaxID=1801712 RepID=A0A1G1HYF0_9BACT  ali  27  6.............................................................................RLVEDLFKAHGLESKLVEHRLMQAWPQIVGPQIAAHAAPTEVRANTLRVVVDSSTWLHELTLLKPILIEKLRRSSGGAIVHDVLFTIGNPPASRPQPPSAPPREP..... 111
545 1.000e-21UniRef50_A0A2M7P9Z9 DUF721 domain-containing protein n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2M7P9Z9_9DELT  ali  25  3....................................................................RKQGAIPISGVLAGLFAERHWEERLGLHQLFLFWDEVVGEAIARQARPAVIRGRVLWVEVTDSIWMQQLHLQKTTLLSAINGRLPGDGLSDIRFRLGRGPSPFKKARPKRP........ 120
546 1.000e-21UniRef50_A0A0F2QSC1 Uncharacterized protein n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A0F2QSC1_9DELT  ali  26  1..............................................................MAEIRKNSKKFAHIGTVIDKILQQHRPLNDQSLIQVWKVWEGAVGFPIAANARPVAFKGDLLLVHVSSSTWLHQLRFLEKEMIAKVNAALGGDQVRSMKLKVGE..................... 104
547 1.000e-21UniRef50_Q1EIQ8 Uncharacterized protein n=1 Tax=uncultured microorganism TaxID=358574 RepID=Q1EIQ8_9ZZZZ  ali  21  2....................................................................KRTEAKNVGQIINDLLKKENLDVALDEHRASALWPQIVGDGINRYTISRSVTGGVMTVRLSSASLANELMLIRASIIQRINEALGREIIHEIIFK........................ 96
548 1.000e-21UniRef50_A0A2D0NEY4 Uncharacterized protein n=1 Tax=Lewinella nigricans DSM 23189 = NBRC 102662 TaxID=1122177 RepID=A0A2D0NEY4_9BACT  ali  13  3.....................................................................KHNEKTLKEALHAMVDQYRLKGKLNQTRIRSHWENMMGPSIARYTRDIKMGRKKLYIYLDSAPLKQELSMGKEKIRKMLNEALGEEYIEEVVIL........................ 96
549 1.000e-21UniRef50_A0A1I2HB29 Uncharacterized protein n=2 Tax=Thermoflexibacter ruber TaxID=1003 RepID=A0A1I2HB29_9BACT  ali  17  2....................................................................RQSEVSSLGEAIDAYLKAYRLKDRYQEAGIVVSWTELMGAPIARYTQRIFIKNKTLFVEISSAPLKNELLMSKNQIIKILNQNAGGNLVEEVIFL........................ 96
550 1.000e-21UniRef50_A0A2G9XJL9 Uncharacterized protein n=1 Tax=Syntrophobacteraceae bacterium CG23_combo_of_CG06-09_8_20_14_all_50_8 TaxID=1974096 RepID=A0A2G9X  ali  27  1...................................................................................MKKRKIFLNFEDRRFREVWNKAVGPQIAAQSRPGQLRGETLFVKVSTSVWMQQLHFMKEEIIEKINQSLGKAVVKNIYFSIGEVSSSLKGGER........... 93
551 1.000e-21UniRef50_K2A3V5 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2A3V5_9ZZZZ  ali  22  5..................................................................RTQRQSFSSIGSLLKKKLAGPEHEPLQKTVALHQQWLKIVGPIISRHSRILYIKDGCLFVSVAHPAWHNELSLMKNQILKQIQEQLPDTKVTSIKFKTDAESQYEKGTKRT.......... 115
552 1.000e-21UniRef50_A0A1F3PQF5 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium RIFOXYA12_FULL_38_20 TaxID=1797368 RepID=A0A1F3PQF5_9BACT  ali  17  2....................................................................KKQDSQHINDVIQAYCKSMNIDKKMKEFMVIRIWEEFVGKMVAKATKDIYFHEGTMFVSLKSSIVRNELLMIRTELKKRINEQMGEEMIKEIVLR........................ 96
553 1.000e-21UniRef50_A0A1F9M0D6 Uncharacterized protein n=3 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A1F9M0D6_9DELT  ali  32  9..........................................................................RIDSLFAELFKKRQWDKRLALHAVFRNWSEVVGPEIAERTEPQVIRGTVLWIAVSDSVWMQQLHLQKQALLEHINANIGSEKISDVRFQIDAA.................... 102
554 1.000e-21UniRef50_A0A223S0V5 DUF721 domain-containing protein n=3 Tax=Nocardiopsis TaxID=2013 RepID=A0A223S0V5_9ACTN  ali  31  1............MDGDPAPSGADLARQALAQAKAAAKERGAAPTGRTRRTRRGRVRSR------------NEPQPFGEAVRAWLVEHGWQEQVAIGGVFGRWTEIVGEFNAQHLRPVSYEDGELVIAADSPTMAAHARAMVRDLLRRLNEELGDGTVHTIKVQ........................ 139
555 1.000e-21UniRef50_B8DV09 Uncharacterized protein n=22 Tax=Bifidobacterium TaxID=1678 RepID=B8DV09_BIFA0  ali  24  14.................................ERALPAEEFEHVSARAGLIAERRVKREEALENFGKPGRDEVAFGSLFAGIAKRAGWVPHMKLAQLRHDWASIVGDVIARNTWVGAIDNGVLTIHAKSPSWTTQLTFMLPELREKVLERLNGLDIRDIRVTGPQAHGPATRRK............ 155
556 1.000e-21UniRef50_A0A2A5XBQ1 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A2A5XBQ1_9BACT  ali  18  2....................................................................RRSKGQPIGEVIKELLKNYDITSKFNEAHIITSWDKLMGPSVTKYTVKIEVEKRILFVKLSNAALKQELSYARQKIKKMLNDEVGEEVLLDVRI......................... 95
557 1.000e-21UniRef50_A0A1W6HQ63 Uncharacterized protein n=1 Tax=Prosthecochloris sp. HL-130-GSB TaxID=1974213 RepID=A0A1W6HQ63_9CHLB  ali  24  4......................................................................KNPRKLDDIVREMCGVLGIDDAYEQHRITGLWPQIVGETIARISRVRHCKDGVLYVRVFDASWRQELRFRKSGIIRRMNQALEQQVIRDIVFQ........................ 96
558 1.000e-21UniRef50_W7YK03 Uncharacterized protein n=1 Tax=Saccharicrinis fermentans DSM 9555 = JCM 21142 TaxID=869213 RepID=W7YK03_9BACT  ali  19  3.....................................................................RKDAQHIKSIIKEYLSQRDLDHKMLENRVVRSWEKVIGKTVARATTNIYVYQGTLYLSINSSVMRNELLMLKDKIMQALNEEVGHQIVTAIVIR........................ 97
559 1.000e-21UniRef50_UPI000BEFCBE7 DUF721 domain-containing protein n=2 Tax=Streptomyces TaxID=1883 RepID=UPI000BEFCBE7  ali  30  2..........TSQPESKTAAGADLARQALAAYKATAPKQGAPKPRHRV-----------RRADRGAG---RDPVGLSGLLGHLNTEQGWELSLSAGSITDRWAALC-PELVGHVEPVAYDRGRLDLRPATHAYAAHLRLLGGQIAKRINDQLGRQVVRSIRPL-PVGP................... 145
560 1.000e-21UniRef50_A0A100Y044 Uncharacterized protein n=2 Tax=Streptomyces kanasensis TaxID=936756 RepID=A0A100Y044_9ACTN  ali  33  1.......................MARIALHQARAAAKARGQATRAPRRRPRPNAAL-----------PDRRDPAGFAVVLQHLMAERAWDMPAAGGTVLVQWPGIAAPTLPAHVQATGYDSGRLDLRPDSPAYATQLRLLTARIIATTNEHVGSSAVRALRVLPPGA.................... 138
561 2.000e-21UniRef50_A0A1Q3X3S0 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1Q3X3S0_9BACT  ali  23  5..........................................................................SIGEALNLLLERSKWKPKVTELRMREEWEAITSKTIAKYTRDVKLQNGVLTIYTDVAPLKQELFFGKEQLIRNINEYFKEMVVNDIVVK........................ 93
562 2.000e-21UniRef50_A0A2V3ABU0 Uncharacterized protein DUF721 n=3 Tax=Streptomyces TaxID=1883 RepID=A0A2V3ABU0_STRVZ  ali  29  1MTETTTPPFERPAVDGPELSGVDLARVALHQAREAAKKRGASEARAPRRRRARVSQ-----------RDGREPSGFAAVLQGLMADRAWALPAAGGTVLDRWPDIVAPQLPDHVQAVAFETGQLDLRPDSPAYATQLRLVSARIVAAANESASADAVRSVRVLVGAAPAPRH............... 167
563 2.000e-21UniRef50_C6W3E8 Uncharacterized protein n=10 Tax=Cytophagaceae TaxID=89373 RepID=C6W3E8_DYAFD  ali  18  4............................................................RFDKEKASRRPGVTPLKEAIDQMLDRYKLRSRFDQSYVVAHWDKIMGSAIATRTKKVYIKDGILFLQIESAPLRNELFRAKSKIIELINREMGSALVEDVIFV........................ 106
564 2.000e-21UniRef50_H2BR84 Uncharacterized protein n=12 Tax=Flavobacteriaceae TaxID=49546 RepID=H2BR84_9FLAO  ali  13  2..................................................................KKRYNENMKLSDALQDFVASNKLQTGLDKVNARDVWNAQMGPAIEKYTTSIKLDGSTLYVQLSSSVLREELSYGKEKIVKLLNEELGKNLITKLVLR........................ 98
565 2.000e-21UniRef50_A0A2D6JJX5 Uncharacterized protein n=1 Tax=Bdellovibrionaceae bacterium TaxID=2026715 RepID=A0A2D6JJX5_9PROT  ali  20  3.................................................................KKDRSKGFNQASDLIHNLFKKTALSQQFLRWKLWHHWREVVGENIGKNTDPVGYYRRTLYVWVKSSTWLQEMTFMEKVLVQKVNNYLGKEWVSRIRFT........................ 102
566 2.000e-21UniRef50_K1ZU76 Uncharacterized protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K1ZU76_9ZZZZ  ali  21  5....................................................................KDSNPTLIADILKSTLKNLNIEEKFKVYPLWKQWALVVGETVASKSSPDYIMASKLYVSVTSPAWIQELSFQKQLLLEKIRAFPQLPSISDIVFR........................ 99
567 2.000e-21UniRef50_Q11NR4 Uncharacterized protein n=2 Tax=Cytophaga TaxID=978 RepID=Q11NR4_CYTH3  ali  13  5..............................................................PERDFKRKKDSLSIGDAIENWMDQLRVRGKYKETYIIQNWEKIMGTPIAKRTTNLYIRNKKLYIHLSSAPLKHELNQSKHKVVELLNKASGDKVLEDVIFL........................ 105
568 2.000e-21UniRef50_UPI0005A88166 DUF721 domain-containing protein n=1 Tax=Streptacidiphilus neutrinimicus TaxID=105420 RepID=UPI0005A88166  ali  32  23.........EPAEPQEPVLSGIDLARVALYAAREAAHKNGTTPGKRTKRSTPVAAASRARGGD-------REPQGLAGALQRLIAERAWDLPVAGGTVVDAWPRIA-PDLADHVTAVGYDSGTLDLRPTSPAWATRLRLGSAELLRRIEAHTGNQAVRALRILTPG..................... 173
569 2.000e-21UniRef50_A0A2J0KQX2 Uncharacterized protein n=1 Tax=Candidatus Omnitrophica bacterium CG07_land_8_20_14_0_80_42_15 TaxID=1974741 RepID=A0A2J0KQX2_9BA  ali  22  3.....................................................................KKNPEPIKKIIDVLLENLKDQKILKEDIVRKVWEKAVGVKALKHTKVASLKSGRLVVEVDESAWIYQLTLKKSEILKKINKHLKDVDIKEIQFRI....................... 97
570 2.000e-21UniRef50_UPI0008311065 DUF721 domain-containing protein n=2 Tax=Rufibacter TaxID=1379908 RepID=UPI0008311065  ali  16  2....................................................................RKADTISLKDSIESMLKAYKLNGKLSEVQLVSSWEKIMGKAIALKTQEVFVRNRKLFVRLTSAPLKHELNMAKAKVVSLINSEMGEQVIDEVVFL........................ 96
571 2.000e-21UniRef50_B8E2H8 Uncharacterized protein n=3 Tax=Dictyoglomus TaxID=13 RepID=B8E2H8_DICTD  ali  23  2........................................................................PDSLYSKLWEVFIKLNLEKKLCEYLAMDKWEEVVGETLSQHTKPAYVREGVLYVYVDSSVWVQELSLFKDKLIEKLNSMIIPHVIKDIVFI........................ 93
572 2.000e-21UniRef50_F8EMV8 Uncharacterized protein n=2 Tax=Runella TaxID=105 RepID=F8EMV8_RUNSL  ali  18  11...................................................................ARRPGVTTVGDAIHKMLEMYRLRPQFDESSVKVYWEKLVGKEIASRTSDIYVKDKVLFLRLDSAPLANELVIAKRKLIQSLNDSFGYELIVDIVFI........................ 106
573 2.000e-21UniRef50_A0A1W9QPS7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium 4484_249 TaxID=1970778 RepID=A0A1W9QPS7_9BACT  ali  20  11....................................................................KNSNEQTLKEAINELLKSYKLENGVNNSRLIKSWDDVTGDMISKHTEQIFIKKTTLYVKLDSPALKHELSFARSKLIKLLNKSVNRNIIEEIVFL........................ 105
574 2.000e-21UniRef50_A0A1E5Q8Y5 Uncharacterized protein n=2 Tax=Magnetovibrio blakemorei TaxID=28181 RepID=A0A1E5Q8Y5_9PROT  ali  25  4.........................................................................................QHGFTHGAIVTKWPEIVGDVMARHTQPEKISGGVLHLKTDSGAFATELQHKEPLIVERINTFFGYRAVERIKLIQGPLPTTKAGPQGSPPRP...... 102
575 3.000e-21UniRef50_Q6MHW6 Uncharacterized protein n=7 Tax=Bdellovibrio bacteriovorus TaxID=959 RepID=Q6MHW6_BDEBA  ali  25  3.................................................................PKQKPKGKLSIGEVLQRLFEKSPLSEQFMRWKLWAKWEEVVGPTIAKNAEPVGFQRGVLYVWVRNSSWMQQMIFMKDPIRDTINQKFENNFVKYIKFT........................ 103
576 3.000e-21UniRef50_Q82YE7 Putative Tra3 homolog n=1 Tax=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 81  ali  27  2............MTETPQLSGVDLARVALRAAKVAAQKNGG-----------GRTAQPKPRTTRVVRRDGREPMGLGAAISALVTERAWELPAAGASLRARWEAIAPDFGHVVAVGCDADSGRLTVCPESAAWATKLRLEQARVVEAANESAGRTVVRGLRILAPGSVPVSEPADVTPESG...... 159
577 3.000e-21UniRef50_A0A2E3NLU4 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2E3NLU4_9DELT  ali  22  2.........................................................................EPVGDLVGKVLGELGLDGVALAHQIGSEWPEIVGEQVAAHCRPLGLRAGVLEVEVDSPVWSQQLQLRKMEILENLRGRYERQAPREVRFQVGYGRAR................. 98
578 3.000e-21UniRef50_A0A2N2FTI9 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-4 TaxID=2013754 RepID=A0A2N2FTI9_9DELT  ali  24  6.................................................................RRNRMFHPAAAGAVLDALTRNMGVRERLEPYRAWKVWAEVVGPQTAQHAQPFRLRGGVLEVRVDHPVWMQQLQLLKPRILERLNRAIAPGVLEDIHLRHGQP.................... 107
579 3.000e-21UniRef50_A0A2E2FEJ3 Uncharacterized protein n=1 Tax=Crocinitomicaceae bacterium TaxID=2026728 RepID=A0A2E2FEJ3_9FLAO  ali  25  9.........................................................................QSLEQAIQAYLEFYKLSGKLTEVDLRNSWSAIMGPSIARHTTEIYLKKXXLVVHLDSSVIRNELSYAKEKIVXKINEHFGREVIEEV.....