current user: public

If you have questions about the server, please let us know.

Query: gi|15607161|ref|NP_214533.1| hypothetical protein (Rv0019c) [Mycobacterium tuberculosis H37Rv], from M.tuberculosis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .
# E-value Template Links and tools%idFirst MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGLALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRHARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRPLast
1 3.000e-47UniRef50_P9WJB4 FHA domain-containing protein FhaB n=345 Tax=Bacteria TaxID=2 RepID=FHAB_MYCTO  ali  100  1MQGLVLQLTRAGFLMLLWVFIWSVLRILKTDIYAPTGAVMMRRGLALRGTLLGARQRRHAARYLVVTEGALTGARITLSEQPVLIGRADDSTLVLTDDYASTRHARLSMRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVRIGKTAIELRP 155
2 1.000e-45UniRef50_A0A1F2Y9N3 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_19FT_COMBO_70_19 TaxID=1797208 RepID=A0A1F2Y9N3_9ACTN  ali  36  1MSPFVLSVLKYSLLALLYFFIYRAVRSVAVDLSG--RRAAPGQEPAPRVAKPKPPRGGRAPTMLVVHAPARKPRSFRLSGG-LEIGRAEACQVRLDDTYASQHHAKLSARDGTWILEDLGSTNGTFVNDHRVTAPVEVHAGDVVKIGKTVLELR. 152
3 3.000e-44UniRef50_I0V2A4 FHA domain-containing protein n=56 Tax=Actinobacteria TaxID=201174 RepID=I0V2A4_9PSEU  ali  60  1MPELVVQLTRVGFLVLLWMFVFAALRVVRSDLYAASGLRVNLPSLRRGKKEKKPLRGRNKLPRLVVTHGALAGTRIALDGRPILIGRADDSTLVLDDDYASTRHARLSLRGDEWYVEDLGSTNGTFLDRAKVTAPLKVPLGVPIRIGKTVIELRP 156
4 1.000e-43UniRef50_A0A212LR82 Forkhead-associated (FHA) domain-containing protein n=2 Tax=Sporomusa TaxID=2375 RepID=A0A212LR82_9FIRM  ali  21  9..NIVVIALQYSLVILLYYFLYHVIKIAVKDL--TGLSDPVKNTVLVSSELQAAAGSDTPPPRLVVIADKQAQTSFVI-SDSLTIGRSEHNDLVINDSFVSHEHACISKSKHNYLLADLSSTNGTLVNGQPIEEEIALADGDVIQIGAVTLTFE. 160
5 9.000e-43UniRef50_A0QNG6 FHA domain-containing protein FhaB n=287 Tax=Actinobacteria TaxID=201174 RepID=FHAB_MYCS2  ali  88  1MQGLVLQLTRVGFLLLLWLFIWSVLRILRTDIYAPTGAVMVRRGLALRGSLLPNRQRRHVARQLVVTEGALAGTRITLGNQPVLIGRADDSTLVLTDDYASTRHARLSPRGSEWYVEDLGSTNGTYLDRAKVTTAVKVPIGAPVRIGKTVIELRP 155
6 1.000e-42UniRef50_C0XT60 Oxoglutarate dehydrogenase inhibitor n=10 Tax=Actinobacteria TaxID=201174 RepID=C0XT60_CORLD  ali  27  8......................PETQVETTSVFRADLLKEMESGAASSNAATGAENLPEGAALLVVKRGPNAGARFLLDQDTTTAGRHPEADIFLDDVTVSRRHAEFRRNDGSFEVVDVGSLNGTYVNREP-RNSQTLAAGDEIQIGKFRLVF.. 137
7 3.000e-42UniRef50_A0A1Q6XH21 Uncharacterized protein n=3 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A1Q6XH21_9ACTN  ali  32  8.VEELLLVLKIAFVVLLYLFIWRIVRTASKDLRVPQESFILAPSQAGDLATLRDPGPRE-VGRLVVVSSPEPGEGRMLDSVAITVGRGPQNDVALDDDYASAKHARIEPRGDGVWVKDVGSTNGTYLNGIKLTRARKLTPGDVVRVGETELRYE. 162
8 5.000e-42UniRef50_A0A1F2WJA5 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_13_55_18 TaxID=1797197 RepID=A0A1F2WJA5_9ACTN  ali  29  1MPEIVYVTLRFAFLGLLYIFVFLVARLLYRELRPAPARQPSSQHRHERMGKKP-----------ILVAFDERGRKTRLNGDQVVLGRAADCGVALKDEFASNQHAKIYQSEGRYYVEDLGSTNGTYINGRRINYPTELRSGDSIKIGRTVLEFR. 146
9 6.000e-42UniRef50_A0A200HJQ4 FHA domain-containing protein n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A200HJQ4_9ACTN  ali  42  1MSELTLTLIKFGFLAVLWIFVLSAVSVIRTDIFGTRVPTRPVAKAAKAGKTPTPRGLRGRPSVLQIVEGPNAGQSVPLGDEPLLLGRGTDAAIRLNDDYVSTRHARFASNGEQWFVEDLGSTNGTYIGSQRITSPVPVPIGTQVRLGKTIVELR. 164
10 7.000e-42UniRef50_A0QYG2 Glycogen accumulation regulator GarA n=301 Tax=root TaxID=1 RepID=GARA_MYCS2  ali  33  34........................................APAAAGTEGAVSGVEGLPSGSALLVVKRGPNAGSRFLLDQPTTSAGRHPDSDIFLDDVTVSRRHAEFRLEGGEFQVVDVGSLNGTYVNREPVDSAV-LANGDEVQIGKFRLVF.. 145
11 7.000e-42UniRef50_A0A2G4H3W1 Uncharacterized protein n=2 Tax=Thermoleophilia bacterium TaxID=2026888 RepID=A0A2G4H3W1_9ACTN  ali  29  1MVDQALLLLRIGVLVLLYLFVWRIARTAIRDVRGSAESMILSPGHGFDRQPAPVAALPAMPGRLVVVASDPIGAAVVLDQPEVLLGRDPHAAAVLDDGFVSGRHAMVRLRGGAPTVTDLGSTNGTYVNGNRIAAETHLQEGDEIAVGSTRMIYEP 160
12 8.000e-42UniRef50_A0A0F2NJC7 Uncharacterized protein n=2 Tax=Clostridia TaxID=186801 RepID=A0A0F2NJC7_9FIRM  ali  25  1MLDLILTVFRYIFLIMLYVFIFQLIRMMFLDLRSGEVMKEAVGKKAAEPLPVEIKPLPGSVAGLVVLSGLTPGSVFSLPEDQATLGRSSKNTITMVDPFASMDHAAVYGSDGQYWIEDRGSKNGTFLNDVRIKKPTVLADKDKIRIGDVSMQF.. 158
13 1.000e-41UniRef50_A0A076JKF3 FHA domain protein n=131 Tax=Bifidobacteriales TaxID=85004 RepID=A0A076JKF3_BIFAD  ali  31  2LTELTFAILKYGFLVLLWIFVACTVRSLYRDIETLSPRKSRAHRRKERAARKAVESPAAKPTLLVIIDGPLAGSSVPLAGNTITLGRSASNTVVLDDEFVSSHHARVYTDPGRWAIEDLGSTNGTVVNHQRLNAPMILGARVPVRIGATTFELR. 171
14 2.000e-41UniRef50_Q4JVU0 Oxoglutarate dehydrogenase inhibitor n=132 Tax=Terrabacteria group TaxID=1783272 RepID=ODHI_CORJK  ali  26  8......................PEASVETTSVFRADLLKEMESGSQHDASPAGVEGLPEGSALLVVKRGPNAGSRFLLDQETTAAGRHPDSDIFLDDVTVSRRHAEFRRNGDQYEVVDVGSLNGTYVNREP-KNSSVLSNGDEIQIGKFRLVF.. 137
15 2.000e-41UniRef50_A0A2X3B752 FHA domain-containing protein n=33 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2X3B752_9CLOT  ali  28  8......................PEASVETTSVFRADLLKEMESGAGQDTAVPGVEGLPAGSALLVVKRGPNAGSRFLLDQPVTTAGRHPDSDIFLDDVTVSRRHAEFRMEGDKFEVVDVGSLNGTYVNREP-KNSADLSNGDEVQIGKFRLVF.. 137
16 2.000e-41UniRef50_A0A2C9SQM3 FHA domain-containing protein FhaB n=15 Tax=Actinobacteria TaxID=201174 RepID=A0A2C9SQM3_9MYCO  ali  87  1MQGLVLQLTRAGFLLLLWLFIWSVLRILRNDIYAPTGAVMVRRGLALRGTLLPPRQQRHSARYLVVTEGTLAGTRITLGSQPVLIGRADDSTLVLTDDYSSTRHARLSPRGSDWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPVHIGKTVIELRP 155
17 2.000e-41UniRef50_D1BI26 FHA domain-containing protein n=27 Tax=Actinobacteria TaxID=201174 RepID=D1BI26_SANKS  ali  42  1MNELTITLLRLGYLVLLWLFVYSVVRVLRHDLYGTRGARETSVGKVAAPAPAAPAQSKNRPTRLVVSEGPLRGTTLPLTSSAILIGRAPSCTLVLDDDYSSSRHARIFPSGDQWILEDLGSTNGTFIGNQRVSSPTPLSPGTQVRIGQSVVELQ. 159
18 6.000e-41UniRef50_A0A2C9SQ06 Glycogen accumulation regulator GarA n=126 Tax=Actinobacteria TaxID=201174 RepID=A0A2C9SQ06_9MYCO  ali  32  35........................................APATTTGESAVSGVEGLPVGSALLVVKRGPNAGSRFLLDQPTTSAGRHPDSDIFLDDVTVSRRHAEFRLDGNEFQVVDVGSLNGTYVNREPVDSAT-LANGDEVQIGKFRLVF.. 146
19 7.000e-41UniRef50_A0A0S1T1T3 Conserved protein of uncharacterized function with Fha domain n=123 Tax=Actinobacteria TaxID=201174 RepID=A0A0S1T1T3_9MYCO  ali  30  16..........................AETTSVFRADFATELEAPAQAGADVSGVEGLPAGSALLVVKRGPNAGSRFLLDQATTSAGRHPDSDIFLDDVTVSRRHAEFRLDSAEFQVVDVGSLNGTYVNREPVDSAV-LANGDEVQIGKFRLVF.. 141
20 1.000e-40UniRef50_A0A098BGV7 Glycogen accumulation regulator GarA n=28 Tax=Corynebacteriales TaxID=85007 RepID=A0A098BGV7_9NOCA  ali  28  18..........................SVFRADFLNELDTTGTGAGTTEAPVSGVEGLPTGSALLVVKRGPNAGSRFLLDQPTTSAGRHPDSDIFLDDVTVSRRHAEFRQDEGEFQVVDVGSLNGTYVNREPVDSAV-LANGDEVQIGKFRLVF.. 143
21 1.000e-40UniRef50_A0A101E7Q5 FHA domain containing protein n=1 Tax=Clostridia bacterium 41_269 TaxID=1635275 RepID=A0A101E7Q5_9FIRM  ali  26  5...LTLTVLRYTFLVLLYIFVFTVVRHMFKGTKEKPKTYMPQRQTAMGSENFSVKTGTSSAPRLISLK-PLPGNRFYLN-GRTTIGSGRNNNIVIKSPYVSREHAVIFKRGDQYWLQDLDSKNGTYLNGFPVKNPTVLAHGDHLSFGGADFKF.. 155
22 2.000e-40UniRef50_Q8NQJ3 Oxoglutarate dehydrogenase inhibitor n=506 Tax=root TaxID=1 RepID=ODHI_CORGL  ali  27  8......................PEPQVETTSVFRADLLKEMESSTGTAPASTGAENLPAGSALLVVKRGPNAGARFLLDQPTTTAGRHPESDIFLDDVTVSRRHAEFRINEGEFEVVDVGSLNGTYVNREP-RNAQVMQTGDEIQIGKFRLVF.. 137
23 2.000e-40UniRef50_A0A170QFM6 FHA domain protein n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A170QFM6_PROFR  ali  27  3..................................PIVEEDVPHAEISAEDTAAVSALPEGNALLIVTRGPDVGARYLLDQPQTTAGRSPDCDIFLDDITVSRHHAKFTMQDGQMTITDLGSLNGTYVNRTLVDGSAVLRPGEEVQIGKFRMVF.. 121
24 2.000e-40UniRef50_A0A1F2WGD8 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_13_55_18 TaxID=1797197 RepID=A0A1F2WGD8_9ACTN  ali  29  52...................................................APPASLQKGSAMLVIKKGPDAGMSFTISRDVISIGRHPESDIFLDDITVSRRHAELHLKEGDFSLKDTGSLNGTYLNHERI-ESVELASGDEIQIGKFHLLF.. 152
25 3.000e-40UniRef50_E2MXN9 Oxoglutarate dehydrogenase inhibitor n=197 Tax=Actinobacteria TaxID=201174 RepID=E2MXN9_CORAY  ali  26  8......................PEASVETTSVFRADLLKEMESSSNTDSTVSGVEGLPAGSALLVVKRGPNAGSRFLLDQAVTTAGRHPDSDIFLDDVTVSRRHAEFRKNGDSYEVVDVGSLNGTYVNREP-KNSAVLANGDEVQVGKFRLVF.. 137
26 7.000e-40UniRef50_L7V727 Forkhead domain protein n=63 Tax=Actinobacteria TaxID=201174 RepID=L7V727_MYCL1  ali  33  35........................................APTQSGTESSVSGVEGLPAGSALLVVKRGPNAGSRFLLDQPITSAGRHPDSDIFLDDVTVSRRHAEFRLEGNEFSVVDVGSLNGTYVNREPVDSAV-LANGDEVQIGKFRLVF.. 146
27 1.000e-39UniRef50_UPI000477F1EA FHA domain-containing protein n=1 Tax=Alloscardovia criceti TaxID=356828 RepID=UPI000477F1EA  ali  33  1MTDLTFAILKYGFLLCLWIFVWLTVRAINRDVATLAPPNPINAHEAAPVRMHSSASASAGPAVLTIIDGPLSGTTTSLSNAPITLGRAANNTLVLDDEFVSSHHARVYFDAGQWAVEDLDSTNGTKVAGQPIHSACLLSPGVPVRIGATTFELR. 202
28 1.000e-39UniRef50_A0A259UQ22 FHA domain-containing protein FhaB n=2 Tax=Sporomusa TaxID=2375 RepID=A0A259UQ22_9FIRM  ali  20  9..NVLVVGLQYTLVILLYYFLYRIVKTVRYDLTRLTIDMPEVSFV--RDNDKLEKGSLERPPRLIVVEGLLSQSVF-IISDNVTIGRSQHNTIVINDNFISHEHACISESKHNYLLTDLNSTNGTLVNGQRIKDETALADGDVIKLGAVTLKFE. 160
29 2.000e-39UniRef50_A0A1H9QMQ1 Inner membrane component of T3SS domain-containing protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1H9QMQ1_9ACTN  ali  31  3..................................PAIEEDAPRTEISAEDTAAVSALPEGNALLIVTRGPDVGARYLLDQQQTTAGRSPDCDIFLDDITVSRHHARFDMVGGEVRITDLGSLNGTYVNRTLVDGSAVLRPGEEVQIGKFRMVF.. 121
30 2.000e-39UniRef50_A0A2M7ACV5 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28 TaxID=1973917 RepID=A0A2M7ACV5_9BACT  ali  27  2..QLFSFAAQYLLIAALYYFLFQLVAVLRDGLHRVDNLQSGEGSVARPSATSTEDGE------LVVVQGGRKGERFTLKKQSVSLGRTDENDIVVDDPYASKRHAAIRRLRGVHQIADLGSSNGTLLNGRLVTEPVELKSGDRIQIGDAILRYE. 149
31 3.000e-39UniRef50_A0A2M7KPN3 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 TaxID=1973912 RepID=A0A2M7KPN3_9BACT  ali  27  13...QLVVVLRYLLPALLFLFVLQVVRTMAADLRR-------------SGRGDTAGGATAGPADLVVIQGPAAGERFRLRSDSILLGRDSSAEVVLVDQYASSRHAQIDRHEGRFYLTDLDTTNGTLLNGHRLKEPTYLAEGDEIEIGEIVFRFE. 152
32 4.000e-39UniRef50_Q8FTJ5 Oxoglutarate dehydrogenase inhibitor n=11 Tax=Actinobacteria TaxID=201174 RepID=ODHI_COREF  ali  30  27..........................................SGAGSAPAATGADNLPAGSALLVVKRGPNAGARFLLDQPTTTAGRHPESDIFLDDVTVSRRHAEFRINEGEFEVVDVGSLNGTYVNREP-RNSQVLQTGDEIQIGKFRLVF.. 136
33 4.000e-39UniRef50_D5NUU6 Oxoglutarate dehydrogenase inhibitor n=10 Tax=Actinobacteria TaxID=201174 RepID=D5NUU6_CORAM  ali  31  44........................................................LPEGQALLVVKRGPNAGARFLLDQPTTTAGRHPEADIFLDDVTVSRRHAEFRVDGDKFEVVDVGSLNGTYVNREP-RNSQELEVGDEIQIGKFRLVF.. 139
34 4.000e-39UniRef50_S3Y7K4 Uncharacterized protein n=10 Tax=Actinobacteria TaxID=201174 RepID=S3Y7K4_9MICO  ali  27  92.................YLFVGNVTVALKRDDDVKAGRFETESSTERSSLAPATTGGENFQPILEI-----DGQQYLLTGRVTVIGRGGDSDIILDDTGVSRHHLELRVDGTSMTATDLGSTNGTFVNGERITTPTGLPDGATIRIGRTRLTV.. 222
35 5.000e-39UniRef50_B0K788 FHA domain containing protein n=19 Tax=Thermoanaerobacteraceae TaxID=186814 RepID=B0K788_THEP3  ali  23  3.YAIASQILKYVLIFLIYLFLYRVFKIVYMDIKGVRYERQITA------------------AKLSFLNGE---RTFNLFE-VTTIGRSEECDIVIESPYVSARHAIIRKRGKRFYIQDLNSTNGTFINGKRIKGIAKIRNNDVITLGDVDLKF.. 132
36 6.000e-39UniRef50_A0A263D3M5 Peptide-binding protein n=1 Tax=Amycolatopsis antarctica TaxID=1854586 RepID=A0A263D3M5_9PSEU  ali  29  15...............................IEPTSRLIPHPAGAAAQPPVAEPEVPPVTSAALVVTRGPLQGERFELTAGRASLGRHPECDIVLDDSTVSRRHAEVREEGGGYVIVDTGSLNGTYVNRQPVDRAQ-LADGYVIWIGKFRLSFH. 139
37 7.000e-39UniRef50_E0DES1 Oxoglutarate dehydrogenase inhibitor n=23 Tax=Actinobacteria TaxID=201174 RepID=E0DES1_9CORY  ali  28  10........................VQVETTSVFRADLLKEMESGAAAPATGSDIT-PPAGAAILIVKRGPNAGARFLLDQETTTAGRHPESDIFLDDVTVSRRHAEFRLNDGTFEVVDVGSLNGTYVNREP-RNSQVLSIGDEIQIGKFRLVF.. 136
38 7.000e-39UniRef50_A0A0F9RLT6 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9RLT6_9ZZZZ  ali  31  1MINLVLFSLKFVFLGLLYLFIFLLVRSIMNDTKLAAADVIDEP----------------KPAKLVLNFGDKNSKTFNLT-DKVIIGRSEGADIQLEDSFASSSHAKLQKQGATYVVQDLKSTNGTLLNGNKIKKET-LNSGDEIKIGKNKFKF.. 135
39 8.000e-39UniRef50_A0A0E3N7Q0 Oxoglutarate dehydrogenase inhibitor n=16 Tax=Corynebacteriales TaxID=85007 RepID=A0A0E3N7Q0_CORUL  ali  26  10........................VQVETTSVFRADLLKEMESGANATPATGSDVTPPSGSGMLVVKRGPNAGARFLLDRETITAGRHPESDIFLDDVTVSRRHAEFRLQDGSFEVVDVGSLNGTYVNREP-RNSEILSSGDEVQIGKFRLVF.. 137
40 8.000e-39UniRef50_A0A1G1H103 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RBG_19FT_COMBO_42_15 TaxID=1801709 RepID=A0A1G1H103_9BACT  ali  25  16.......................................EEDDTSGRTKAMPSIKGARAGRAYLVVVKGENFGEEHEFKEKDMIIGRSSSNDIVIKDEGVSRKHCAIEPATNSYVLKDLKSTNGTFLNDKKITSPSVLKHGDKITVGKTILQF.. 129
41 1.000e-38UniRef50_A0A1F1K1W0 Uncharacterized protein n=3 Tax=Kytococcus TaxID=57499 RepID=A0A1F1K1W0_9MICO  ali  26  13.....................GPATSRIDLATGSPVPTHPRTPVAMTDVDAQMIAALRPGTALLLIPAGASAGARYLLDEPETTVGRAADADILLDDVTVSRHHARFVLSQEGCRLVDSKSTNGTYVNGEPV-EQVDLQEGDEVQIGKYRLVFHP 145
42 1.000e-38UniRef50_A0A1M3KGJ4 Uncharacterized protein n=6 Tax=Chloroflexi TaxID=200795 RepID=A0A1M3KGJ4_9CHLR  ali  31  6..............................................................QLVIRKGANPGQTFPIDLTEMYIGRDLGCEIVINDTEVSRRHAKIYVQGSGFVIEDLGSTNGTFVNGQRITGPHVLVPGEEIALGDTTLLFE. 98
43 1.000e-38UniRef50_A0A2C6L297 Signal peptide protein n=1 Tax=Desulfotomaculum profundi TaxID=1383067 RepID=A0A2C6L297_9FIRM  ali  28  132......................PVVRRDQPDFAQDNQDTRDYRPLTDTAPIPNLQQ--HCSATLLVEEGNDAGKEFPLTDYRTSLGRRDTCDIVLSDTSVSRRHAQFEKIGGRFWLTDLNSTNGTYVNGLPVDK-VELTTGDVITVGNTVLIFK. 260
44 1.000e-38UniRef50_A0A0Q5VD52 Uncharacterized protein n=10 Tax=Bacteria TaxID=2 RepID=A0A0Q5VD52_9ACTN  ali  29  7................................SEDSGEVPEVVESPADAHAGAVESLPAGSALLVVKRGPNAGSRFLLDQEVTTAGRHPDSDIFLDDVTVSRRHVEFHREGGGFTVHDVGSLNGTYVNREPVDVA-SLAGGDEVQIGKFRLVY.. 126
45 1.000e-38UniRef50_Q6NHD4 Oxoglutarate dehydrogenase inhibitor n=67 Tax=Bacteria TaxID=2 RepID=ODHI_CORDI  ali  28  10........................VQVETTSVFRADLLKEMESGAGAATASGSDVTPPAGAGMLVVKRGPNAGARFLLDRPTTTAGRHPESDIFLDDVTVSRRHAEFRRQDGSFEVVDVGSLNGTYVNREPRNSEV-LSSGDEVQIGKFRLVF.. 137
46 1.000e-38UniRef50_A0A0U1CWH0 FHA-domain-containing protein n=3 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A0U1CWH0_9MYCO  ali  82  1MQGLVLQLTRVGFLLLLWLFIWSVLRILRTDIYAPTGAVMVRRGLALRGSLLPSRDGRHIARQLVVTEGALAGTRITLGTQPVLIGRADDST............................................................... 92
47 3.000e-38UniRef50_A0A2H6HGM4 FHA domain-containing protein FhaB n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H6HGM4_9BACT  ali  30  1MPALFLNILKLIFLALVYLFLWQIARSIGAHVGPGQRSKKTKVADELA----------------VIRSETMAGQTIRIGAG-IVIGRSEEANFVIDDTYASDFHARIGQQQDKVLLTDLGSTNGTYVNGRRITVPTSLGKGDTVQIGKTIFEVR. 137
48 4.000e-38UniRef50_J0XDL9 FHA domain protein n=7 Tax=Actinomyces TaxID=1654 RepID=J0XDL9_9ACTO  ali  43  26.........................RTLRRDTAEASSPTPRRRFSREKNTPAAAPGRRRGATRLIITEGPLAGSMVPLTPTSITIGRDQNCTLVLNDSYASSHHARVFPKDGSWWLEDLNSTNGTTLAGRPVHGAVELPVGVPVRIGQTTLELRP 157
49 4.000e-38UniRef50_D2Q4C2 FHA domain containing protein n=12 Tax=Actinobacteria TaxID=201174 RepID=D2Q4C2_KRIFD  ali  27  75.................................EPDTERVDLGESLSAEDEAAVGALPAGSALLIVQRGPNAGSRFLLDVDVVTAGRHPDSDIFLDDVTVSRRHAEFRRDPAGVKVRDVGSLNGTYVNRDRIDE-VLLNNGDEVQIGKYRLVY.. 193
50 4.000e-38UniRef50_A0A2I2KIR4 Glycogen accumulation regulator GarA n=19 Tax=Frankia TaxID=1854 RepID=A0A2I2KIR4_9ACTN  ali  28  53.....................................EGDHVDESTERDAVAAVDALPPGSALLVVKRGPNAGSRFLLDADLTTVGRHPESDIFLDDVTVSRRHAEFHRSPKGFSVRDVGSLNGTYLNRERIDSA-ELTSGDEVQIGKFRLVF.. 169
51 5.000e-38UniRef50_C7LZA0 FHA domain containing protein n=1 Tax=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) TaxID=525909 Rep  ali  22  33..........................AAITDDDRGDVTGTLAIDAIEHLAEEAPSGPTTTTPVLLLRSGPQAGSWFALDRDVVTVGRHPDSDVFLNDVTVSRRHAEIRREGDAYVLYDAGSLNGTYVNHER-HERAPLHHGAEIQIGRFRFTF.. 158
52 5.000e-38UniRef50_A0A1B9EK96 Glycogen accumulation regulator GarA n=209 Tax=Actinobacteria TaxID=201174 RepID=A0A1B9EK96_9ACTN  ali  25  46..............................EAYEAEATGQTALPSLSPEAQAAVDALPAGSALLVVRRGPNSGSRFLLDSDLTTAGRHPQSDIFLDDVTVSRRHVEFRRSEGSFTVGDVGSLNGTYVNRERIDS-VPLSNGDEVQIGKYRLVF.. 168
53 5.000e-38UniRef50_A0A1Y2N6K8 Glycogen accumulation regulator GarA n=18 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y2N6K8_PSEAH  ali  30  10......................PPERAPETTSVFRADFLADVEQPSAEPAVSGVDGLPAGSALLVVRRGPNAGSRFLLDVPTTSAGRHPDSDIFLDDVTVSRRHAEFRRDAGEFVVVDVGSLNGTYVNREPVDTAV-LANGDEVQIGKFRLVF.. 139
54 1.000e-37UniRef50_I4EXI6 Uncharacterized protein n=23 Tax=Actinobacteria TaxID=201174 RepID=I4EXI6_9ACTN  ali  26  92....................VGESTSIIPKVGGEDSGEQAEIAESTADAHAGAVESLPAGSALLVVKRGPNAGSRFLLDQEVTTAGRHPDSDIFLDDVTVSRRHVEFHREGGGFTVHDVGSLNGTYVNREPVDVA-SLAGGDEVQIGKFRLVY.. 223
55 1.000e-37UniRef50_A0A0U1L6S3 FHA-domain-containing proteins n=3 Tax=Sporomusaceae TaxID=1843490 RepID=A0A0U1L6S3_9FIRM  ali  17  8.LNIVVIALQYSLVVLLYYFLYRVVKLAARDLNRLAFDDPDDSVVHDTRISDADF---SSHPRLIVIDDHQESQTFFTIIDSLTIGRSQHTNVVIDSSFVSHEHACISRVKQNYLLADLNSTNGTLVNGQQVEEEIALVDGDIIQIGAVTLKFE. 159
56 1.000e-37UniRef50_A0A0M9Y9M4 Uncharacterized protein n=620 Tax=Actinobacteria TaxID=201174 RepID=A0A0M9Y9M4_9ACTN  ali  25  50..............................EAYDAEVTGQTQLPSLSPEAQAAVDALPQGSALLVVRRGPNSGSRFLLDGELTTAGRHPQSDIFLDDVTVSRRHVEFRRGDGRFTVSDVGSLNGTYVNRERIDS-VDLANGDEVQIGKYRLVF.. 172
57 1.000e-37UniRef50_A0A177HXT7 Glycogen accumulation regulator GarA n=91 Tax=Actinobacteria TaxID=201174 RepID=A0A177HXT7_9ACTN  ali  25  48..............................EAYDAEVTGQTPSPMLSPEAQAAVDALPFGSALLVVRRGPNSGSRFLLDGELTTAGRHPQSDIFLDDVTVSRRHVEFRRGADGFTVADVGSLNGTYVNRERIDS-VVLSNGDEVQIGKYRLVF.. 170
58 2.000e-37UniRef50_D5X7S0 FHA domain containing protein n=2 Tax=Thermincola TaxID=278993 RepID=D5X7S0_THEPJ  ali  21  6....IFLGMKFVVLFFIYLFVFKVVAMIARDIKGKTSGGSHEQSLADYAGQELGEAY-GLMAIQSIVDDIKVGMQYPVKR-YMQIGRSAENSLRINDAFVSHEHARIYYRDGRYWIEDLNSRNGTLLDGKRIDRPVPLDEGALLSIGGVTFKV.. 152
59 2.000e-37UniRef50_S2WWP7 Uncharacterized protein n=7 Tax=Actinobacteria TaxID=201174 RepID=S2WWP7_9ACTN  ali  28  40.................................EDEARDDIRTVELSPEDANAVRDLPENSALLIVTRGPDVGARYLLDSDEVTVGRSPKSDIFLNDITVSRHHAKFTMNNGSVVLVDQHSHNGTYVNRTLVDQQVTLRQGDEVQIGKYRMLF.. 159
60 2.000e-37UniRef50_F3P6N6 FHA domain protein n=58 Tax=Terrabacteria group TaxID=1783272 RepID=F3P6N6_9ACTO  ali  41  26......................RVMRRDMADSPVAAPSRRRSANASEQPAGPPPRGRRRSATRLVITEGPLAGSTVPLSPSSIIIGRSPSCTLVLDDSYASSRHARVFPKDGAWWLEDLGSTNGTMMDGRPVHGAVELPMNIPVRIGQTTLELR. 157
61 2.000e-37UniRef50_A0A1G6GPG7 Forkhead associated (FHA) domain, binds pSer, pThr, pTyr n=2 Tax=Propionibacteriaceae TaxID=31957 RepID=A0A1G6GPG7_9ACTN  ali  24  23......................RLVTASEATKVIPIVPDEDEAGELNPEEKAAVSALPQGSSLLVVRRGPNVGARFLLDRDEITAGRHPHSDVFLDDITVSRHHVKFLRVGDQVLLRDVGSLNGTYVNRSLVDGDILLQDGDEVQIGKFRMVY.. 153
62 2.000e-37UniRef50_A0A1F2WUQ6 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_16_64_13 TaxID=1797200 RepID=A0A1F2WUQ6_9ACTN  ali  27  1MLQIVLLAGKFAFLIILYLFIYRVVRSSTRELRMSAPGAGKQQWSEAGGTLVPGGGPAAVAATLIVEKSPQAGTVFAFPPGVHAIGRSSDMDIYLDDTFVSSKHALFETTPSGLQVEDLHSTNGTQVNGAEVAGTRLLKVGDRVEVGDTIFKVE. 165
63 2.000e-37UniRef50_UPI0009FB3108 glycine cleavage system protein GcvH n=1 Tax=Pseudonocardia sp. CNS-004 TaxID=1904967 RepID=UPI0009FB3108  ali  30  183......................PPERSPETTSVFRADFLSEAEPTAQDQPVSGVESLPAGSALLVVKRGPNAGSRFLLDWASTSAGRHPDSDIFLDDVTVSRRHAEFRSDAGEFVVVDVGSLNGTYVNREPVDTAV-LANGDEVQIGKFRLVF.. 312
64 3.000e-37UniRef50_A0A1V1RFF5 Glycogen accumulation regulator GarA n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A1V1RFF5_9ACTN  ali  32  33........................................EPVGSAASGTPSGVAAEPDRAPVLVVQKGPDAGERFYLESPRLTIGRNPASDIFLNDVTVSRAHAVIEVGPNGVTIEDVGSLNGTYVGGVRVDKAA-LKHGDLVQIGRFQLLF.. 144
65 3.000e-37UniRef50_L7L4I7 Signal transduction protein GarA n=59 Tax=Bacteria TaxID=2 RepID=L7L4I7_9ACTN  ali  33  28........................................DAPATAAEPTDTGVERLLPGTALLVVKRGPNAGSRFLLDQATTSTGRHPDSDIFLDDVTVSRRHAEFRLAGTDFKVVDVGSLNGTYVNREPVDDAV-LTSGDEVQIGKFRLVF.. 139
66 3.000e-37UniRef50_UPI0002629696 FHA domain-containing protein n=1 Tax=Brachybacterium squillarum TaxID=661979 RepID=UPI0002629696  ali  27  22..................................PNDPVEEAEPGLTAQDRKAIENLPPRSALLIVRKGPNLGARFLLDADSTVAGRHPKCEIFLDDVTVSRKHAAFVRDGEGFLLRDLGSLNGTYIGKERVDE-VHLQPGQDVQIGKYRLTYHP 141
67 3.000e-37UniRef50_A0A2M8Q5L7 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8Q5L7_9CHLR  ali  31  2.........................................................QGGGYRLVVRRGPQPGVVFELNRDVVTIGRESGTDIVVPDVEVSRHHCRLRRSAGGYVIEDLGSTNGTFVNRQRVTGSRPLSVGDVIGLGETVLVYE. 99
68 3.000e-37UniRef50_A0A2P8AX51 Glycogen accumulation regulator GarA n=169 Tax=Actinobacteria TaxID=201174 RepID=A0A2P8AX51_9ACTN  ali  27  13...........................VTSTLNLGSLDEVLEGPDTDVVPSRMSGSLPPGMALLVVRRGPNAGARFLLDHDVTTSGRHPDSDIFLDDVTVSRRHAEFHRDAGTFTVRDVGSLNGTYVNRERVEAAT-LSNGDEVQIGKFRVVF.. 137
69 4.000e-37UniRef50_UPI00069128D9 FHA domain-containing protein n=1 Tax=Actinocatenispora sera TaxID=390989 RepID=UPI00069128D9  ali  27  17...............................PLDATTRLERTTLPGEAMATADTDRPPAGTALLVTVRGPGLGNRYPVDGPTVTIGRHPESDIRLEDVTVSRRHAQLRVVDGSYTVADLGSLNGTYVNQERI-ESIALEDGDEIQIGKFRLMLR. 138
70 4.000e-37UniRef50_A0A2M8Q5M2 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8Q5M2_9CHLR  ali  31  8..............................................................RLVVRRGPQPNQVYELNRDMMTIGRDVNNEITVNDPEVSRHHCRLTRGPSGYTIEDLGSTNGTFVNGRRLTGAQPLNPGDLIGLGETV..... 95
71 4.000e-37UniRef50_A0A101ILE2 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium 46_22 TaxID=1635294 RepID=A0A101ILE2_9CHLR  ali  27  7..............................................................QLSTRSGPNPGKVFPLEQAEILFGRDLANDIAIGDPEVSRRHARFFRQEEDFFIEDLGSTNGTFLNGERISSPKQLRAGDVITFGEIVMVFE. 99
72 5.000e-37UniRef50_A0A1V5IMJ7 FHA domain-containing protein FhaB n=1 Tax=Actinobacteria bacterium ADurb.BinA094 TaxID=1852790 RepID=A0A1V5IMJ7_9ACTN  ali  34  1MIDIVLLVLKIGVLVLLYVFIWRMP-AAAPDVALPTGDRLAPVFTPAERRQRREERSAHIAPRLVVEQSPVAGVIFPL-EGWITVGRAPTSDIVLDEQFVSSTHARLVPRGQFYHVEDLGSTNGTFVNEKPVTEAQ-LKLDSRLRIGETIFRYE. 166
73 7.000e-37UniRef50_A4FEN8 FHA domain containing protein n=11 Tax=Pseudonocardiaceae TaxID=2070 RepID=A4FEN8_SACEN  ali  27  4........................TRSDVLSPPDTTGVQATRPGMVIPAARPPQRLEVGGSAWLVVNRGPDKGSGFAITSATTTIGRHRECDIVLDDVTVSRFHAELIRQDGRYFLADGGSLNGTYLNRQPVDWK-RLADGDEIWIGKVRFTFH. 139
74 7.000e-37UniRef50_A0A085WFE5 Uncharacterized protein n=10 Tax=Cystobacterineae TaxID=80811 RepID=A0A085WFE5_9DELT  ali  26  27.......................................RPVRKTGTTAPAVRSAPLPYNGPKLVVTAGPKEGEEFQLEDDEYVIGRSTDNPICIQDTSVSRKHISLRRVGNGWTVSDLGSGNGTLVNGEQITDETVLANGDIITMGDTEVTY.. 140
75 8.000e-37UniRef50_A0A0S4PGV1 FHA domain-containing protein n=3 Tax=unclassified Armatimonadetes TaxID=1042316 RepID=A0A0S4PGV1_9BACT  ali  26  298................................APPQPDLPPLETAGVPPTATVAPVATGTPTRIVGTQGAYVGVSFSIEADLITVGREAGNGIVLDDSTVSRRHAQFLKQGDTVFVEDLGSTNGTFVNGVRISAPTPIRPGDTVQFGACAFRVE. 420
76 9.000e-37UniRef50_A0A1A9GPR1 Glycogen accumulation regulator GarA n=108 Tax=root TaxID=1 RepID=A0A1A9GPR1_9ACTN  ali  27  44.......................ISIGMTASGTGEGSRVETSDRKLTAVDAAAVDALPSGHALLVVQKGPGSGSRFLLDSDVVTAGRHPDSEIFLDDVTVSRRHAEFHRTGASFSVGDAGSLNGTYVNRDRIDR-VQLSDGDEVQIGKYRLVF.. 172
77 9.000e-37UniRef50_A0A1Q2D1E2 Uncharacterized protein n=12 Tax=Propionibacteriales TaxID=85009 RepID=A0A1Q2D1E2_9ACTN  ali  24  39.............................TTTMIAVTSDERDEHELTDQELAAVKELAPGNALLIVNRGPGDTNRFLIDSDITNVGRHPESDIFLDDITVSRHHAKFVRSGGKLYLEDLGSLNGTYVNRTLLDGRTVLREGDEIQIGKYR..... 159
78 9.000e-37UniRef50_A0A0F0LUZ2 Glycogen accumulation regulator GarA n=209 Tax=Bacteria TaxID=2 RepID=A0A0F0LUZ2_9MICO  ali  26  36.....................................SFVPFGSELTEPEMAAIEALPTGSALLIVRSGPTAGARYLLDADVMTVGRHPDADIFFDDVTVSRRHAEITRVGAAFEIVDQRSLNGTYVDGERVDRAT-LANGDEVRIGKFRLNF.. 150
79 1.000e-36UniRef50_A0A1E7NCW1 Uncharacterized protein n=18 Tax=Streptomycetales TaxID=85011 RepID=A0A1E7NCW1_KITAU  ali  27  163..............................ESYDPSATTGTGTTPALSAEVLSADALPPGSALLIVQRGPNSGSRFLLDSDITTAGRHPQGDIFLDDVTVSRRHVEFRRTPAGFIVADVGSLNGTYVNRERIDE-VPLNNGDEVQIGKYRLVF.. 285
80 1.000e-36UniRef50_E3JAB9 FHA domain containing protein n=221 Tax=Actinobacteria TaxID=201174 RepID=E3JAB9_FRAIE  ali  28  70......................................PDQAEEAGEREAVAAVDALPPGSALLVVKRGPNAGSRFLLDADLTTAGRHPESDIFLDDVTVSRRHAEFLRSPKGFTVRDVGSLNGTYLNRERID-AADLSSGDEVQIGKFRLVF.. 185
81 1.000e-36UniRef50_A0A1N0GQG0 FHA domain-containing protein n=32 Tax=Actinobacteria TaxID=201174 RepID=A0A1N0GQG0_9MYCO  ali  26  26......................................TEDAEHGLSPQDRQAVEALPAGTALLIVRKGPNMGARFLLDSESTVAGRNPKSEIFLDDVTVSRKHATFVRGEGGFLVLDMGSLNGTYVNRE-LTDEARLNNGDEIQIGKYRFTF.. 139
82 1.000e-36UniRef50_A0A2W5TPN7 Uncharacterized protein n=1 Tax=Archangium gephyra TaxID=48 RepID=A0A2W5TPN7_9DELT  ali  27  16...................................TGVSPATGRPSSGVRKPVARPPKTATATLTARSGPASGQEFTLDGDELVIGRAADNPVSIPDTSVSRKHAVVRKTADGWAVSDLGSGNGTMLNGAPIADETTLNDGDVITMGDTELVY.. 133
83 1.000e-36UniRef50_K9EFI6 Uncharacterized protein n=6 Tax=Actinomycetaceae TaxID=2049 RepID=K9EFI6_9ACTO  ali  37  33.....................GTAIRARKSTSSKHGRAPETHHEDSAPAEVPPEPARLIPQPVIAVVGGPLTGTVLPLSRSPLLIGRSPDSSLVLDDSYASSRHAKLFFRDGYWWIEDLQSTNGTYIGGARINEPVALTPGVQVTIGKTTMELQ. 165
84 1.000e-36UniRef50_W4U018 FHA domain containing protein n=5 Tax=Actinobacteria TaxID=201174 RepID=W4U018_CUTAC  ali  27  1...........................MIPTITEPTVAEETSPNVDLPAGVLQDADLPAENAMLIVRRGPNLGAQFLLDQDETTAGRSTHSDIFLDDITVSRHHVKFIRQDGRMVVEDQGSLNGTYVNRTLVDGSAVLRDGDEVQIGKFRMTYH. 128
85 1.000e-36UniRef50_A0A164ECQ6 Glycogen accumulation regulator GarA n=69 Tax=Micrococcales TaxID=85006 RepID=A0A164ECQ6_9MICO  ali  25  39................................REAAAQLSALDADISAAEQEAINALPSGSALLIVRRGPNAGARFLLDTDVTTVGRHPDADIFLDDVTVSRKHAEFVRHRTAFEVRDLNSLNGTYFDGVRIETA-LLSDGAEVQIGKYRLTF.. 158
86 1.000e-36UniRef50_A0A0X8JG46 Uncharacterized protein n=15 Tax=Actinobacteria TaxID=201174 RepID=A0A0X8JG46_9ACTO  ali  30  32..............................................SQQDRAAIAALPPGTALLVVGHGPTTGARFLLDSEETTVGRHPRADIFLDDVTVSRKHAVFLAQDGGYLVRDSGSLNGTYVNRQRVESAA-LRPGDEVQIGKYRMTYHP 140
87 1.000e-36UniRef50_A0A136LIS4 Putative winged helix family two component transcriptional regulator (Fragment) n=1 Tax=Chloroflexi bacterium OLB15 TaxID=1617416  ali  31  9..............................................................RLIVRRGPQPNQSYELNKDIVTLGRDITNDIVINDPEVSRHHLRLSRGAGGFTIEDLGSTNGTFINGQRLTGPRPLRPGDMVGLGETV..... 96
88 1.000e-36UniRef50_B8E0P0 FHA domain containing protein n=3 Tax=Dictyoglomus TaxID=13 RepID=B8E0P0_DICTD  ali  28  60.............................................................AYLIVKHGENRGKDFKIVKDETTIGREQENDIVIPNPTVSRFHAKIIRSEDKYFIEDLGSANGTMVNGIKVTKE-LLHDGDIVQLGDVVLVFK. 151
89 1.000e-36UniRef50_A0A1F8RHK6 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_64_43 TaxID=1797659 RepID=A0A1F8RHK6_9CHLR  ali  29  2.........................................................SSGQLRLVMRSGPTPGKVFELNKEIATIGREASADIVIADPEVSRAHARLVLKQGGVIIEDLGSTNGTFVNKQRITAPRAISPGDEITLGESI..... 94
90 2.000e-36UniRef50_A0A2G6JDK2 Histidine kinase n=1 Tax=Pseudopropionibacterium propionicum TaxID=1750 RepID=A0A2G6JDK2_9ACTN  ali  24  21.....................GEIVLALDPESTRVMAAVPGSEEAAVPTVELETPALEHGDVVLIIHKGGSDKSIIRLDQESTTAGRHPKCDIFLDDISVSRHHLRFVYKDDQLLLEDLGSMNGTYLNRERIDSPRVLHDGDQIHIGKYR..... 149
91 2.000e-36UniRef50_N6W4N7 FHA-domain-containing protein n=40 Tax=Terrabacteria group TaxID=1783272 RepID=N6W4N7_9ACTO  ali  28  19..................................PVDESGDTTMPLSARDREAVDALPAGSALLIVQRGPNTGARFLLDAEATSAGRSPKSDIFLDDVTVSRSHCQFIAVDGGHVVRDSGSLNGTYVNRERVDSA-RLNTGDEVQIGKYRLTYQP 138
92 2.000e-36UniRef50_A0A2M8PHN8 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8PHN8_9CHLR  ali  25  19.........................................................GSGSFRLIVRRGPQPNQIYELSKDVISLGRDITNDIVVNDPEVSRHHCRLTRSSAGYTLEDLGSTNGSFVNGQRVSGPRPLNNGDLIGLGETTLVYE. 116
93 2.000e-36UniRef50_UPI0007847499 FHA domain-containing protein n=6 Tax=Micrococcales TaxID=85006 RepID=UPI0007847499  ali  27  7......................PVERTMSLDAQIP--VDETAPPRISAQDDDAVSALDESCALLIVHHGPNQGARFLLDVDITTAGRSVKGDIFLDDVTVSREHVQFIRDGHDFYVKDAGSLNGTYVNRELVSEA-KLAEGDEVQIGKYRMTFHP 136
94 2.000e-36UniRef50_A0A1M4UFQ4 Zinc-ribbon domain-containing protein n=3 Tax=Acidimicrobiaceae TaxID=84994 RepID=A0A1M4UFQ4_9ACTN  ali  29  52...................................................RALSEVPQGQAALVVRVGEGAGSRFDLDRELTTVGRHPESDIFLDDVTVSRRHAEIRRTAHGYEIKDTGSLNGSYLNKERVESAV-LRHGDELQIGKYRFTF.. 152
95 2.000e-36UniRef50_H5SN36 Two component response transcriptional regulator n=1 Tax=uncultured Chloroflexi bacterium TaxID=166587 RepID=H5SN36_9CHLR  ali  30  3..........................................................EAVARLVISDGEKIGQEIALHQDVTTLGRMADCQIVIDSQFVSRRHAQIIRRGQGYWLRDLGSKNGTLVNNEPVTTETLLKDGALIQVGQVTFRF.. 99
96 3.000e-36UniRef50_A0A1I2R7T5 FHA domain-containing protein n=3 Tax=Desulfotomaculum TaxID=1562 RepID=A0A1I2R7T5_9FIRM  ali  28  93.................YTLLGRIEVSFDQDQAVAPGEMVIESAPVSEATAPSARELPEAAASLEVLEGPLSGRRYQVEGNLAVIGRKESCDIFLPDESISRRHALISRVGRQFYIKDQASTNGTYINGARVEQE-ELMPGDMIKIGRILLRFR. 251
97 3.000e-36UniRef50_A0A2E0L1H2 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E0L1H2_9CHLR  ali  31  9..............................................................RLVVRRGPQPNQVYELTKDIITVGRDITNDIVINDPEASRHHMRLTRGAGGYTLEDLGSTNGTFINGQRLTGAKPLNPGDMVGMGETTLGFE. 101
98 3.000e-36UniRef50_D1CC18 FHA domain containing protein n=1 Tax=Thermobaculum terrenum (strain ATCC BAA-798 / YNP1) TaxID=525904 RepID=D1CC18_THET1  ali  29  122................................DLGPGEIDPQLEFTQPIEVTRARPKIPASAFLTVISGPQNGQRFHLPSGRASIGRGLDNQIILEDPMVSRHHAEIYLRGSEWYIKDLNSTNGTYVNGHAIREK-SLEHGDRITLGSVDIRF.. 242
99 3.000e-36UniRef50_A0A140LAX8 Transcriptional regulatory protein EmbR n=7 Tax=Firmicutes TaxID=1239 RepID=A0A140LAX8_9THEO  ali  26  1MYELLAQVMKFLLIGLIYYFLYNFLKLMVLDLY------------------EERRSSDETDYCLRCED----GREFPIRR-VTTIGRAKDSDIVIDDPYLSSKHAMIYRRGKRLIIQDLKSTNGTYINGRRIKKPVALKEKDVITMGSRKFTF.. 130
100 3.000e-36UniRef50_UPI000C076E65 FHA domain-containing protein n=1 Tax=Actinomyces minihominis TaxID=2002838 RepID=UPI000C076E65  ali  30  2................................................RDQAAVDALPKGSALLIVQRGPNSGARFLLDQQTTNAGRSASSDIFLDDVTVSRKHCQFIARDGGHIVRDSGALNGTYVNRERVDQAV-LKSGDEVQVGKYRLTYHP 107
101 3.000e-36UniRef50_A0A1H9ZMD7 FHA domain protein n=1 Tax=Natronincola peptidivorans TaxID=426128 RepID=A0A1H9ZMD7_9CLOT  ali  23  1MFPILSWTIRYIFIGLIYYFIYHIIRLIYLDIK----HINERQNKQFDSPYLKLVNRKETLDFEI--------QEFYDLKDVVTLGRSKENDIQILDKFMSSSHAKITMDEDEYFLEDLESVNGTYLNSTQIEDVVKLKSGDRIGLGQVEFLF.. 141
102 4.000e-36UniRef50_U1F2U0 FHA domain-containing protein n=110 Tax=root TaxID=1 RepID=U1F2U0_9ACTN  ali  29  66..................................................VDAIAALPEGNAMLVVERGPNLGARFLLDHDVTTAGRSTHSDIFLNDITVSRHHVKFIRRDGKVFVEDQSSLNGTYVNRTLVDGTAALRDGDEVQIGKFRMIFH. 169
103 4.000e-36UniRef50_A0A2N3GIS9 Histidine kinase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2N3GIS9_9ACTN  ali  23  49..............................................ADEDVAAVEALPKRSALLIILKGGHSDGRFLIDADLVTAGRHPRTDIFLDDVTVSRHHARFTRDGDLFSVSDENSLNGTYVNGELIEGPTALRRGDEVQIGKFRMVF.. 155
104 4.000e-36UniRef50_C7MCS3 FHA domain-containing protein n=10 Tax=Actinobacteria TaxID=201174 RepID=C7MCS3_BRAFD  ali  29  23..................................PSDPTDDAESGLSSQDRRAIENLPPRSALLIVRKGPNLGARFLLDSETTVAGRHPKSEIFLDDVTVSRKHAAFVRDGDGFLVRDLGSLNGTYVGKDRVDEA-RLHAGQDVQIGKYRLTYHP 142
105 5.000e-36UniRef50_A0A1X0B0P4 FHA domain-containing protein n=2 Tax=Mycobacterium aquaticum TaxID=1927124 RepID=A0A1X0B0P4_9MYCO  ali  26  22.....................................TPPRETIEVAATALEHLDTLPPGAAMLVVKRGPNIGLRFVLHQPITTAGRHPRSDIYLDDITVSRLHAEFHCDEGEFQIIDTNSLNGTYVNRQPVDCAT-LTDGDEIQIGNFRLLF.. 136
106 5.000e-36UniRef50_A0A2E0ZQ84 Uncharacterized protein n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2E0ZQ84_9ACTN  ali  27  27.............................HEIRATSDETTDTFELGEELPHEEDRARPHDCGLFVVESGPKAGARYGLEAELTTLGRHGDADIFFDDVTVSRRHAEVQRTDDRYLVRDSGSLNGTYVNRERIESA-LLQDGDELQIGRFRLVF.. 150
107 5.000e-36UniRef50_A0A0G3UY56 FHA domain-containing protein n=1 Tax=Actinobacteria bacterium IMCC26256 TaxID=1650658 RepID=A0A0G3UY56_9ACTN  ali  29  1MSDALLTLLRYCFLALLLIFLSRVVLVVVREMRASRPLTVKPRPQRERAPRDTSRSRTSRGWQLVVVEPPDAGRRYLL-AAENTVGRAPGCTIPIDDNFISSIHVRLFIADGKLFAEDAGSTNGTSVNESLITGTQPLSRGDRIAIGGTVLEVQ. 156
108 6.000e-36UniRef50_A0A261F7Y5 FHA domain-containing protein n=195 Tax=cellular organisms TaxID=131567 RepID=A0A261F7Y5_9BIFI  ali  22  95.................YSFSGPVVVIFEENTDIPQGRPQVSSQVVQGAPVTDDKSSPRDFPVLEI-----SGRQYLLTAAKTVIGRGSDCDIVIDDPGVSRHHVEIEITPQHVVARDMGSTNGTYVEGHLVP-AASLIDGNTITIGRTRMLF.. 226
109 6.000e-36UniRef50_A0A223S121 FHA domain-containing protein n=1 Tax=Nocardiopsis gilva YIM 90087 TaxID=1235441 RepID=A0A223S121_9ACTN  ali  45  31..............................DLFGPSKSKEKRPKKSPQRKPSLPRGRRNEPRTLVVTKGPLTGTTLNLTSQPITIGRAGDSTLVINDDYTSGRHARIFTDNGRWIVEDLNSTNGTFVGQERLTRPQPITVGQPIRIGKTVLELR. 154
110 7.000e-36UniRef50_A0A094Q071 Uncharacterized protein n=1 Tax=freshwater metagenome TaxID=449393 RepID=A0A094Q071_9ZZZZ  ali  44  29............................RRDLQAPRDAKPLTPARSTNQPSQRPTRSRKTSTKLVIVEGALTGTVLPLGTSPILIGRAPDSTIVLEDDFVSTRHAQLTPNGNHWIVEDLGSTNGTWIDRTRISAPTVLRPGTQLRIGRTSMEL.. 154
111 8.000e-36UniRef50_A0A0D8HEI5 Glycogen accumulation regulator GarA n=2 Tax=Acidithrix ferrooxidans TaxID=1280514 RepID=A0A0D8HEI5_9ACTN  ali  28  54......................................................EGAKNGSALTIVQGGPSAGTSFNLEKDRTSLGRHPASDIFLDDVTVSRRHAEIVREGDEYTISDVGSLNGTYVNHKRSDFEV-LKSGDEVQIGKYKLLF.. 151
112 9.000e-36UniRef50_A4J583 FHA domain containing protein n=8 Tax=Desulfotomaculum TaxID=1562 RepID=A4J583_DESRM  ali  27  153.......................................ETRAFEPLSDTAPLRISKIPYSASLLVEEGNDMGKEFPLGDYRSSIGRRDTCDIVLNDSSISRRHAQIEKKNNRFCLSDLNSTNGTYVNGIPIDR-TELTTGDVITLGNTVLVFK. 266
113 1.000e-35UniRef50_C9LUK0 FHA domain containing protein n=31 Tax=Selenomonadaceae TaxID=1843491 RepID=C9LUK0_SELS3  ali  27  10...VLSVAFQYGVLLLLFRFIARLAQAMFEDAKALQQEIKPREILPDEAVLS------------VVEAGDEAGKRFAFTQG-LTIGRSADNDIRIPDSFVSHRHAVVRLVNNQYVIEDMGSMNHTYLNDAILQGKAYLKPGDLIRIGFVTLRFE. 149
114 1.000e-35UniRef50_A0A0G2ZM24 Uncharacterized protein n=19 Tax=Cystobacterineae TaxID=80811 RepID=A0A0G2ZM24_9DELT  ali  29  1..................................................MRAEPPLPVMGTKLVCSAGPCAGSEFALEEGEYVIGRANDNPICIPDTSVSRKHVLIRRVGGGWEVSDLGSGNGTLLNGEPLTTEMPLSHGDTLTLGDTELTF.. 103
115 1.000e-35UniRef50_A0A2E0Z5F9 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E0Z5F9_9CHLR  ali  31  5.......................................................PSAAHAARLVVEQGPEPEQTFTLGHAPQTIGRSANNGIVINDAEISRRHAQITPQGEGYVLEDLGSTNGTFVNGSRLNQPIALKHGDAVAFGDTRLRY.. 103
116 1.000e-35UniRef50_A0A2M7T9X8 Histidine kinase n=1 Tax=Actinobacteria bacterium CG_4_10_14_0_8_um_filter_50_43 TaxID=1973889 RepID=A0A2M7T9X8_9ACTN  ali  26  51........................................................APAEGPILVVTKGPFIGQKFNLAKNETTLGRDPNSDIFLDDVTVSRNHAKITMGDDTVTVIDADSLNGTYVNQQCIDGPTELESDDELQIGKFKLVF.. 147
117 1.000e-35UniRef50_UPI000782D0BD FHA domain-containing protein n=1 Tax=Bellilinea caldifistulae TaxID=360411 RepID=UPI000782D0BD  ali  33  2..........................................................AARYQLVLKSGPNAGLTYPVEGDLISIGRDASNMLVVNDPEVSRRHARIYRQGEGYYLEDLGSTNGTAVNGVRLETAYALQGGELITLGETHLLFE. 98
118 1.000e-35UniRef50_A0A143XAG3 Glycogen accumulation regulator GarA n=24 Tax=Terrabacteria group TaxID=1783272 RepID=A0A143XAG3_9ACTN  ali  23  37....................................GATQRFEPVPLDDAPPSVEAASQARAALHVVRGPSAGVTLQLGDKPLSIGRSPQCDVFLNDMTVSRSHAAVEPDGGGYVIRDANSFNGVWVNNESV-ECRRLASGDVIQIGAFCLVYK. 153
119 1.000e-35UniRef50_A0A1G5RVB1 FHA domain-containing protein n=1 Tax=Acidaminobacter hydrogenoformans DSM 2784 TaxID=1120920 RepID=A0A1G5RVB1_9FIRM  ali  23  1MVELISTVAKYLLVVIIYIFIYKIVQLIYTDIRLLMGRDSAAALLPHLKLMTPVGTRGTQSVA----------EIYPLMRPVSLIGRSKKCLIILPDPYVSSEHVRIDKVGDRFFVEDLESANGTLLNGKRLEKRTELKDGDKISLGRIDLVF.. 143
120 2.000e-35UniRef50_A0A1F8PTB4 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_52_11 TaxID=1797646 RepID=A0A1F8PTB4_9CHLR  ali  28  2.........................................................APQSYMLIMRTGPNPGKAFELTRNEIYIGRDINNDIVINDSEISRKHARLIMQAGGFVLEDLGSTNGTFVNGQRLMGPHVLRAGEVVLFGEVSLAFEP 100
121 2.000e-35UniRef50_A0A1V5T510 Glycogen accumulation regulator GarA n=1 Tax=bacterium ADurb.Bin270 TaxID=1866926 RepID=A0A1V5T510_9BACT  ali  23  213..........................SAESSEPESREPDQTEESSTIKAPIEEIIGGRSPHPRILVISGEMSGTAYPL-KGIVSFGRAESNTVTLRDSKCSRQHAQIQQHGNEFVVEDLNSSNGTFVNGERVSE-HVLSNGDEIQIGDTLMQFQ. 338
122 2.000e-35UniRef50_A0A1I2HVP5 FHA domain-containing protein n=1 Tax=Sanguibacter marinus TaxID=285351 RepID=A0A1I2HVP5_9MICO  ali  44  35...................................TRITPRLAGRSTGTPAPSSPGRSTRPTRLVVTDGSLTGTTLPLTSSAILIGRAPACTLVLDDDYSSSRHARIFPQGEQWVVEDLGSTNGTYIGEQRLAEPTILPAGTPVRIGQTVLELQ. 153
123 2.000e-35UniRef50_D5UPR8 FHA domain containing protein n=16 Tax=Actinobacteria TaxID=201174 RepID=D5UPR8_TSUPD  ali  63  1MQGLVLQLTRAGFLLLLWLCVWLVINALRSDARLASGLRPKQKEAKPPRGSLFQRGSKTAK-YLVVTHGPLANTRITLGQQPVLIGRADDSTLVLNDDYASTRHARLARDGDDWYVEDLGSTNGTYLARNKVTTPTRVPLGTPVRVGKTVIELRP 154
124 2.000e-35UniRef50_A0A1M6KJ24 Zinc-ribbon domain-containing protein n=2 Tax=Propionibacteriales TaxID=85009 RepID=A0A1M6KJ24_9ACTN  ali  26  31.............................TTTLLPITTDDRSSVNLSEQELAAVKELAPGNALLIVNRGTGNYNRFLIDADITNVGRHPESDIFLDDITVSRHHAKFVRSGGKLYLEDLGSLNGTYVNRALLDGRTVLREGDEIQIGKYR..... 151
125 2.000e-35UniRef50_UPI000DA63006 FHA domain-containing protein n=1 Tax=Massilibacillus massiliensis TaxID=1806837 RepID=UPI000DA63006  ali  21  8.VDVLSIILQYGFILFIYYFIYKVVYLLYKDLN--------------PNRIKNEEENSYAKLILIDLDDPTKEKQIFSFVDIITIGRNNENDIIINDQYVSHYHAQIKRIDSNYILEDLDSINHTYLNNESIVRNEVLKSGDIIKIGLVTFRFE. 146
126 2.000e-35UniRef50_A0A1F2W6F7 Uncharacterized protein n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A1F2W6F7_9ACTN  ali  33  1MPVLALHILKISFIALLYVFLWVIGRNIAGHLR-------------------GERARSEAPAVAVIEPAAQSGLTFRVTRP-LVLGRSAEADVVLEDPYTSDFHARLVFQAGEVRLQDLGSTNGTYVNGERMTAPMSLRRGDQIRVGQTIMEVR. 134
127 3.000e-35UniRef50_Q24U13 Uncharacterized protein n=1 Tax=Desulfitobacterium hafniense (strain Y51) TaxID=138119 RepID=Q24U13_DESHY  ali  36  23......................................................EQSRKIRYALEIIQGPDSGKTFPLEEETIHIGRHGQCEIVLQDPEVSRRHLKLSSDGEDWVIDDLGSTNGTWLNGQRIAK-QKIGLGDRVEIGQTIFILR. 121
128 3.000e-35UniRef50_A0A261FQK4 Phosphopeptide-binding protein n=4 Tax=Bifidobacterium TaxID=1678 RepID=A0A261FQK4_9BIFI  ali  24  95.................YAFVGPVVVIFEEDLDLAKGNFNLSSESVQGNAVPVTTESQSDNPVLEV-----NGNQYLITKEQTVIGRGSGCDIVIDDPGISRRHLEIDVTENGVIARDLGSTNGTYVEGHQVPAATLL-DGNTITIGRTRILY.. 225
129 3.000e-35UniRef50_UPI000370C094 FHA domain-containing protein n=1 Tax=Amycolatopsis nigrescens TaxID=381445 RepID=UPI000370C094  ali  28  17..................................PTSAIAPPPVGDAPSPPPVLPPDARGTGLLVIVRGPGVGTRFPLSDGTITIGRHAECDIRLDDLTVSRQHAELHRKGDGLELVDLGSLNSTYVNRLPVDR-VTINPGDEIWIGKFRLAY.. 134
130 3.000e-35UniRef50_I6X0Q0 Oxoglutarate dehydrogenase inhibitor n=2 Tax=Pseudopropionibacterium propionicum TaxID=1750 RepID=I6X0Q0_PSEPQ  ali  27  37................................................SPSADAADLAPGNALMIVTRGGVKESQFLIDSDVTTLGRHPESDIFLDDVTVSRHHAKLVRAGGQLMLEDLGSLNGTYVNRVLIDGRAQLRHGDEIQIGKYR..... 138
131 3.000e-35UniRef50_F5XFJ0 Uncharacterized protein n=12 Tax=Actinobacteria TaxID=201174 RepID=F5XFJ0_MICPN  ali  28  62..................................PPVQVETDVEGLSAEDEAAVNALPRGSALLIVQRGPSAGSRFLLNTDQVSAGRHQDSDIFLDDISVSRRHATFTRTAEGIVLRDRGSLNGTYVNRGLVDT-TLLRHGDEVQIGKFRLIF.. 179
132 3.000e-35UniRef50_A0A166HF64 Glycogen accumulation regulator GarA n=19 Tax=Microbacteriaceae TaxID=85023 RepID=A0A166HF64_9MICO  ali  33  42............................................RASREEAEAVGALPSGSALLVVRRGPNTGARFLLDTDSTTVGRHPEAGIFLDDVTVSRRHAEFVRRGTSFEVHDLGSLNGTYFDGVRIESAI-LTDGSEVQVGKFRLTF.. 149
133 3.000e-35UniRef50_Q83FG3 Uncharacterized protein n=3 Tax=Tropheryma whipplei TaxID=2039 RepID=Q83FG3_TROWT  ali  29  1MNEFIFFTLKVGFLGLLWIFVLCSIVILYKSL-------PKGRDNLATPRISSKKFSPSVGAKMVTVKTECSEQKIPIKQPRMLIGRTPDCQIALSDRFSSGHHAELVLTESGWKVRDLGSSNGTFVDGKRIGQAITLRIGEELKIGSSAIRL.. 148
134 3.000e-35UniRef50_UPI0007866C9A FHA domain-containing protein n=1 Tax=Leptolinea tardivitalis TaxID=229920 RepID=UPI0007866C9A  ali  36  2..........................................................SATYQLVIRSGAGAGKVLPLDKTELHVGRDVTNDLVISDEKVSRRHARLYTEGDQYVVEDLGSTNGTFINGARLSGPHLLRAGEQITFGETSIV... 95
135 3.000e-35UniRef50_A0A086YWE6 FHA domain protein n=10 Tax=Bifidobacteriaceae TaxID=31953 RepID=A0A086YWE6_9BIFI  ali  23  95.................YAFVGPVVVIFEEDLELSKGDFRLSSESVQGNAAPATAASDSDCPVLEI-----NGRQYLLTAPSTVIGRGSACDIVIDDPGISRKHLQIDITDKGVIARDLGSTNGTYVEGHQVPAATLL-DGNTITIGRTRILY.. 225
136 3.000e-35UniRef50_A0A126Z0J8 Transcriptional regulator n=127 Tax=Actinobacteria TaxID=201174 RepID=A0A126Z0J8_9MICO  ali  31  43.................................................EREAVSALPSGSALLVVRRGPNIGARFLLDADVTVAGRHPDAGIFLDDVTVSRKHAEFRRHGTTFSVKDLGSLNGTYFDGVRIDEA-LLSDGAEVQVGKFRLTF.. 145
137 4.000e-35UniRef50_M5AG98 Uncharacterized protein n=4 Tax=Acidimicrobiaceae TaxID=84994 RepID=M5AG98_9ACTN  ali  27  1MSDQVLNVLKLTLLGLVYLFFARVLWAVWSEVRTPPARPVAQPQPNAPAQRRPAKGRRGRAARLVILEPRHRGMAIALT-GEITLGRDEQCTISIDDSYVSQLHLRVYDYDGQPMVEDLGSTNGTFHNGNRLRGSKLLHQGDRIQVGTTVIE... 179
138 4.000e-35UniRef50_A0A0D8FXM3 Glycogen accumulation regulator GarA n=1 Tax=Ferrimicrobium acidiphilum DSM 19497 TaxID=1121877 RepID=A0A0D8FXM3_9ACTN  ali  30  24.........................RLLELPEETTGSLDVVDPGLLQQGDVTEAQAPAGGYGFLMIQIGQEAGSWFQLDRQTMSIGRHPDSDIFLNDVTVSRRHAEITLRDDEYYIKDAGSLNGTYMNRERVEEE-RLCPGNEIQIGKFRLLF.. 152
139 4.000e-35UniRef50_D1CC17 FHA domain containing protein n=2 Tax=Thermobaculum TaxID=262406 RepID=D1CC17_THET1  ali  29  5.YDLLVFLLNVGFVALLYIFLFEVVRIALRELRAVTATTSQNSRFGQLVVVDPGR------------TGLRPGTVFPL-EPTTAIGRKISNAIVLDDPTVSGEHAILYLWDGTWYIRDAGSTNGTLVNGQDVIEPSPVNVGDILTLGAVKLRL.. 143
140 4.000e-35UniRef50_E8N4S3 Uncharacterized protein n=3 Tax=Anaerolineaceae TaxID=292628 RepID=E8N4S3_ANATU  ali  28  2..........................................................PVGYQLIMRSGPQAGGVFPLTKTEISLGRDLTNDLVVSDPEVSRHHARLYLQGNTYVLEDLGSTNGTFVNGIRLTGPYPLRPGESISLGRVVFLYE. 98
141 5.000e-35UniRef50_UPI0009DBAC15 FHA domain-containing protein n=3 Tax=Actinobacteria TaxID=201174 RepID=UPI0009DBAC15  ali  33  6...........................................SRASREEIEAIAALPSGSALLVVRRGPNTGARFLLDSDLTTVGRHPEAGIFLDDVTVSRRHAEFVRRGTSFEVRDLGSLNGTYFDGARIESA-LLTDGSEVQVGKFRLTF.. 114
142 5.000e-35UniRef50_R4Z0M2 Putative FHA domain containing protein n=1 Tax=Candidatus Microthrix parvicella RN1 TaxID=1229780 RepID=R4Z0M2_9ACTN  ali  29  27.....................................PLPEVESQPTGVLSAVGGDPALGTPLLIVTRGANAGSRFALGEGTTSIGRQEDSDIFLDDVTVSRRHAQLLRSPDGIEVQDSGSLNGTYLNDRRIERA-PLAEGDRLQVGKYKLLF.. 141
143 5.000e-35UniRef50_A0A2N2MD92 Uncharacterized protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2N2MD92_9CHLR  ali  27  5..............................................................QLVMHSGPTPGKTFPLEGDVLTIGREASNAVAINDAEVSRKHTQLVFQGGKYIITDLGSTNGTFVNGQRLTGQHVLQPGEIISLGE....... 90
144 5.000e-35UniRef50_A0A2S5W582 Transcriptional regulator n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A2S5W582_9MICO  ali  31  8.............................................VTPEELEAIAALPSGSALLIVRRGPSAGARFLLDKLTNVVGRHPDADIFLDDVTVSRRHAEFSRSGTTFSVRDLHSLNGTYFDGVRVDDA-LLADGSEIQVGKFRLTFYP 116
145 5.000e-35UniRef50_A0A136L0G4 FHA domain-containing protein n=1 Tax=Chloroflexi bacterium OLB14 TaxID=1617415 RepID=A0A136L0G4_9CHLR  ali  33  7................................................................VMRSGPTPGVVFPLEGEQLTIGRDSSNGVAINDAEVSRKHARLNMQGGKFVIDDLGSTNGTFVNGQRITGPVVLKAGDVVSLGE....... 90
146 5.000e-35UniRef50_A0A2M8SC12 Uncharacterized protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2M8SC12_9CHLR  ali  28  6..............................................................QLVMRSGPNVGKVFPLEATEISIGREIGNVIVISDSEVSRRHAKLTWQGAGYFIEDAGSTNGTFVNNQRISAPHALKAGDLVSLSESTLAFE. 98
147 5.000e-35UniRef50_A0A1M4WEG3 FHA domain-containing protein n=1 Tax=Schwartzia succinivorans DSM 10502 TaxID=1123243 RepID=A0A1M4WEG3_9FIRM  ali  25  12......VLLQYGILFFLFYFLWKMGKSL-------------SPALIINKQEDRAAGNEPDEAVLTILDGPDAGRRFAF-RESLTVGRAEDNDLVISDNFVSHHHIVFRRVQTLYTVQDLGSSNHTYVNEEVLSERRILRNGDHIRIGMITILFE. 147
148 5.000e-35UniRef50_A0A2L0ERI6 Diguanylate cyclase n=26 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2L0ERI6_SORCE  ali  36  45..................................................APPAPQVEPGTACLVVIYGTELGRRIALNAGAIECGRSMQTDIPLDDEAVSRRHARISWNGMSYVVRDLGSTNGTYVNDVSVDERA-LRDGDQVKIGRTIFKF.. 146
149 6.000e-35UniRef50_A0A0H0ZSH4 Uncharacterized protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A0H0ZSH4_9MICC  ali  44  29........................RRDLAIGSRSRTGKPSARALKKNPELAEPEPTTRKPASALQILEGPLAGRTITLQGQPILFGRAQDATVVLEDDYASGRHARLFPQGSRWFIEDLGSTNGTFVGDSQLTRAQAVEPGQRIRIGKTVLELK. 158
150 6.000e-35UniRef50_A0A1M4S3D8 Uncharacterized protein n=6 Tax=Actinomyces TaxID=1654 RepID=A0A1M4S3D8_9ACTO  ali  45  26.........................RVLRRDVADVSATPTRRRGL--RRDAGAAAGRNRGPTRLVITEGPLAGSMVPLTPTSITIGRDQNCTLVLNDSYASSRHARVFPKDGAWWLEDLSSTNGTTLAGRPVYGAVELPVGVPVRIGQTTLELRP 153
151 8.000e-35UniRef50_A0A0K2SJZ7 Uncharacterized protein n=2 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SJZ7_9FIRM  ali  31  165.............................EEGAGLAEADEPPPMEGTRRFRATPEPSAGPRGRLVVVAGADRGTAFPLRRSEVVVGRASGADVVLNDRAVSRRHARLVWRGGLWWLEDLGSTNGTYVNGDLIDSGW-LQPGDRVEVGGSELLLE. 291
152 8.000e-35UniRef50_A0A1R4JG67 FHA-domain-containing proteins n=13 Tax=root TaxID=1 RepID=A0A1R4JG67_9MICO  ali  38  32..................LFGLKARKGQQXXXXXXXXXXXXKRKPSTAPQPPEGSATSATASTLVIVAGTRAGERIPLGREPITIGRSSDSTLVLKDDYTSTHHARLVLWNDGWMIQDLDSTNGTFLNGKRISSPTPVPLGVPVKVGATSFELR. 167
153 8.000e-35UniRef50_A0A2M8NX54 Uncharacterized protein n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A2M8NX54_9CHLR  ali  27  9..............................................................RLIVRRGPQPNQVFELNKDSITLGRDITNDITINDPEVSRHHLRLTRGADGYTIEDLGSTNGTFINGQRLTGSRPLNRGDMIGLGETV..... 96
154 8.000e-35UniRef50_A0A1F2Y8M9 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_19FT_COMBO_70_19 TaxID=1797208 RepID=A0A1F2Y8M9_9ACTN  ali  25  93.................WGLVGPPVVELEVDDELARGRFRCAATFVEGEGEMPPAVPAAGDAGLVLLDGDRVADTFRLRSA-TTLGRLTECEIVITDPGASRRHAQIVRRDDGFVITDLGSTNGTLVNGEPVRER-LLVDGDRITIGSTVLEYR. 227
155 8.000e-35UniRef50_A0A2P7ABR7 FHA domain-containing protein n=8 Tax=Microbacteriaceae TaxID=85023 RepID=A0A2P7ABR7_9MICO  ali  41  83.................................PQTXXXXXXXXXXXXSGASGTSGQPQRLTKLVITSGPKRGFEIELGTEPLSIGRARDADVCIQDDYTSTRHARLLNWDGAWMLQDLDSTNGTFINGERVSQPVELRSGVPVRIGTTTFELR. 203
156 9.000e-35UniRef50_A0A221RBH3 FHA domain-containing protein n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A221RBH3_9MICC  ali  48  28...........................MRRDLAVGRRTGAPTARQVRRNPELAEPPARQQAHRLVVVEGPLAGTSVPLAESPILLGRAQEATLVLEDDYASGRHARLFPQGSRWFIEDLGSTNGTYLADQQLTRAQPVELGVPIRIGKTVIELRP 157
157 9.000e-35UniRef50_UPI00093F0BA1 FHA domain-containing protein n=1 Tax=Arcanobacterium urinimassiliense TaxID=1871014 RepID=UPI00093F0BA1  ali  33  26......................RTVRVFGTQVKSRASFFPAPKSKNRRRPARKSSNAPETSGSLVVTAGPLAGTVLPFGNSTISVGRSPDSALVLDDGFASARHARFYRTEGKYYVEDLNSTNGTWVGKKRISTPTELQAGVPITIGKTVLELR. 159
158 1.000e-34UniRef50_A0A1G1MQS1 Uncharacterized protein n=1 Tax=Omnitrophica WOR_2 bacterium RBG_13_44_8 TaxID=1801850 RepID=A0A1G1MQS1_9BACT  ali  31  62..........................................................EGLPVFMVVKGPNKGARFRIERSEVLIGRSSECDIILDDVTVSRLHARIFKEGLETWVFDMNSLNGTYVNRKRI-EKIRLENKDEIQIGKYKFVF.. 155
159 1.000e-34UniRef50_A0A024H7Y3 FHA domain protein n=87 Tax=Terrabacteria group TaxID=1783272 RepID=A0A024H7Y3_9MICC  ali  48  29........................RRDLMVGRKAAAGAPTARQVRKNPELAEAPPQPVKQQARLAVVEGPLKGTTLPLAASPILLGRAQEATLVLEDDYASGRHARLFPQGSRWFIEDLGSTNGTYLGDQQLTRALPVEPGVPVRIGKTVIELRP 160
160 1.000e-34UniRef50_A0A2E8L8H3 Uncharacterized protein n=4 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E8L8H3_9ACTN  ali  28  1MTDQLLFLVRLGLLAIVYLTFFRVLRAVWVELRTENRIVVTTSGVVPVTKGAPTPAGAEGGARLVVLTPPAAGQVFEL-QAETTIGRAPSCAVVIDDSRVSKFHARLCQRDGRWVVEDLGSTNGTLVNDHVLDHPENVGPGDRIQVGEHVMEL.. 164
161 1.000e-34UniRef50_A0A0M2HE59 Glycogen accumulation regulator GarA n=28 Tax=Actinobacteria TaxID=201174 RepID=A0A0M2HE59_9MICO  ali  27  10.....................GDIRRAAGSDAHDSDRAADTTQTFGHDSDLSFVPALPSGAALLLVRSGPTAGARYLLDADVTSVGRHPEADIFFDDVTVSRRHAEISRTGTAFELVDQRSLNGTYVNGERVDRAV-LTNGAEVRIGKFRLNF.. 154
162 1.000e-34UniRef50_A0A239TM44 Oxoglutarate dehydrogenase inhibitor n=3 Tax=Selenomonadaceae TaxID=1843491 RepID=A0A239TM44_9FIRM  ali  22  1MVDAFLVALQYGMLLCICGFIYFTVKSMFKDLKSTSVLKPEKENTPNQVALI----------VLEATDSNLANKKISF-SGQISIGRGKENDVVLNDIYVSHHHAVISPVHNLYQIEDLQSRNHTYINGSVLHGKAFLQNGDIIKIGCVTFRFE. 144
163 1.000e-34UniRef50_A0A2G4FEC4 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2G4FEC4_9ACTN  ali  28  14.PEAVLTILKFGFLALVYLFLWQVVRVVMLELRPASVGGRSRNSPPVIKRTKNRAARIR-----IIEPSAHSGETFTVGQ-EITIGRGGACTVVINDEFASTIHARIFPSNEDVLVEDLGSRNGTLVNGTAIQGIVALSHGDQVQFGQTVVEV.. 160
164 1.000e-34UniRef50_A0A2I2KRK3 FHA domain-containing protein FhaB n=273 Tax=Actinobacteria TaxID=201174 RepID=A0A2I2KRK3_9ACTN  ali  49  31.........................RAVRLDMFGPTKRQQRRGPPPMARPTPPSPPPPRSPSKLVVTKGHLAGTTIPLGSSPVTIGRAQDSTLVLEDDFASGRHARLVPHDGQWFVEDLGSTNGTYLNRTKVTSPMPVPLGAPVRIGKTVLELH. 164
165 2.000e-34UniRef50_A0A2G6PB74 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2G6PB74_9CHLR  ali  29  11..........................................................QPIAQLIVQKGPQPTQIIDLALEQLTIGRSSTNDFPITDPEISRKHARLVKQGTTYAIEDLGSTNGTFVNERRISGLTPLHDGDIIEFGEAI..... 102
166 2.000e-34UniRef50_A0A1F2WJ86 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_13_55_18 TaxID=1797197 RepID=A0A1F2WJ86_9ACTN  ali  28  109...........................LREGEFAVDTTMEKPVGMDIPVAVRPARASGDTIGTLAFLSGENAGSSQDLEGKKTSIGRADDNDLVLQDPRASRFHAEIERTEQGYVLRDLGSTNGTLVGDRRVRER-LLEDGDKLTVGETEFRFR. 234
167 2.000e-34UniRef50_D2NQ68 Protein containing forkhead-associated domain n=49 Tax=Actinobacteria TaxID=201174 RepID=D2NQ68_ROTMD  ali  38  40........................................RAAPVDAVPEATHIAPPPARPSQLVITAGAQAGAMMQLGDHPITIGRANDIEVSLQDDYASGRHARLFPQGSRWFLEDLNSTNGTFVNGERLTRATPIEPGDDFRVGGTTMQLR. 153
168 2.000e-34UniRef50_M7NDZ4 Oxoglutarate dehydrogenase inhibitor n=93 Tax=Terrabacteria group TaxID=1783272 RepID=M7NDZ4_9MICC  ali  43  29........................RRDLAIGGKARVGAPTARQIRKDPSLAPPPETPAKQQATLAILEGPLTGLEHQLTASPILLGRAEEATIVLDDDYASGRHARLFPQGTRWFIEDLGSTNGTFLGEAQLTRAQPVELGQKIRIGKTVMELRP 160
169 2.000e-34UniRef50_D5P6L6 FHA domain protein n=6 Tax=Actinobacteria TaxID=201174 RepID=D5P6L6_9MYCO  ali  30  7....................................................RVEGLPTGAALLVVKRGPNAGSRFLLDRPVTSAGRHADNDIVLDDITVSPHHAEFRRENGQFQVVDIDSPDGTYVNRELVDSAV-LANGDEIQMGKFRLMF.. 106
170 2.000e-34UniRef50_UPI000424E4CC FHA domain-containing protein n=1 Tax=Brevibacterium album TaxID=417948 RepID=UPI000424E4CC  ali  27  157..........................................PHTGEIHPVPDLQGLDETDALLVVVSGPDAGAQILLDTDVVTVGRSPNADIFLDDVTVSRKHAEFVRTPSGFTLRDTGSLNGTYVGRQLIDS-IELQNGADVQIGKFRMIFQ. 267
171 2.000e-34UniRef50_A0A168FKH2 FHA domain-containing protein FhaB n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A168FKH2_9MICO  ali  42  29............................RRDLALRNPRGRRKSAEEPSGPPPRTAARASGPTRLVVTAGPLTGTTLPLSTSSILIGRAPSCTLVLDDDYSSSRHARIFPQGDHWYVEDLGSTNGTYMGDEKVGGPTHLPPGVGVQIGRSVVELQ. 160
172 2.000e-34UniRef50_A0A2H1L728 FHA domain-containing protein n=4 Tax=Brevibacterium TaxID=1696 RepID=A0A2H1L728_9MICO  ali  26  173..................................PQFSGILDPHTGEIHPVPDLQNLDETDALLVVVSGPDAGAQILLDTDVVTVGRSPNADIFLDDVTVSRKHAEFVRTPSGFTLRDNGSLNGTYVGRQLIDS-IELQNGADVQIGKFRMIFQ. 291
173 2.000e-34UniRef50_A0A2H5ZE84 Glycogen accumulation regulator GarA n=1 Tax=bacterium HR29 TaxID=2035424 RepID=A0A2H5ZE84_9BACT  ali  28  9......................................................RTSPPTFAYLIVTKGAQAGSIFQLKPDTTTVGRSGTNDIRIDDPNVSGEHLRIRHESGEFTLIDLGSTNGTRVNGRQMHQ-HVLRHNDRVQIGDTILLFK. 107
174 3.000e-34UniRef50_A0A1D7W541 FHA-domain-containing protein n=29 Tax=Bacteria TaxID=2 RepID=A0A1D7W541_BRELN  ali  23  201..........................PVSGDSGNQQFQGILDPHTGEIYPVPDLEGLQDTDALLVVVSGPDSGSQILLDTDVVTVGRSPNADIFLDDVTVSRKHAEFIRTPSGFTLRDTGSLNGTYVGRQLIDS-IELQNGADVQIGKFRMIFQ. 327
175 3.000e-34UniRef50_UPI0006C91D72 FHA domain-containing protein n=1 Tax=Thermanaerothrix daxensis TaxID=869279 RepID=UPI0006C91D72  ali  32  6..............................................................QLYMRSGPTPGERFSLEKEEVWLGRDPSNDIVIADPEVSRRHARFLLRGSTYAIEDMGSTNGTLVNGEMITALKPLAHGDVIELGHTSLVFE. 98
176 3.000e-34UniRef50_D4YKH1 FHA domain protein n=1 Tax=Brevibacterium mcbrellneri ATCC 49030 TaxID=585530 RepID=D4YKH1_9MICO  ali  27  159..........................................PRTGEVMPVADLNRLQDTDALLVVVSGPDAGAQILLDTDVVTVGRSPNADIFLDDVTVSRKHAEFVRTPSGFTLRDTGSLNGTYVGRQLIDS-VELRNGADVQIGKFRMIFQ. 269
177 3.000e-34UniRef50_A0A2H6B8G1 Glycogen accumulation regulator GarA n=4 Tax=Bacteria TaxID=2 RepID=A0A2H6B8G1_9BACT  ali  27  26.........................RIGESEGGTTEAYQIDPSGELRPIDIEEAAAGGA----LVIRSGGGAGELFELAGERTTIGRSPNSDVFLDDVTVSRNHAVVVRRRDGFYIDDLGSLNGTYVNRRRI-ESHRLSHGDELQIGKYRLTF.. 149
178 3.000e-34UniRef50_A0A2P2BY05 Uncharacterized protein n=38 Tax=root TaxID=1 RepID=A0A2P2BY05_9ZZZZ  ali  40  35................................ARVPEGARVERTGRKQKAAKPPTKRRGSPTHVAVVDGSNAGQRAELDAAPILIGRGTDAAIRLDDDYVSTRHARIAASGDQWFVEDLGSTNGTYVGTARITQPTTISLGTQVRIGKTTLELR. 156
179 3.000e-34UniRef50_A0A2H5WXI9 Glycogen accumulation regulator GarA n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5WXI9_9BACT  ali  24  297......................................PPLETAGVAPTATPLSTTVSAIPTRLVGLQGAYAGQVFEINADLITIGREAGNDIVLEEITVSRRHAQLIRQNGELMVQDLGSTNGTFVNGQRISGVTPLRVGDTVQFGMASFRVE. 413
180 3.000e-34UniRef50_UPI0009467EE4 FHA domain-containing protein n=1 Tax=Ornatilinea apprima TaxID=1134406 RepID=UPI0009467EE4  ali  28  2...........................................................ASYRLVMRNGPTPGKSFLLEQAELFVGRDLNNEIVINDPEVSRRHARFLLQGDGYILEDLGSTNGTTINGQRIMGPYALRPGEVILLGEVTMVYE. 97
181 4.000e-34UniRef50_A0A1J5PN13 Glycogen accumulation regulator GarA n=5 Tax=root TaxID=1 RepID=A0A1J5PN13_9ZZZZ  ali  26  37.............................RTTPTPTPIAHQTVGDLLTDDDHAVAELASDCALLVVKRGPQAGSRFLLDADLTTVGRASANEIFLDDVSVSRKHALFQRSVGHFTVSDVGSLNGTYVNRDRIDSK-ELASGDEVQIGKFRLVFYP 166
182 4.000e-34UniRef50_A0A1R3UEV2 Adenylate cyclase n=32 Tax=Actinobacteria TaxID=201174 RepID=A0A1R3UEV2_9ACTN  ali  29  94.................YSFVGPVRVQFRSDDGLKTGRFRIRSGQPVGDPAPGSAQRQMGRPRLLISPGGGMQQSFELTTPVTLLGRGTDCDLRLVDNGVSRHHVEIRVDGDEVILEDRGSTNGTFVNGQQVRQA-RLVDGTRISLGRTTMTFR. 252
183 4.000e-34UniRef50_C7R4A1 FHA domain containing protein n=5 Tax=Micrococcales TaxID=85006 RepID=C7R4A1_JONDD  ali  27  37...........................................AAAAPEVREYVAGLPRGSALLVVQAGKTFTERFLLDADRVVAGRSEDADIFLNDVTVSRTHAEFIRHGDQFEVRDAGSLNGTYINRDRIDS-YTLKNGDELQIGKYRMIY.. 145
184 4.000e-34UniRef50_E2MZ06 FHA domain protein n=12 Tax=Corynebacterium TaxID=1716 RepID=E2MZ06_CORAY  ali  37  34....................................GSAPLRPLRQTSSAPAKRFQRSQTPHQLLVTSGPLAGSRMNLNNQRITIGRSESNAFVLNDDFASGQHARVINRDGIWYLEDLDSRNGTFLNGQRVEQPERLASGMEFRIGRTTLRLQP 153
185 4.000e-34UniRef50_A0A1X6X5J8 Uncharacterized protein n=3 Tax=Micrococcales TaxID=85006 RepID=A0A1X6X5J8_9MICO  ali  27  29......................................AEEPEHGLTAMDRSAIDALPEGSALLIVRKGPNLGARFLLDADKTVAGRHPQSEIFLDDVTVSRKHAAFLRDGQGFLIRDLGSLNGTYVSRERVDEA-RLHSGEELQIGKYRLTYH. 143
186 4.000e-34UniRef50_A0A2E0RPF0 Uncharacterized protein n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E0RPF0_9ACTN  ali  28  256.................YHFMGPVSVDLRVDNSLKPGRFGIASQLKQSDPGRRPGTIVMP-----------SGDRIELADDTQTIGRLPDCTVVVSDSNVSRHHSRISRSGSGFVIADLNSTNGTFVNGEKLTADHRLDDGDIITIGSVNLRFE. 381
187 5.000e-34UniRef50_A0A1G6GFJ6 FHA domain-containing protein n=3 Tax=Propionibacteriaceae TaxID=31957 RepID=A0A1G6GFJ6_9ACTN  ali  28  44............................APEPRPVKTRNRRAERTPAAPLPGRPAPASVVPARLIVTNGPQTGMAAEVDQAGTVIGRSPECAIVLEDDYISTRHARVVNGDQGLYLEDMGSTNGTYVNGRRISAPTSVGTEDEIRVGRTILKLEP 172
188 5.000e-34UniRef50_A0A0F9UG93 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9UG93_9ZZZZ  ali  32  60............................................................AAVFVVKKGPILGQRLPINDDETLIGRDPKADIFLNDITVSRRHAKIIRGDSGATVKDLGSLNGSYLNGDIITDSA-LKNNDELQIGKFLLVF.. 151
189 5.000e-34UniRef50_A0A1H6FMN1 FHA domain-containing protein n=1 Tax=Thermoleophilum album TaxID=29539 RepID=A0A1H6FMN1_THEAL  ali  24  27..........................SARRELARTAEVATEPPPLHTERPSEPMLDLAGGNPRLEVIAGHSPGAEVPLNGGA-TLGRSASADVVVDDPFASAVHARIFPQGGFMWIEDLGSTNGTYVNGRRIDAPQRLRPSDVIRIGDSEYRY.. 155
190 5.000e-34UniRef50_F9ED62 FHA domain protein n=37 Tax=Actinobacteria TaxID=201174 RepID=F9ED62_9ACTO  ali  24  94.................YSFVGPVKVSFTPDAALTAPAIEIESSTQRGGAAPAASANAPGHPILDI-----NGQRYLLTGPVTVIGRGSEADIIVDDSGVSRRHLEVRLTQGHAIATDLGSTNGTFVEGHRVDAATLL-DGNTLTIGRTRIMF.. 224
191 5.000e-34UniRef50_A0A150H747 Glycogen accumulation regulator GarA n=10 Tax=Micrococcales TaxID=85006 RepID=A0A150H747_9MICO  ali  24  23..........................HQTQAAQPAPISGILDPRTGEIRPVPDVDHLQETDALLVVVSGPDAGAQILLDTDVVTVGRSPNADIFLDDVTVSRKHAEFVRTPSGFTLRDTGSLNGTYVGRELIDK-VELQNGADVQIGKFRMIFQ. 149
192 5.000e-34UniRef50_UPI0009DECD00 FHA domain-containing protein n=1 Tax=Bifidobacterium cuniculi TaxID=1688 RepID=UPI0009DECD00  ali  31  2........................................PAQRATAPSAPTPTPAGGAQPTLLVIIDGPLAGTSIPLGDDVITLGRAASNSVVLDDEFVSSHHARVYHDASGWAIEDLRSTNGTVVNQQRIDSPTILAPRVPVRIGATTFELR. 116
193 6.000e-34UniRef50_A0A1W2G0Y9 FHA domain-containing protein n=1 Tax=Kibdelosporangium aridum TaxID=2030 RepID=A0A1W2G0Y9_KIBAR  ali  26  10........................TRSAPLDGADQDTAAYAIPPRYADAAPTPQSPLPGTAA-ITITHGPGAPVEIPLTADTILIGRHQDCDIVLADMTVSRRHAEIRRVGDAFTVTDLGSLNGTYVNRTPIDHSQ-LADGDVLLVGAFRLTFR. 139
194 6.000e-34UniRef50_A0A2E0WDE3 Uncharacterized protein n=58 Tax=Actinobacteria TaxID=201174 RepID=A0A2E0WDE3_9MICO  ali  40  27..........................VLRRDLRAPREARPSVVATTASVSPAPRRSRSSGKGRLVVTEGPLSGTVVPLGSGSISIGRAPDSTLVVDDDYASGEHARIYPVDDQWIVEDLNSTNGTWLESTRISRPTVLPTGVPLRIGRTVMQVR. 155
195 6.000e-34UniRef50_I8RIZ1 Forkhead-associated protein n=4 Tax=Pelosinus TaxID=365348 RepID=I8RIZ1_9FIRM  ali  21  13......IVLQYSLLGLIYYFLSKVIKIIYTDLDRAGQKKSSIGNEGNQFNFHKRANL------LVVDSGHLSQNSFSLD-DITYLGRNEQNGIIIDDSFVSHEHASINKGQQGYLLTDLNSTNKTYLNGQPIVEATLLKNGDLIKIGAVTFSFK. 155
196 6.000e-34UniRef50_A0A0R2QUR6 Uncharacterized protein n=2 Tax=unclassified Acidimicrobiia TaxID=121036 RepID=A0A0R2QUR6_9ACTN  ali  31  27.......................................................GNENAHGLLVMRSGERSGERFSLALDRVEIGRNPECTVCLDDVTVSRRHAELRLGNNGYVVTDMGSLNGTYVNQERV-EEILLQNGDELQVGKYRMVF.. 123
197 7.000e-34UniRef50_A0A2G6P6V3 Uncharacterized protein n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2G6P6V3_9CHLR  ali  31  3...........................................................SAYQLIVQKGPQPGQIYPLLSTSITLGRDPITDIVLNDPEVSRQHARLTQTANSYQIEDLQSTNGTYVNGTQVRAAVPLAHGAEIQLGSVLLIFE. 99
198 7.000e-34UniRef50_X0WIS6 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X0WIS6_9ZZZZ  ali  32  6.VAVLLTVGKYLFLVCLYVFVLAVFRGMMRQLGADVGATDRPRGLAASASQPAAVQVPSGPPRLVVVEDPAPGSELPLTAA-VTIGRNQENAIALKDGYTSGRHALICLREGRRMLLDRGSTNGTFVNGQRVDSEVELRDGDRIALGRTVLEYR. 185
199 7.000e-34UniRef50_A0A2E7SK58 FHA domain-containing protein n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A2E7SK58_9ACTN  ali  35  39...............................................................LVIESGPKSGSRYALDSESILIGRGKDSDIFLDDVTVSRRHALIERDGSEYKVSDLGSLNGTYVNAKGIQSE-ELVDGDVLQVGRFKLVF.. 127
200 8.000e-34UniRef50_A0A2M7CMW4 DUF2662 domain-containing protein (Fragment) n=1 Tax=Anaerolineae bacterium CG03_land_8_20_14_0_80_58_20 TaxID=1973905 RepID=A0A2  ali  33  12................................................................VMRSGPTVGALYPLEADSISIGRDASNGIQINDAEISRRHARLQFQGGKYVIEDAGSTNGTHVNGQRIMSAYVLKPGDVVSFGE....... 95
201 8.000e-34UniRef50_A5UTG0 FHA domain containing protein n=2 Tax=Roseiflexus TaxID=120961 RepID=A5UTG0_ROSS1  ali  30  1...........................................................MPAYLVAVSGAQAGKQFPLTDAPCSFGRNPDNAIVVASARASRRHAEIRREGGDFILYDLGSANGTLVNGQRIAAPHRLRSGDLIEIGDETFRFE. 95
202 8.000e-34UniRef50_K6UNM6 Uncharacterized protein n=6 Tax=Micrococcales TaxID=85006 RepID=K6UNM6_9MICO  ali  36  41...................................AADGRAKVRPTSNVPSSRAERRGRGLRSLVIVEGPLRGTTVPLRSSGVLLGRNPECTLVLDDDFSSGRHARIFEEAGHWYLEDLNSTNGTFVSGQRISQPIEMRDGSQLRIGTTVLELR. 159
203 8.000e-34UniRef50_A0A2E8BF10 Uncharacterized protein n=9 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2E8BF10_9ACTN  ali  24  31................................SGDHEATDSFEALPIIPHEDDRARFPSGIGLFVVDSGPKAGSRYGLESEVTSVGRHRSADILLDDVTVSRRHVEVDRTGDRYVVRDIGSLNGTYLNGDRIESA-ELHDGDELQIGRFKLVF.. 150
204 9.000e-34UniRef50_A0A1M4DXK3 Adenylate cyclase n=40 Tax=Actinobacteria TaxID=201174 RepID=A0A1M4DXK3_9ACTN  ali  27  94.................YSFVGPVRVRFETAGDLAVGLFRIRSGVIRGATVEQDEIRQPGRPRLLVQDDPQGDRSYELTTPVTLLGRGTDCDLRLVDPGVSRHHAELRVEGQTVVLVDLGSTNGTFVNGQPV-RRIELQNGTRVTLGRTTLVFR. 244
205 9.000e-34UniRef50_A0A0P9D8Y9 Uncharacterized protein (Fragment) n=1 Tax=Kouleothrix aurantiaca TaxID=186479 RepID=A0A0P9D8Y9_9CHLR  ali  27  1...........................................................MPAFLSGLQGGHAQRQIPLNDAPTTFGRNPDNTVVIDSGRASRRHAEIRSQGGMFVLADLGSSNGTFVNGQRLAAPHTLRPGDLIQIGDDTFRF.. 94
206 1.000e-33UniRef50_A0A261F7Z0 FHA domain-containing protein n=2 Tax=Aeriscardovia aeriphila TaxID=218139 RepID=A0A261F7Z0_9BIFI  ali  36  269...........................................SATTTKETARSAMPSQAATMLVIIDGPHAGATFPLDQGNITLGRSTHNTIVLDDEYVSGHHARVCQDPGQWVVEDLGSTNGTYINESRMPGRAVLRPRVPVRIGATTFELR. 381
207 1.000e-33UniRef50_A0A2E0X9C8 Protein serine phosphatase n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E0X9C8_9PLAN  ali  27  4....................................................RTPLPRTGMATLKILQGPQVGQKFDLTGPTSVIGRSPECDVVLDVAAVSRRHASIESNGGRTVLQDHGSRNGTYVNGQRVVDQAELRDGDQVLICDVLFEFR. 105
208 1.000e-33UniRef50_UPI000DEB993F FHA domain-containing protein n=1 Tax=Brevibacterium celere TaxID=225845 RepID=UPI000DEB993F  ali  26  185..........................................PHTGEIHPVPDLDGLQETDALLVVVSGPDSGSQILLDTDVVTVGRSPNADIFLDDVTVSRKHAEFIRTPSGFTLRDTGSLNGTYVGRQLIDS-IELHNGADVQIGKFRMIFQ. 295
209 1.000e-33UniRef50_A0A2E0L269 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E0L269_9CHLR  ali  24  125..........................HIRRETLKPTGTTNPMPE-PLKKEMLGTTRMDAPGVWLSVHRGPQQGQEWNLNKDEITVGRDITNDIAINDQQVSRRHARFVRNPTSFTIEDLGSSNGTFVNKDPLNEPRRLKHGDVIELGETVLVYQ. 256
210 1.000e-33UniRef50_A0A100W0T6 Signal transduction protein GarA n=1 Tax=Mycolicibacterium brisbanense TaxID=146020 RepID=A0A100W0T6_9MYCO  ali  24  24..................................AATDGRQRSSPSYGSALWRCDEPRLDCAVVVIKRGPNAGLRFALKGSVTSAGRHPRSDIFLDDVTVSRLHAEFRRENDQYQLVDTGSLNGTYVNHEPVQS-VALVNGDDIQIGKFHLVF.. 141
211 1.000e-33UniRef50_A0A286RGF8 Serine phosphatase RsbU, regulator of sigma subunit n=1 Tax=Thermogutta terrifontis TaxID=1331910 RepID=A0A286RGF8_9PLAN  ali  25  1............................................................MAELRQIEGPDRGRVFPIDADCVVLGRHPHCNIVLDIGAVSRQHAQIVRTPTGYFVEDLNSRNGTFLNEQRLHGRRPLRHGDRIRICDLVFVFH. 94
212 1.000e-33UniRef50_D3EYP5 FHA domain containing protein n=12 Tax=Actinobacteria TaxID=201174 RepID=D3EYP5_CONWI  ali  28  7.....SVALKLGFLAVLYLFLLWIVRSSLKDLRRAQAPAADATAMHNAADDLLGDAIGDGEPRLVVERGHPDGIAYDLARG-VTLGRG-DVEIRLEDPFASSHHARIERQGSVLVLEDLGSTNGTYLNEEPLRGIQPLHHGDRIRIGDSEFSY.. 167
213 1.000e-33UniRef50_A0A151BZ86 FHA domain-containing protein n=4 Tax=Micrococcales TaxID=85006 RepID=A0A151BZ86_9MICO  ali  38  39.....................................TRGASAASAVPRERAQRRKRASGPTHLTVTDGSMRGSRIPLGDTPILIGRNPECSLVLSDDFASGRHTRIYRDGLQWYADDLGSTNGTFVDDRRISEHAALKEGSEIRIGQTVLEVR. 155
214 1.000e-33UniRef50_A1HMX1 FHA domain containing protein n=2 Tax=Sporomusaceae TaxID=1843490 RepID=A1HMX1_9FIRM  ali  24  13......TILQYTLLLLLYYFLFRVVKIIYLDLQNPKITNPTL-----------VHPADLKPATLKVQAASLAQPVFEL-AETTSIGRSDANDIVINEAYVSHEHACISFYKQQYWLADLNSTNGTFVNGQRITGEVPLRSGDIIKIGSVSFKFE. 150
215 1.000e-33UniRef50_A0A1F9GQQ8 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_43_9 TaxID=1797867 RepID=A0A1F9GQQ8_9DELT  ali  32  13.......................................................RAKRTQPSLVLIAGKPLGKRFPITPPQIVIGRSSDVEVSIDSPHISRKHAILKVQDGKIIVEDLGSTNGTFVNDAKIGHPVILKEGDHIRCGKTIFKFLP 112
216 1.000e-33UniRef50_A0A151AXZ8 Glycogen accumulation regulator GarA n=13 Tax=Thermoanaerobacteraceae TaxID=186814 RepID=A0A151AXZ8_9THEO  ali  24  112.....................GEVRIHARMEEGRPEEDGETGDTLIYKAIDEEVDRPGRPSFKLTVIAGPDAGRTFLLRPGKQVLGRHPACDFILTDEQVSRRHCQLEESHDRVLVTDLGSRNGTLVNGKKVERA-FLNPGDRMQVGRTVLELQ. 247
217 1.000e-33UniRef50_D3Q5N1 FHA domain containing protein n=43 Tax=Actinobacteria TaxID=201174 RepID=D3Q5N1_STANL  ali  51  26.........................RTIRRDVFAGTAARTPARVPGRGNASRRGGGGPRPPRQLVVTEGELAGTQLPLGNAPIRIGRAPDSTLVITDDYASGRHAQLVPRGDQWLVEDLGSTNGTYLGRAKVSGPTPIPAGVPIRIGRTSIELRP 158
218 1.000e-33UniRef50_A0A1V4VUX1 Glycogen accumulation regulator GarA n=14 Tax=Clostridia TaxID=186801 RepID=A0A1V4VUX1_9FIRM  ali  27  130...............................AEADAGVLEHTQLFRLAKDITVVEKTPAVYARLKVEAGPEKGRIINLSKASQVIGRHAGCDIVLNDFSVSRRQARLEWVQGRFAITDLGSTNGTWVNGSRIVSKV-LEPGDEVALGTTVCAFK. 251
219 2.000e-33UniRef50_A0A2D6PEL8 Uncharacterized protein n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A2D6PEL8_9ACTN  ali  27  53.............................HEIRSSADEITDNFELGEELPHEEDRARPHDCGLFVVESGPKAGARYGLEADLTTLGRHGDADIFFDDVTVSRRHAEVQRTGDRYLVRDTGSLNGTYVNRDRIESA-LLQDGDELQIGRFRLVF.. 176
220 2.000e-33UniRef50_A0A1Y1RR00 Uncharacterized protein n=1 Tax=Rothia nasimurium TaxID=85336 RepID=A0A1Y1RR00_9MICC  ali  22  8..........................PATSAMAAVKPLGVATSHQPTTEESDLLATLPGGSAILIGLDGQFKGARFLITSGVTVAGRSPDSDIYLDDVTVSRRHALFMPNAGSYILTDAGSLNGTYVNGDRVDEAY-LKNGDEIYIGKFHFAF.. 139
221 2.000e-33UniRef50_A0A1F9F447 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_40_11 TaxID=1797858 RepID=A0A1F9F447_9DELT  ali  33  25..........................................................TGVPCLVLIEGSPLGKKFPLVPPKVRFGRGSRSDLSIDDKSVSGEHAEVIVKGQEVQIVDLKSTNGTYVNDQKISEPMVLKEGDTVRIGTTIFKY.. 119
222 2.000e-33UniRef50_A0A2T2RIK4 FHA domain-containing protein n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A2T2RIK4_9ACTN  ali  35  29........................VRAVIRDVR----RDAPSRRAAPSPPASRPGARPGSASQLVVHRPEARPEIVALDGNEIRFGRSRDCDIVLTDDFVSERHARVFPRQGGWMIADMGSTNGTYLNRQRVNEASPISGGDQVTIGKTIVEVR. 154
223 2.000e-33UniRef50_A0A0B0DF47 Signal peptide protein n=3 Tax=Kocuria TaxID=57493 RepID=A0A0B0DF47_9MICC  ali  35  42........................VRGGREKLRDARAREPRQEAPQNPRPAAPTTGGARTRAQLVVVDGPLAGRSFQLGSAPVMLGRSAEATIPLEDDYASGRHARLFAQGSKWFLEDLGSTNGTYLQDQRLARATVVDPDVRFRVGRTVMELRP 173
224 2.000e-33UniRef50_A0A0Q2UBI8 Peptide-binding protein n=2 Tax=Mycobacterium gordonae TaxID=1778 RepID=A0A0Q2UBI8_MYCGO  ali  27  7............................RADLGGASASVADVLS------AEDVESLPPGYGMLVVTRGPNTGSQIRLDRPVMSAGRHQLSDIYLDDITVSRRHAEFRREKGEFHIVDCGSFNSSYVNGQPVESAV-LSNGDEIQIGKYRLVF.. 124
225 2.000e-33UniRef50_UPI000D6C04B7 DUF2662 domain-containing protein n=1 Tax=Quadrisphaera granulorum TaxID=317664 RepID=UPI000D6C04B7  ali  25  94.................YSFSGPVVVRLQRDDELATGVFRVRSARVRGGAPATSAVATPAHPVLEV-----DGRSYQMTSERTVIGRGSECDVVVDDPGTSRRHLEVVRSGGRTTVHDLGSTNGTSVDGRRLDDAAVLHDGSRIQLGRTTVVFH. 230
226 2.000e-33UniRef50_A0A2H6HBT1 Glycogen accumulation regulator GarA n=1 Tax=bacterium BMS3Bbin01 TaxID=2005724 RepID=A0A2H6HBT1_9BACT  ali  25  27....................................EPTITFVPEMAASVSEAEEATLSGGYILLVKRGPRAGMGWVLQQGTTTVGRHPDSAIFLDDITVSRHHCRLILDRTDLTVEDSGSTNGTYVNGERVDRAA-LETGDELIVGKFHLVV.. 142
227 2.000e-33UniRef50_A0A0R3JU77 FHA domain-containing protein FhaB n=9 Tax=Clostridiaceae TaxID=31979 RepID=A0A0R3JU77_9CLOT  ali  21  1MKEIAM-ILKFVVIGLIYLVLFRIIRVMYLDLKGVKPKGNVKEYTLEVIDAPEETGLSRGS--------------FFLVHKVLLIGRNDDSDITIKDPYISGNHAKIFVKNNNLYIEDLNSTNGTFLNGKRIKDLEGIDDGDIIEMGRVTFKV.. 138
228 2.000e-33UniRef50_A0A1F8KT94 Uncharacterized protein n=1 Tax=Chloroflexi bacterium GWB2_54_36 TaxID=1797613 RepID=A0A1F8KT94_9CHLR  ali  32  6..............................................................RLILKSGPNSGQVFPLEASEIVIGRDINATFVINDPEVSRRHARLTLQGANYIIEDLGSTNGTMVSGQRLAGPYILRPGEMVTLGHTHVLFE. 98
229 2.000e-33UniRef50_A0A161I8G7 Glycogen accumulation regulator GarA n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A161I8G7_9MICO  ali  22  96.................YAFVGPVSVTFERHDELTGGRFQIRSATVRGNVAPATNPAPSTRHPLIDID----GQRYLLTGPVTVIGRDAEADIVVDDPGVSRRHLEIRVAPEGVVATDLGSTNGLFVEGHQVPAATLL-DGNTLTIGRTRIMF.. 226
230 2.000e-33UniRef50_A0A2H6K358 Glycogen accumulation regulator GarA n=23 Tax=Bacteria TaxID=2 RepID=A0A2H6K358_9BACT  ali  31  63..............................................................SLVVRSGGGAGESFLLAGETTTIGRSPGNDIFLDDITVSRDHAVIVRKHDGNYINDQGSLNGTYVNRTRVETR-KLFDGDLLQIGKYKLTY.. 153
231 2.000e-33UniRef50_S0EV04 FOG: FHA domain n=4 Tax=Chthonomonas TaxID=1077265 RepID=S0EV04_CHTCT  ali  27  336.............................EQPPLPPITEGTADPLAGLSGVAGSPLNVGSRPRLVGTIGVYAGQMFELQGSQVDIGREPSNTVVLSDSNVSRRHASIQNQGGQFVIVDNGSSNGTFVNGARIQTPHPLRPGDEIQVGMTRFRFE. 463
232 2.000e-33UniRef50_A0A2H6GPX4 Glycogen accumulation regulator GarA n=1 Tax=bacterium BMS3Abin14 TaxID=2005722 RepID=A0A2H6GPX4_9BACT  ali  27  30..........................................PTQTIPKRRGAAKPDRPAKAYMAVLTGAKAGSQYPLNDRQTVIGRSPGCEIHIDDPDASRRHAAVQPFGNDYYLMDMGSTNGTLVNGKPV-EKRILKHGDKITLGKQVLQF.. 140
233 2.000e-33UniRef50_A0A2M8N8B5 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8N8B5_9CHLR  ali  27  9..............................................................RLIVRRGPQPNQTFDLKGDVITLGRDITNDIVINDPEVSRHHLRITKTADGYTLEDLGSTNGTFIAGQRITGVRALNRGDLIGLGETV..... 96
234 2.000e-33UniRef50_A0A1W9VJ44 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium 4572_5.2 TaxID=1971725 RepID=A0A1W9VJ44_9CHLR  ali  27  8...................................................EQPTSRPGAQLRIEIHAGPLAGKGYPFAGNTISIGRAPENDISLDDSQVSRHHAILRRQGNEIILEDLGSTNGVFVNGERIYLPHVLQPTETISIGESVF.... 107
235 2.000e-33UniRef50_A0A1W9UGA3 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium 4572_32.1 TaxID=1971623 RepID=A0A1W9UGA3_9CHLR  ali  34  6..............................................................RLVMNQGPQPGQTFMIDKDLVTLGRDPSSELVINDPQASRQHARITRRGNLEVIEDLGSTNGTFVNGVRLTDPHTLTNGDVIGLGDSI..... 93
236 2.000e-33UniRef50_R4KHZ9 FHA domain-containing protein n=2 Tax=Desulfotomaculum gibsoniae TaxID=102134 RepID=R4KHZ9_9FIRM  ali  30  131....................................PETVEDTMRFTPLRGVVDEPSRNETVLLEVVEGALAGKRFTLDSSQAVIGRGEICDICLPDNSISRRHAALSRTGRHFVIKDRSSTNGTYVNGVKVTER-ELVDGDIIKMGNTVLIFK. 247
237 2.000e-33UniRef50_A0A2N3Y243 PSer/pThr/pTyr-binding forkhead associated (FHA) protein n=4 Tax=Saccharopolyspora TaxID=1835 RepID=A0A2N3Y243_SACSN  ali  23  6.....................FGTAVPPTEAFRDVPPAAIPAEAGVDTPAPRAAAAPTGSSAELVIARGPQAGTAIPVTGTPLTVGRSRDCDITLDAPTVSHFHAQICQDGEQCTITDSGSLNGTYVNHAPVDRA-ELADGDEVWIGTFRFTFR. 137
238 3.000e-33UniRef50_A0A2H5ZTS7 FHA domain-containing protein FhaB n=1 Tax=bacterium HR32 TaxID=2035427 RepID=A0A2H5ZTS7_9BACT  ali  27  1MSELFFQPLRYVVLAALFLFLYRVVRALDEDLGRAEREGAVAALVVEEAAPGLPP-----------------GHVFLVRSGAV-VGRSAPSTVVVPDPQAEDQHLRLVLRGTGFWVEDLGSKAGSFLNGRRLEAPAPLADGDRIRLGATVLRF.. 135
239 3.000e-33UniRef50_K4IYX7 FHA domain containing protein n=85 Tax=Bacteria TaxID=2 RepID=K4IYX7_BIFAP  ali  33  35..................TFSPKTSHTRRRSERAAQGKLPAAARSVPIAPVSKTEPANNEPSLLVVIDGPLAGSSTPLSGRPITLGRSSSNTLVLDDEFVSGHHARVYQDPGRWAIEDLGSTNGTVVSGQKITAPTILPAEVPVRIGATTFELR. 172
240 3.000e-33UniRef50_Q08SH1 Pkn9 associate protein 1 n=3 Tax=Stigmatella TaxID=40 RepID=Q08SH1_STIAD  ali  27  51.....................FPVPRRMPRGPRSPRQMHQD-RELLPRFDARDSSEPGHTSASLYVEKGPGAGQLIPVNQGVLVIGRASACDLRLQHPSISRRHVQLLRTGERFILRDLGSQNGTFINRVKIEGDVELCPGDELTLGNSVLKLR. 183
241 3.000e-33UniRef50_A0A1V6G2G2 Transcriptional regulatory protein ZraR n=1 Tax=Planctomycetes bacterium ADurb.Bin069 TaxID=1852902 RepID=A0A1V6G2G2_9BACT  ali  33  1............................................................MAHVVIIEGVERGKSFRLDAERVAIGRDPECDIVLADQAVSRRHCELRREEGGWVVADLGSSNHTFVNDAPVDSA-RLKDGDRIGVGDCELML.. 92
242 3.000e-33UniRef50_UPI00037C14D6 DUF2662 domain-containing protein n=1 Tax=Desulfurispora thermophila TaxID=265470 RepID=UPI00037C14D6  ali  28  132......................RVETAFSQEESVPQAAGEPDWDDTKDTDTAPLATVQRPEFLLAVISGDAAGETLPLYPPRVVLGRRAGCDIVLKDPGVSRRHAVLEWRGDRWVLLDAGSTNGTLVNGKPAVE-VALRPGDIINVGHTALELR. 265
243 3.000e-33UniRef50_F1YLC7 Forkhead-associated protein n=16 Tax=Actinobacteria TaxID=201174 RepID=F1YLC7_9ACTN  ali  67  26.........................RAMRSDLAAAGGGARMPRTSGRAERKQRAARSRGTARYLVVTAGALANTRITLGTQPVLIGRADDSTLVLTDDYASERHARLSPRGDDWYVEDLGSTNGTYLDRSKVTTAVRAPINTPIRIGKTVIELRP 155
244 3.000e-33UniRef50_A0A1F2WJW1 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_16_64_13 TaxID=1797200 RepID=A0A1F2WJW1_9ACTN  ali  33  58.............................................................PVLVIRTGGGRGEVIGLDTDVLTIGRSPHSDLFLDDVTVSRHHARVLHDEGGFLVEDLNSLNGTYVNRKRI-ERHQLFDGDELQIGKFKLAF.. 149
245 3.000e-33UniRef50_A0A2N6F3F9 Uncharacterized protein n=2 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6F3F9_9DELT  ali  28  1............................................................MAKLLVVFKDKVQQEVKLAKETVRIGRDSDNEIQIDNPGVSRFHAEVYRQGYPFYVEDMKSTNGTFVNGSFVSWKAALNDGDRIRIGKHDLIFQ. 94
246 3.000e-33UniRef50_Q1AW32 FHA domain containing protein n=1 Tax=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) TaxID=266117 RepID=Q1AW32_RUBXD  ali  31  61...............................................................LDQVEGTAGRRMHDISRELVTVGRHPESDIFLDDVTVSRKHAEIRRSEGGYRIRDVGSLNGTYVNRVRVD-AVDLRNGDEIQIGKYRFKF.. 149
247 3.000e-33UniRef50_A0A257RDK5 Uncharacterized protein n=1 Tax=Actinobacteria bacterium 21-73-9 TaxID=1970489 RepID=A0A257RDK5_9ACTN  ali  24  29..................................ATSSPETVAVPVVHAPDTLHPEAWRGPGELVIAAGPEAGARIELKGDVTAVGRHESSEILLDDVSVSRHHAVFTRTAGRITLRDLNSLNGTYVNGRRV-EETTLHSADEVQIGKFKLVF.. 152
248 3.000e-33UniRef50_A0A1W9WEM6 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium 4572_78 TaxID=1972460 RepID=A0A1W9WEM6_9CHLR  ali  29  21....................................................SPTHNPSSHLHIVVHEGALAGKTFSFTAEHFTVGRAEDNDIVIDEVQVSRHHATLRRDGNEVTLEDLGSTNGTLVNGEIITEPHILQPTEKITIGTSVFKV.. 121
249 3.000e-33UniRef50_R4KG91 FHA domain-containing protein n=6 Tax=Peptococcaceae TaxID=186807 RepID=R4KG91_9FIRM  ali  27  34...............................TARPSAKVDEIKEGAGYRAPSQVITEKNGPGMLVVESSPGEGAEFALAR-ELNLGRGAHNEIVLPDRFASNSHARLYSQDGQYWLEDLGSKNGTFLNGKPLTGPAVLANGDQIRIGEIIFKF.. 158
250 4.000e-33UniRef50_A0A0B6X1M5 FHA domain-containing protein n=1 Tax=Pyrinomonas methylaliphatogenes TaxID=454194 RepID=A0A0B6X1M5_9BACT  ali  28  26...........................LKESARAPSSFGPIERDRARKTGPPSRSGMSEPHAKLVIERGRAAGKEFFIDADEAQIGRDADNDIDLDDPEVSRRHARIWREGSSYFIEDLGSTNGTFINGRRLGERIPLHDGDEIIVGKTFLRFH. 168
251 4.000e-33UniRef50_C0VY25 FHA domain protein n=15 Tax=Actinomyces TaxID=1654 RepID=C0VY25_9ACTO  ali  37  31.........................RDIFGTVVTPRGKVRERRDVQQKRASRRLAKHQPTMTKLLITSGPLIGTSIELVNNEVVIGRSPASTLVLDDSYASSRHARIFKDGDYWFIEDLGSTNGTYVDDERISGVQPFAVNQILRIGQSTFEL.. 159
252 4.000e-33UniRef50_A0A1N0QLS9 Conserved protein of uncharacterized function with Fha domain n=3 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A1N0QLS9_9MYCO  ali  32  19.....................................................ASEVRPGSGVLVINRGPGPGGQFLLADDVVAAGRHPDSAVFLDDITVSRHHAEIRWLDDEYWIVDAGSLNGTYVNGIQVQ-ALPLTSGDEIQIGKFRLGFRP 121
253 4.000e-33UniRef50_UPI0009F4EC9C FHA domain-containing protein n=4 Tax=Brevibacteriaceae TaxID=85019 RepID=UPI0009F4EC9C  ali  25  23..........................HQTQAAQPAPISGILDPRTGEIRSVPDIGHLQETDALLVVVSGPDAGAQILLDTDVVTVGRNPNADIFLDDVTVSRRHAEFIRTPSGFALRDTGSLNGTYVGRQLIDE-VELQNGADVQIGKFRMIFQ. 149
254 4.000e-33UniRef50_Q2JPE7 GGDEF/FHA domain protein n=1 Tax=Synechococcus sp. (strain JA-2-3B`a(2-13)) TaxID=321332 RepID=Q2JPE7_SYNJB  ali  23  16...............................LDPLSQLPEEPTTQIPLEFYERRPQPEATAAFLTVLSGANVGMTFPLARGGV-LGRSHRADIQLLDHAVSRQHCRLERESEGYVLTDLESLNGTYVNGERVSR-VLLKDGDRIQVGASTLKF.. 135
255 4.000e-33UniRef50_E6KSR8 Pkn9 associate protein 1 n=29 Tax=Bacteria TaxID=2 RepID=E6KSR8_9ACTO  ali  34  36........................TVVTPRGKGRDKAASRRKASREKRKEKKRTSTNPLAPKDLLVTGGPLVGTMLPLGEAPIVIGRSPACTLVLEDEYASSRHAALTPQSDGWWIEDLSSRNGTFIDDERLATPRQLKIGDVIRIGQTTLEL.. 164
256 4.000e-33UniRef50_A0A078MIL8 Glycogen accumulation regulator GarA n=17 Tax=Micrococcaceae TaxID=1268 RepID=A0A078MIL8_9MICC  ali  21  94.................YTLQGPVRVSFTRDSSLRGGTRAAAAPQHRPSPPAPRQSPTRMQPVLDI-----NGQRYSINASSVVLGRSSEADIMVDDTGVSRRHLEIRAGGGTIRAVDLGSTNGSYVNGQRIRSEVRLEDGAVITMGRTRITFR. 236
257 4.000e-33UniRef50_UPI0008268AAF FHA domain-containing protein n=1 Tax=Pseudoclavibacter alba TaxID=272241 RepID=UPI0008268AAF  ali  37  96......................PAPTPVKHADDAPTEHVTAPSSSSSTSGPTTDELRAASRARLIITSGPRKGTEVALGAIPVTIGRHPDSDLVIQDDYSSTHHARLVPNGASWLLEDLSSTNGTYVNGHRLSHSSPLAPGVPVRIGTTTFELR. 228
258 4.000e-33UniRef50_A0A1N5M138 FHA-domain-containing protein n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1N5M138_9MYCO  ali  38  30........................RRDLGVGRNFRTARAVPAADQVSAEPRQTQPAPPARPTQLVITDGAQAGAVMRLTDQPVTMGRATDIEVSLQDDYASGRHARLFPQGSRWFLEDLGSTNGTFVGGTRLTRAVPIEPGSDFRVGRTTMQLRP 160
259 4.000e-33UniRef50_C4V0Q7 FHA domain protein n=11 Tax=Selenomonadaceae TaxID=1843491 RepID=C4V0Q7_9FIRM  ali  26  3MPALFLKALRYGALLWLAYSVFRIGHLMFSSLR-------------MDLHVPRAPVQSVGAPTLLVLTGKGEGKRYPL-GHELSIGRSPDNDIVLSDSFVSHHHVLIYQRENSYIAEDLGSRNCTYLNDGRLSGRAYLRPGDVLRIGAVSLRFE. 147
260 4.000e-33UniRef50_A0A1J5R523 FHA domain-containing protein FhaB n=36 Tax=root TaxID=1 RepID=A0A1J5R523_9ZZZZ  ali  35  35....................LYGTRISTRRDPARTSGPASVPPTRGGAPTPSPAPRRDAPPRRLVVVEGSLRGTSVPLGTSSVLIGRAPSCTLVIDDISLSSRHARLFPEVGGWVIEDLGSTNGTFVSGRRIDQPTPVPLGAQVRVGTNVLELQ. 174
261 4.000e-33UniRef50_M5A308 Putative signal transduction protein n=10 Tax=Actinobacteria TaxID=201174 RepID=M5A308_9ACTN  ali  21  34.............................RTINLTRIDPLQDAPGPDDDLVVPVGDLPVETGVLIVRAGEQAGDRFALDNAVTKLGRHPDSEISLDDITVSRRHVEIERTPDGYVASDAGSLNGTYVNQERIDK-MLLRHGDELQVGKFRLVF.. 156
262 4.000e-33UniRef50_A0A0Q7JTP8 Uncharacterized protein n=20 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q7JTP8_9ACTN  ali  44  41................................SAPRPAPGPQSAPSGPSGRRGQRTSRRTPSHVLVSEGPLKGTTITLGQNSVLIGRNPESTLVLDDDYASGRHARIYPENGEWFVEDLGSTNGTFSGTQRLTSPLKLQVGSTLRIGTTVLELR. 162
263 4.000e-33UniRef50_H3K6I4 Uncharacterized protein n=2 Tax=Megamonas TaxID=158846 RepID=H3K6I4_9FIRM  ali  22  3.SKAFLVALQYGMLLCICGYIFVTVKSMFKDLKSTSSLKPVKEESA---------QNEVALIVLEAADPKLANKKISF-SGQISIGRGKENDIVLDDIYVSHHHAVISPVRNLYQIEDLQSRNHTYINGNILNGKEFLQNGDVIKIGCVSFRFE. 145
264 4.000e-33UniRef50_A0A1V5FWG9 Putative diguanylate cyclase AdrA n=28 Tax=Proteobacteria TaxID=1224 RepID=A0A1V5FWG9_9PROT  ali  27  5..........................................PTTQRTIFSPGPLSPGPSSACLVVIHGEGLGKRQDVREEVIKIGRAPDCTLLIAHPSISRRHCEVWREDGRYWVRDLGATNRTRVNDRPV-ERMELKDGDHLTIGETLLKF.. 114
265 5.000e-33UniRef50_A0A2H6B4Z7 Glycogen accumulation regulator GarA n=13 Tax=Bacteria TaxID=2 RepID=A0A2H6B4Z7_9BACT  ali  31  139....................................GETMVYSPERAARPLAPHVPAAQTRALLIV-----DGKRIVL-GDRTVIGRSRECDVVVPDPNASRRHAEVRREGNGWVVRDLGSTNGTLVNGRRVAQA-PLRHGDRLTVGLTEVVFE. 249
266 5.000e-33UniRef50_A0A2V7YJB4 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7YJB4_9BACT  ali  21  57.....................GDMTFSRREEAKPASVETEAEPEDRKTGKVTSPQMPTGKRLSLAVINGPDAGTVFRIEKPRVTIGR-TGSDIALNDSEISRAHAAVEIRDTTYLVEDLKSTNGTLIDGQRINGPTELQNQSEFQVGGSTLML.. 187
267 5.000e-33UniRef50_A0A094PBE7 Uncharacterized protein n=1 Tax=actinobacterium acAMD-5 TaxID=1504319 RepID=A0A094PBE7_9ACTN  ali  33  27..........................ALRKDISGSSSGAVLFKPKTLKQQNEPRA--------LVVIDGPAQGKIVNIAKHPISIGRASVCDLVLDDDFISSKHARITNQAEGYLVEDLGSTNGTWVEGEKLTQPVLIKPGVRIKIGRNTLTIR. 146
268 6.000e-33UniRef50_UPI000490A596 DUF2662 domain-containing protein n=1 Tax=Nocardiopsis sp. CNT312 TaxID=1137268 RepID=UPI000490A596  ali  27  92.................YSFVGPVRVHFRSDDGLKTGRFRIRSGVPTRDPGYSAGQRQAGYPRLIISPGGGSQQAFELTTPVTLLGRGTDCDLRLVDNGVSRHHVEIRLEGDDAVLVDKNSTNGTFVNGQQVQQA-RLVDGTRISLGRTTMTFR. 250
269 6.000e-33UniRef50_M4ZWF0 Uncharacterized protein n=6 Tax=Acidimicrobiaceae TaxID=84994 RepID=M4ZWF0_9ACTN  ali  30  92.................YHFIGPVQVRLTVDNGLKNGRFGIVSQL-------KQAANGVGAGSLVMPS----GQRVSLGDHVTSIGRLPECTITLDDGNVSREHARIAPGAGAYVVTDLGSTNGTLVNGVRVTGDQKLSDGDIVSFGSTHVRFE. 217
270 6.000e-33UniRef50_A0A2U3KSX9 FHA domain protein n=1 Tax=Desulfosporosinus sp. SbF1 TaxID=2043169 RepID=A0A2U3KSX9_9FIRM  ali  30  53...............................................................LEIIEGPDIGQSFSLQDAEVFIGRHGQCELVLHDPEVSRRHLKIALEENSLWLDDLGSTNGSFVNGQRITHLSVL-PGDRIQIGQSVLVIQ. 142
271 6.000e-33UniRef50_A0A2E8I4T0 GGDEF domain-containing protein n=1 Tax=Zetaproteobacteria bacterium TaxID=2026807 RepID=A0A2E8I4T0_9PROT  ali  26  26.............................................................ACLIQYSGTNLGKRFTLEKVEMIVGRSPQATIVINEQSVSRQHAKCCLNNNQVEIEDLGSSNGTFVNDQRISSRHALKNGDILRLGAVLFKF.. 117
272 6.000e-33UniRef50_U1RCC3 FHA domain protein n=13 Tax=Bifidobacteriaceae TaxID=31953 RepID=U1RCC3_9BIFI  ali  30  59.....................GPVVVPAQ--DGVPSNTQTLATPATAHISNPTNATNAPEPAVLTIIDGPLSGTTMPLSAGSISLGRAADNNIVLDDEFVSSHHARIFFDSNQWAVEDLNSTNGTKVADQPIHSVCLLPPGVPVRIGATTFELR. 191
273 6.000e-33UniRef50_A9WEE1 Forkhead-associated protein n=14 Tax=Bacteria TaxID=2 RepID=A9WEE1_CHLAA  ali  35  41................................................AQTSAAPPLASPYGQLVVTSGVAVGKVFPLN-PVTVIGRSPHCDIVLNDSFLSSEHARLERRGGVWLLEDLNSTNGTFLNGFEVTGLTEVHPGDAIRVGRVELRLE. 149
274 6.000e-33UniRef50_A0A2H0P9G7 GGDEF domain-containing protein n=2 Tax=unclassified Deltaproteobacteria (miscellaneous) TaxID=122706 RepID=A0A2H0P9G7_9DELT  ali  30  42............................................................HAYLLFLSGPLIGKLINLQEGSTVIGRSPDANVVINDQRISRQHLKIDVSPKGFIIEDMGSTNGTFVNGERITAKKELSDGDKIQISSTIFKF.. 135
275 6.000e-33UniRef50_A0A160T8F0 Uncharacterized protein n=1 Tax=Candidatus Promineofilum breve TaxID=1806508 RepID=A0A160T8F0_9CHLR  ali  30  6.............................................................ALLVVERGPVPSTQVPLTSEQLTIGRSAGNDLVLADPEVSRRHVRIVRRADGFAAEDIGSTNGTFVNGQRISHLTLLQDGDTIDLGDTRLRF.. 98
276 6.000e-33UniRef50_C7MH18 FHA domain-containing protein n=13 Tax=Actinobacteria TaxID=201174 RepID=C7MH18_BRAFD  ali  41  40......................RSSRDPRREQRPAAGPIGGAAAAAGTDPAQLRTDPEVTQAAMVVTAGPLRGTSLTLGSTPILIGRAPECTLVLDDDYASNRHARVFQRDGEWMVEDLGSTNGTLVSGRRIEGAVPFRPGAQVRIGRTEIELR. 171
277 7.000e-33UniRef50_A0A1B9BE16 Uncharacterized protein n=3 Tax=Actinobaculum suis TaxID=1657 RepID=A0A1B9BE16_9ACTO  ali  48  150...........................................................SRPVLAVIEGPLTGMVLPLGQAQIIIGRSPDSSLVLDDSYASSRHARVFFQDGYWWIEDLQSTNGTYIGNSAITEPVALVPGTRVRIGKTTMELQ. 244
278 7.000e-33UniRef50_A0A2E0WC12 Uncharacterized protein n=1 Tax=Micrococcales bacterium TaxID=2026762 RepID=A0A2E0WC12_9MICO  ali  27  49...............................IDAAQAMGETAPIPALDADVLSDVAPGDG--VLLIQKGPDQGEKFPLDQETVSVGRGKASDIFLDDVTVSRKHAIFTRTNSGWVLADNDSLNGTYVNRERVAK-HSLRISDEVQIGKYRFNF.. 167
279 7.000e-33UniRef50_A0A0Q6FIG8 Uncharacterized protein n=17 Tax=root TaxID=1 RepID=A0A0Q6FIG8_9ACTN  ali  43  36.........................RVAREGARGGGRQRPDRGEK--RARSKPAKPRRGAPTQVVIVEGGNQGETVSLQDAPLLIGRGNDAAIRLDDDYASTRHARIASSGEQWYVEDLGSTNGTYVGTSRITQPTAIQLGTRVRIGKTVLELR. 162
280 7.000e-33UniRef50_UPI000DACB1A9 diguanylate cyclase n=2 Tax=Bradymonadales TaxID=1779134 RepID=UPI000DACB1A9  ali  27  21..............................ELVEPSETTMIVNADMLRQAREGLGERDQ--AYLIIISGQHVGRPHKVGDEPMTMGRSPQVDVQLNDVGVSRKHARIERRGDYVFVRDLKSANGTYVNGELVTHDYQLKDGDKITLGSTTLKF.. 142
281 7.000e-33UniRef50_A0A1Q7J7S0 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A1Q7J7S0_9BACT  ali  32  27...................................................APRPSQGAPLASLLVKSGALKNQRLPVRTPVFNIGRADYNDIVFPDPSVSTTHAKLQRREGVWVVVDLDSTNGTFVDGERVKGESPLAPGALLRFGDVQLVFEP 130
282 7.000e-33UniRef50_A0A0J1FNV6 Glycogen accumulation regulator GarA n=27 Tax=Peptococcaceae TaxID=186807 RepID=A0A0J1FNV6_9FIRM  ali  26  147......................................TTIFRESVMTNLRAEDSAGRISNYFLEIIEGPDKGQSFKLPEHDIYIGRHGQCDLVLHDPEVSRRHLKITPGENGWRLDDLGSTNGSFVNSQRITHQTA-APGDRIQIGLSVLVIQ. 261
283 8.000e-33UniRef50_A0A126ZUS8 FHA domain containing protein n=2 Tax=Sinomonas TaxID=596707 RepID=A0A126ZUS8_9MICC  ali  24  94.................YTLQGPVRFTFRHDAALKPGQFEVDSRTERNEPAAPTRQPVRLSPVLEI-----DGQRYSVNADSVVLGRSNEADIVVDDTGVSRRHLEIRTDGSTTYAVDLGSTNGSYINGHRIEGSAVLHDGTTITMGRTKIVFR. 230
284 8.000e-33UniRef50_A0A1Q7F1N8 Uncharacterized protein n=10 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Q7F1N8_9CHLR  ali  25  44..............................................PARPQPASSVAAGPQGELTIETGPDAGHTHRTGDHAVRMGRSPDNDVILRDPATSGHHARLELRDEQFWIVDLGSTNGTFVNGESIQEKQ-LGHGDRLTIGQNSIHF.. 149
285 8.000e-33UniRef50_A0A2R4MZQ7 Inner membrane component of T3SS domain-containing protein n=3 Tax=Clostridiales Family XVI. Incertae Sedis TaxID=543347 RepID=A0  ali  33  27.................................................PAQCQEISSAAAAALVILSGEDTGMRLALPRQTVYIGRREDCTITINHPTVSRLHARILPTDRGWVLQDLDSANGTLVNGRPVTE-VLLSPGDRIKIGPWEAEF.. 129
286 8.000e-33UniRef50_UPI0009DF69C5 FHA domain-containing protein n=1 Tax=Dactylosporangium aurantiacum TaxID=35754 RepID=UPI0009DF69C5  ali  24  98.....................WRVPIITSEELLAQASVAAPEGATQPLDLTAHMEKLPSGRATLLIRKGAEAGAEFALDGEVCRCGRDSANQIVLDDNTVSRKHVEFHRNPSGFTL-DLGSLNGTYVNGERVKSAT-LKDGDEVQVGKFTLSYQ. 231
287 8.000e-33UniRef50_A0A0L6HUF3 Uncharacterized protein n=3 Tax=Microbacteriaceae TaxID=85023 RepID=A0A0L6HUF3_9MICO  ali  35  40........................VRKLPAEGDAAAASPTTPPAPAKRPASSKASTGPATIARLVITSGPKAGLELPLGTDILTIGRSSESALVIRDDYTSSHHARLLLRGDAWAIQDLDSTNGTFVAGNRVTGPVALGLGVPIKVGATTFELR. 173
288 8.000e-33UniRef50_I8ARX6 Uncharacterized protein n=18 Tax=Bifidobacteriaceae TaxID=31953 RepID=I8ARX6_PARDN  ali  38  76..............................TPSMPYDESGPRSTSRTTAPAANGPAPVRKASVLTIIDGPLSGTTYTLGSQPITIGRAPDNTVILKDEFASSHHARVYIDPGRWAIEDLGSTNGTVVDGMRMTQPVILPSGVPVRIGGTTFELR. 201
289 8.000e-33UniRef50_A0A1Y6BNU2 Diguanylate cyclase (GGDEF) domain-containing protein n=1 Tax=Pseudobacteriovorax antillogorgiicola TaxID=1513793 RepID=A0A1Y6BNU  ali  26  18.......................................................PPKKSPACFVQYSGTNLGKRYVLDQKEMVVGRSPNVQIVINEQSVSRNHAQCTAVGDSISIADLGSSNGTYVNDEKISTAYSLRDGDIIRLGNIVFKF.. 115
290 9.000e-33UniRef50_A0A2H5VX51 Oxoglutarate dehydrogenase inhibitor n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H5VX51_9BACT  ali  27  46......................RSSRSLGGTPAEKPAAVSRAEGTASEAPPDRSPPDRRPRAKLVLVRGGRVGREFPIWESEVMLGRWPEIDLDEDDPEVSRRHARIFYREGQFWIEDLGSLNGTFVNGPRLHQPVPLRHGDEIIVGKTFLRF.. 189
291 9.000e-33UniRef50_A0A2V7YDU7 Uncharacterized protein n=4 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7YDU7_9BACT  ali  28  222........LVYGLLALIQVVDDETIRQQIADFTADSTFRETPDDTAEDATLTFREVIKKTVAQLLVMGGNEAGTVIPLIENEYQIGRHHDSHIQLTDLGISSHHARIFRSPDGFVVEDLKSRNGTWVNGTRVFHSI-LKDGDQIRLGETDLRFE. 372
292 9.000e-33UniRef50_A0A2N2ACX6 Uncharacterized protein n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A2N2ACX6_9FIRM  ali  20  3...VIFLIIKFGVLAITYLFIIRVFYFILSDLNRVSQKGRAPQARLQPQSGAELVVTGSGDPSL------RPGEIFIL-GDNTRLGRGPHNHVNMADTFVSHDHAKIIFKTDKHFLEDLGSINGTYINGVRVSGAMPLAHGDVIRIAGVTFKF.. 145
293 1.000e-32UniRef50_A0A2E1CC91 FHA domain-containing protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2E1CC91_9ACTN  ali  33  27...............................................................LVIESGPRSGSRYALDSELISIGREKDADIFLDDVTVSRQHAILERSESIYTVSDTGSLNGTYLNGKSVRSE-ELTDGDVLQIGRFKLVF.. 115
294 1.000e-32UniRef50_X1AN85 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1AN85_9ZZZZ  ali  27  66.............................................................PMLVVIKGPNSGARYLIDKNIISIGRNTNSDIFLDDVTISRNHVKIINDQGLYTIIDLESTNGTYINGSR-EKEKILKNNDEIQIGRIKMVF.. 156
295 1.000e-32UniRef50_A0A2M7ACV3 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium CG07_land_8_20_14_0_80_59_28 TaxID=1973917 RepID=A0A2M7ACV3_9BACT  ali  28  121.........................VILVEDASVKVSATQIESEITNTPRELSRKRAQRSSYLLHVTEGPDSGRQFDVADGETILGRDGECGIPLSDPSSSRNHARLLCANGEVTIEDLGSTNGTYVNSEQIDRYSLL-PGDVIGIGTTSMELK. 251
296 1.000e-32UniRef50_A0A0S8KI66 Uncharacterized protein (Fragment) n=1 Tax=Anaerolineae bacterium SM23_84 TaxID=1703388 RepID=A0A0S8KI66_9CHLR  ali  21  2................................................RERAPRKRAPTANAALYVQSGPRAGTDYRVNVGNTTIGRGRDNDIWIDHPEVSGQHAMIKEEGGRFTLYDRGSTNGTFLNGEMLRQPATLEDGDQIGLGQVTLTFK. 108
297 1.000e-32UniRef50_A0A2W2CRM9 Uncharacterized protein n=1 Tax=Jishengella endophytica TaxID=515350 RepID=A0A2W2CRM9_9ACTN  ali  30  28.................................................DLPTIPVPPPGTALLVVRYGAFRGSWYPLPGRRIIIGRHPECEIALDDNTVSRRHAEINTRGVDFAVRDVGSTNGTWLNRERLAEEAILRPGDELQTGKFRFAF.. 132
298 1.000e-32UniRef50_A0A249LF35 FHA domain-containing protein n=1 Tax=Candidatus Planktophila limnetica TaxID=573600 RepID=A0A249LF35_9ACTN  ali  26  38...........................................EPSIRAIIDQVCAPGSGKAMLVIHRGPAQGSRFLLDAPSTSIGRSPESDVFFDDVTVSRKHARIERLHEDFTIIDSQSLNGTYVNSVSVTEKV-LHMGDELQIGKFHALF.. 146
299 1.000e-32UniRef50_A0A2N5KV52 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2N5KV52_9ACTN  ali  24  22.....................GTRLVHAQSTVSYAPSFGEEEYAVGKKAQGEEDPNEGAALIELDQVEGTAGRRMHDIGSEKVTVGRSPDSQIFLDDVTVSRRHAEVFRRGNGFRIRDAGSLNGTYVNRVRVDS-VDLRNGDEIQIGKYRFKF.. 156
300 1.000e-32UniRef50_A0A0J0UXV8 FHA domain-containing protein n=5 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0J0UXV8_9ACTN  ali  30  109.................YGFVGPIEIVIEQDDSARSGVLALDARFA-----EGEGGLPPGSLLL------PTGDRVPLGEYVVSVGRQNDCTIVLGDPNVSRNHAEVRPSGDGFVVADLGSTNGTKVNGVRVAE-QQLRDGDEVTFGNTVMHFE. 233
301 1.000e-32UniRef50_K0YTM0 Uncharacterized protein n=5 Tax=Actinobacteria TaxID=201174 RepID=K0YTM0_9ACTO  ali  36  51................................AAPSPSPKNDRDSGGIPRRRSITGASSSPTQLIITEGALTGTKMPLGSAAIVIGRSPACTLVVDDSYASSQHARLYLAGGSWHVEDMNSTNGVFVDGERISSPRPVGLGNQIRIGQTTLEL.. 171
302 1.000e-32UniRef50_D2SGH0 FHA domain containing protein n=15 Tax=Geodermatophilaceae TaxID=85030 RepID=D2SGH0_GEOOG  ali  25  136....................VGPRSGAVPPLPPLQGGRMATDTGRQSPSTVVGRAGSRPGATHVLLVDGP--GTRHELTTGRNVIGRGTDADIRLPDTGVSRKHVDVVLDNGTAIAEDLGSTNGTLVNGRRITR-QPLADGDVIRIGHSVLVYR. 266
303 1.000e-32UniRef50_A0A1I2HSL0 FHA domain-containing protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1I2HSL0_9MICO  ali  23  95.................YAFVGPVTVTFEERTDLEPGRYQLRSRSTRGNVAPPSAAPSSRHPLVDI-----DGQRYLLTGPVTVIGRGSEADIVVDDPGVSRKHLEIRITGDGVVATDLGSTNGLYVEGHQVPAATLL-DGNSLTIGRTRILF.. 224
304 1.000e-32UniRef50_A0A0H2P3H2 GarA Signal transduction protein n=14 Tax=Bifidobacterium TaxID=1678 RepID=A0A0H2P3H2_BIFBI  ali  26  22....................................PVTTTGDRPLTQEDIETIARLAPGTALLISTRGAVSGSRYLLDEDEVTVGRDSRADILLDDSTVSRSHAVFRRVGDTFAVYDSGSLNGTYVNRQRVD-HQQLRNGDEIMIGKFRLVF.. 137
305 1.000e-32UniRef50_A0A2N3FLU4 FHA domain-containing protein n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-6 TaxID=2013651 RepID=A0A2N3FLU4_9ACTN  ali  29  33....................................GATASFEPVAAESSVRSPEAVSADGPVLVVHKGAEVGERFYIDRDHLSVGRDPGSDIFLNDVTVSRSHARLHLSPEGVTVEDAGSLNGTYVNDLLVDKA-LLHSGDALQIGRFRMIF.. 148
306 1.000e-32UniRef50_A0A134BH52 FHA domain protein n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A134BH52_9ACTO  ali  21  95.................YVFVGPVQVVFSAGDHPLGELKIENSIRRGPAAPVTTAGASPSHPIIDIE-----GQQWLLTEPVTVIGRGSEADIVVHDPGVSRRHLELRITPQGVIATDLGSTNGSYVEGHRISAATLL-DGNELTIGRTHLLF.. 224
307 1.000e-32UniRef50_A0A1F8NQ19 Uncharacterized protein n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8NQ19_9CHLR  ali  27  2.........................................................PAASFRLIMRTGPNPGLVFDLTKEVTVLGRDVSNDIVLGDAEVSRTHARLTRTPGGYVLEDLGSTNGSFVKGERLAAPRVLNPGDLVGFGEITLTF.. 98
308 1.000e-32UniRef50_A0A1T4T2S5 FOG: FHA domain n=44 Tax=Actinobacteria TaxID=201174 RepID=A0A1T4T2S5_9ACTN  ali  28  94.................YSFVGPVRVQFDTADDLQTGRFRIRSGRRPVSDHPRGGAAIAGRPRLLLSPGSNTQQSYELNAQVTLLGRGTDCDLRLVDNGVSRHHAEIRVEDDEAVLVDLGSTNGTFVNGQQVKRA-RLVDGTRISLGRTVMTFR. 251
309 1.000e-32UniRef50_UPI000A06E4A2 DUF2662 domain-containing protein n=1 Tax=Ilumatobacter nonamiensis TaxID=467093 RepID=UPI000A06E4A2  ali  26  92.................YHFIGPVAVTLSVDDRLKPGRFNIVSQLKQSRGGVGAGSLVLP-----------SGQRVSLGEHTTTVGRLPESTITIDDGNVSREHARIAPGARGYVVTDLGSTNGTLVNGTRIAGQQQLGDGDIISFGSTHLRFE. 217
310 1.000e-32UniRef50_A0A2N3G781 FHA domain-containing protein n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=A0A2N3G781_9ACTN  ali  35  27.........................RAIYRDIRMPE---------TVARPSRHREKKKDQQPQLVVIADRNVGARFMLVDD-VRIGRAANSHIIIDDTYASQQHARIFVNDGSYFVEDIGSTNGTYVNGRKISYPLGLRAGDRIKIGKTVFEFR. 146
311 1.000e-32UniRef50_A0A2M7T730 Uncharacterized protein n=1 Tax=Actinobacteria bacterium CG_4_10_14_0_8_um_filter_50_43 TaxID=1973889 RepID=A0A2M7T730_9ACTN  ali  29  93.................YELLGRPQIAIKAVPRLSLGEVLIESTLESREP--GVEKEGAGDAYL-VRSGAGGETKFLLADTTIKIGRAADNHIIISDPNVSRYHARIESVGAQHLIKDLESTNGTFVNGAKVDER-RLKNGDTIAIGTTKLYFR. 225
312 2.000e-32UniRef50_A0A269YIT5 FHA domain-containing protein n=7 Tax=Rothia TaxID=508215 RepID=A0A269YIT5_9MICC  ali  38  30............................RRDLGLGKRSVPVESAADSQPQPQHIAAPPARPSRLVITKGVQAGAMMQLGDSPVTIGRANDIEVSLQDDYASGRHARLFPQGSRWFLEDLGSTNGTFVNNQKLTRATAIEPGVDFRVGGTTMQLR. 157
313 2.000e-32UniRef50_A0A2E5E0S3 Uncharacterized protein n=2 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E5E0S3_9BACT  ali  33  5................................................SPGLPFPDYHQSMLVLEVIDGVDQGQVFPLPGEPQLIGRSSES-LPLSDQSVSRRHAELTPDGDRWWLRDLQSANGTWVNGRRVDGRVELRQGDEVTCGETTLRL.. 109
314 2.000e-32UniRef50_A0A1F8PU97 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_51_16 TaxID=1797644 RepID=A0A1F8PU97_9CHLR  ali  27  5..............................................................QLVLRSDPAPGMTYPLEGDQITIGRDSTNGVAINHSEVSRRHSKLSFQGGKYVIEDMGSTNGTFVNGQRLGGQTVLKPGDVVSLGE....... 90
315 2.000e-32UniRef50_A0A124FV28 Uncharacterized protein n=1 Tax=Anaerolineae bacterium 49_20 TaxID=1641376 RepID=A0A124FV28_9CHLR  ali  27  8...............................................................ITMRSGPTPGSSYYIEKDEVYLGRDLSNDLPVPDPEISRRHARFLRKPDGIYIEDLGSTNGTFVNGVRLTGPQLLKNGDLITLAETVMSFE. 99
316 2.000e-32UniRef50_A0A2M8WJH6 Type III secretion system (T3SS) inner membrane Yop/YscD-like protein n=1 Tax=Luteimicrobium subarcticum TaxID=620910 RepID=A0A2M  ali  43  95.....................................PRTPVLPGTTDSRTAARHQPRVSTTRLVVVEGSLRGTSLPLSGSGVLLGRAPSCTLVLDDDYSSARHARVFPQHGSWFVEDLGSTNGTYLDGNRLVAPVEVRPGSQIRIGQTVMELQ. 211
317 2.000e-32UniRef50_A0A2V8PIN9 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8PIN9_9BACT  ali  30  72...........................................................GSGWLVPLDGPQTGELFQLRAGRTFVGTSPDCDIVLRDPSISGRHAEISITRRGFRINDLGSANGTYVNDKRVSSE-DLIDNDSVRLGRTNFKFK. 165
318 2.000e-32UniRef50_I0I538 Uncharacterized protein n=9 Tax=Bacteria TaxID=2 RepID=I0I538_CALAS  ali  33  26.............................................................AMLVLQRGLEAGRRWPLDRHPLTIGRDESCDIHLPDRQVSRRHARVFWSQDHYYVEDLGSKNGTHVNGQAVNAPQPLQDGDEIQI---ALRFK. 118
319 2.000e-32UniRef50_A0A0J8FZV1 FHA-domain containing secreted protein n=2 Tax=Clostridium cylindrosporum TaxID=1495 RepID=A0A0J8FZV1_CLOCY  ali  21  2..EQFSLILRFVVLGLIYIVLFKIIKVMYIDVKGTKPKRKKKPKLNYALEVEDSPENI----------GINKGSVFPIHSA-ITIGRKDTNTISIDDPFVSGYHAKIILKDGKVYLKDLESTNGTRRNGDPVKGFQEVYIGDFIEIGRVIFKV.. 141
320 2.000e-32UniRef50_A0A2N3FN54 FHA domain-containing protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A2N3FN54_9ACTN  ali  36  27..........................VVRTDLFGRKVSAAELAAQGGAPGAKPRRALRQLPKTLTVTHGKQAGLQLPLGEG-ILIGRASDCQLLLDDDYVSTRHARISRTPTGYQVEDLGSTNGTFVNNQRITAPTPFGIEDTLRIGRTMM.... 154
321 2.000e-32UniRef50_A0A2V9DAM6 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9DAM6_9BACT  ali  25  9.......................................................PAPAGDARLEAVSGPCGGRVFSLAEDEVSIGRDPSNQISLLDSLVSRRHCVIRKDGEAFRIQDLDSRNSTFVNGIPVKERV-LAHGDQIRVGNSTFVFQ. 106
322 2.000e-32UniRef50_A0A2U2SPF5 Uncharacterized protein n=1 Tax=Ardenticatenia bacterium TaxID=2099665 RepID=A0A2U2SPF5_9CHLR  ali  32  2....................................................STHVPLSPMVYLTIRHGKRAGQTFSAPGPAVTIGRVSDNSIVIDDPQVSRHHASLTFEGGQWVLRDLGSTNGTTLNGKPVTAPVVVRDGDVIGLGEV...... 98
323 2.000e-32UniRef50_A0A1B7LEC9 Uncharacterized protein n=2 Tax=Peptococcaceae TaxID=186807 RepID=A0A1B7LEC9_9FIRM  ali  24  33.............................REEAVLSADAGRQVPAPVPSGRQQQPSAGSGGSRLVVLASPDAGMNFPL-GENTSLGRGTKNDLVIADPFASLEHAHIFSREGQYWLEDLGSLNGTYLNEVRLERPTVLADGDRVRIGGVTFQF.. 159
324 2.000e-32UniRef50_A0A1Y4E1W2 FHA domain-containing protein n=15 Tax=Coriobacteriales TaxID=84999 RepID=A0A1Y4E1W2_9ACTN  ali  30  34.........................................................QANTPVLTIIKGPQTGNTFELEGAETTIGRDPSNGIFLNDMTVSRAHAKIIRNAAGVLIEDLGSLNGTWVDGAIVNSA-PLHDGSSVQIGTFTLIYH. 129
325 2.000e-32UniRef50_D3Q5N2 FHA domain containing protein n=13 Tax=Actinobacteria TaxID=201174 RepID=D3Q5N2_STANL  ali  23  115.....................FRVIVAAQQDQHAPGPDPAYGPPAGGYDQAGPGQPAPPTGPRLV----SGDGRQYAITMGSTTIGRGEQAQIRLPDVGISRVHVRIDFDGGQVLVTDLGSTNGTLVNGQRIST-VALQPGDMIQLGTTSLTLQ. 244
326 2.000e-32UniRef50_A0A1D7X9G5 FHA domain-containing protein FhaB n=11 Tax=Thermoanaerobacteraceae TaxID=186814 RepID=A0A1D7X9G5_MOOTH  ali  30  41....................................................APAQSSRKRPVLVVLDGAKRGESYPL-GENISIGRDNHNDIIINDSHVSARHAVITRQGREWKILDLDSTNGTYVNGLRLTGPHSLRPGDKISIGGVTFKV.. 144
327 2.000e-32UniRef50_A0A0W1KLH5 FHA domain-containing protein FhaB n=17 Tax=Bacteria TaxID=2 RepID=A0A0W1KLH5_9ACTO  ali  40  48......................................RPASRTTPQPRRSSTPAPSALAHPHLVVSGGSLAGSTIPL-SGSITVGRSPDSALVLDDGYTSARHAHFYTDGHDWYVEDLNSTNGTWVGGTRIYEPTRLGFGTPVTIGKTTLELR. 162
328 2.000e-32UniRef50_A0A2N2LZ45 Uncharacterized protein n=3 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A2N2LZ45_9CHLR  ali  32  6..............................................................KLVIQSGTGTGTEFPLEKNELFLGRDLTSDLVINDPEVSRRHLRFVLDGAAYRIEDLGSTNGTFIHGQRLTAPALLKPGEIITLGKIVLRYE. 98
329 2.000e-32UniRef50_A0A2H0PFE4 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_47_16 TaxID=1973975 RepID=A0A2H0PFE4_  ali  26  230..........................TQRTQVFAPGQNTGDATSTGSASISSATAPGKPGTAYLTVTRGASDNPKYPLGK-ETTIGRAHTNHIVLKEARISRQHAIIRQAGKEFVLEDLQSSNGVYVNGERVKE-HVLSEGDQIQIGDFAMEFH. 356
330 3.000e-32UniRef50_UPI0009EE08D6 DUF2662 domain-containing protein n=1 Tax=Desulfotomaculum intricatum TaxID=1285191 RepID=UPI0009EE08D6  ali  31  168..............................................................YLVIELGPDKNKSFKLNNQRVVIGRDESCDIVLSDKSVSRRHVMLERRRKAYVIRDLKSTNGTFVNGVRIIEEI-LKPGDEIKLGITICSVR. 258
331 3.000e-32UniRef50_A0A154BT61 Uncharacterized protein n=1 Tax=Anaerosporomusa subterranea TaxID=1794912 RepID=A0A154BT61_9FIRM  ali  23  8.SNLLVIVLQYGMLLLMCLFLYRVIHLVYLDFYSSTNP--------------SLLVVKPKSGKLVINRGSLVQAEFPI-GETINIGRSEGNDIIINETTVSFEHACISYYCGEYLLSDLKSTNGTLHNDLRIQDDSVLHRGDKITIGSTIFLFE. 148
332 3.000e-32UniRef50_A0A2W4LLD0 GGDEF domain-containing protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2W4LLD0_9PROT  ali  39  25.......................................................GVAQQHALLIVLSGPRLGTRSVLGESPIEIGRSPACQLILDADSVSRRHARIEWNGSEHRLIDLGSTNGTFVNGKRVTDRV-LKDGDRVGIGKLQLKY.. 121
333 3.000e-32UniRef50_A0A2T2UNA5 Uncharacterized protein (Fragment) n=1 Tax=Proteobacteria bacterium SW_6_67_9 TaxID=1919227 RepID=A0A2T2UNA5_9PROT  ali  27  3....................................PSMPDDLDQTIRVTVDVSPEAGPSEASLVVIYGSDLGRRYPLDRAALELGRDDTNPIQIPSEKASRRHARVVEHDGQAWIEDLGSTNGTLVNDQQITRA-PLAHGDIINIGSVLLKY.. 118
334 3.000e-32UniRef50_A0A2H6ADM9 Sensor protein FixL n=1 Tax=bacterium HR36 TaxID=2035431 RepID=A0A2H6ADM9_9BACT  ali  32  1...........................................................MAATLIVVQGPQQGRRFTLEASVVPVGRDASNVIRLHDTEVSRRHAEFRRTAEGYVVVDLGSSNGTWVNSQRVQQ-HLLQTGDRIRLGQTVLLY.. 93
335 3.000e-32UniRef50_A0A0P8W4A7 FHA domain-containing protein FhaB n=1 Tax=Oxobacter pfennigii TaxID=36849 RepID=A0A0P8W4A7_9CLOT  ali  23  2LNKLIIWIMRFVLLGMIYIFLYKVIKVMYSDLKGNKIKASVSAGIEVIDIGDDCPIP--------------IGAVYPLHS-VTNIGRTPDNNIVLDCKYVSNYHARIFLKNNYYILKDMNSTNGTFLNSIKVEKPTVVKNDDLINIGGVIFKV.. 139
336 3.000e-32UniRef50_A0A1V6DEK8 Oxoglutarate dehydrogenase inhibitor n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A1V6DEK8_9CHLR  ali  28  9................................................................IMRLGPEPGKVFLLEKEEAFLGRDLGNDFIVSDPEISRRHARFYTWEGGVFVEDLGSTNGTFLNGERITSPQQLRKGDLITLGESVLIF.. 98
337 3.000e-32UniRef50_A0A1V5NWX4 Oxoglutarate dehydrogenase inhibitor n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1V5NWX4_9FIRM  ali  25  136.....................................PLEHTQYFTLVKDKPLPDAPPLVYAQIRVESGPERDKIFNLNKESMVIGRRESCDIVLSDDSISRRHARLDRRLGVYTIHDLGSTNGIKVNGDRITARV-LKSGDVLTLGATVCTFK. 251
338 3.000e-32UniRef50_A0A1Q7X5M7 Uncharacterized protein n=1 Tax=Actinobacteria bacterium 13_1_20CM_3_68_9 TaxID=1803475 RepID=A0A1Q7X5M7_9ACTN  ali  33  27.........................RSAFRELRRTTRPAPEATGVHAIGPGGRAAATD---ASLVVTRGGGPGERFDLFGG-ISIGRSDDADVRIEDRYASGVHARLYSRGPSYYVEDMNSTNGTFLNGGRLDGEAKLNDLDEVRIGDTEFRFE. 153
339 3.000e-32UniRef50_A0A1Q5PPH7 Uncharacterized protein n=4 Tax=Actinomyces TaxID=1654 RepID=A0A1Q5PPH7_9ACTO  ali  33  44.....................GRAARTSARAVRKAEKAAQAEAKRRAKDAKRESTVLPGMPGRLIVTGGPLAGTSLPLGSAPILIGRSPSCTLVLDDNYASGRHARLFPDETSWWLEDLDSTNGTFMDDERVVEARPLQPGVRFRVGQTTME... 185
340 3.000e-32UniRef50_A0A249KTH4 FHA domain-containing protein n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A249KTH4_9ACTN  ali  26  18...........................LRTASDSPAGALDEFLATVSAADRSIIEEIAQSSAMLIINRGSNLGSRFLVTAQGASIGRSSGSDVFLDDVTVSRSHAKIESTSSGFSLKDSGSLNGTYVNNSSVTE-HALHSGDQIQIGKFHLLF.. 144
341 3.000e-32UniRef50_A0A1Y4G3Y0 FHA domain-containing protein n=4 Tax=Gordonibacter TaxID=644652 RepID=A0A1Y4G3Y0_9ACTN  ali  24  28....................................GSTQRFAPVALPDESFSPEAKPAAAAALRVVRGPQTGVVIQLGDAPQTIGRSPQRDVFLNDMTVSREHALIEPCEGGYAIHDTNSFNGVWVNNDSVDAPRKLCNGDVIQIGAFCLLYQ. 145
342 4.000e-32UniRef50_B9KYR3 ABC transporter ATP-binding protein n=9 Tax=Bacteria TaxID=2 RepID=B9KYR3_THERP  ali  29  37............................................RELAAAAVTSSEEGGPPGHLIVQSGLRPGTRLPL-EPVTVIGRHPSCTVRLDDAFISTEHAQLTWEQGRWWITDLKSTNGTRVNGKPVTAPTGLRYGDVIELGDVRLVLAP 150
343 4.000e-32UniRef50_W9G4W3 Signal peptide protein (Fragment) n=9 Tax=Actinobacteria TaxID=201174 RepID=W9G4W3_9MICO  ali  50  41.......................................................RGSRVPTTLVVTEGPLAGTSLPLRGGGILIGRNPECALVLDDDYASGRHCRIVQGPEGWVVEDLGSTNGTYIGRERLTTPRPVEVGTSLRIGKTVLELR. 139
344 4.000e-32UniRef50_A0A1F9LIT0 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFOXYA12_FULL_61_11 TaxID=1797896 RepID=A0A1F9LIT0_9DELT  ali  32  16...................................................RGRGPNHAGEPCLIVLTGNAVGMMYKLTGTEWLIGRTREADICIEDPSISRSHAKLSTVKSGLYLQDLNSTNGTFVNEKKVTGMHQVSDGDKIRLGDTTLKF.. 118
345 4.000e-32UniRef50_A0A2E7MUE8 Uncharacterized protein n=6 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E7MUE8_9ACTN  ali  31  58...............................................................LTVEPQDTQGTEYPL-EEEIFLGRDEECDITINDSFTSHRHARIFLEENTLYLEDLTSTNGTFVNGEKVEKPHLLEQQDRIQIGNTVLEVK. 147
346 4.000e-32UniRef50_A0A0M8KMK2 Adenylate cyclase n=18 Tax=Actinobacteria TaxID=201174 RepID=A0A0M8KMK2_9MICO  ali  22  93.................YMFVGAVSVALEQDEEVRQGRFETESRTERGSVAPATGAAPGGSPIVEI-----DGQQYLLTGPVTVIGRGGDADIILEDTGVSRHHLELRAEPDSLVATDLGSTNGTFVDGERIRTPVPLHDRSLIKIGRTRLTV.. 227
347 4.000e-32UniRef50_A0A2E2C557 Uncharacterized protein n=4 Tax=Gimesia TaxID=1649453 RepID=A0A2E2C557_9PLAN  ali  31  1............................................................MTRFIIQSGKYKGKTLKLPERNITIGRELDCDVRVTDPDVSRRHCELHIREGQLFVVDLNSQNGTFINGKPVQTESPLHPGDQLRVGPMLFEL.. 93
348 4.000e-32UniRef50_A0A023X3U5 FHA domain n=2 Tax=Rubrobacter TaxID=42255 RepID=A0A023X3U5_9ACTN  ali  25  34.........................................QPSFAEEEIVASTAQVPENGASLVQVEGTAGRRMHDITAELVTVGRSPDCEIFLDDVTVSRAHAEITRGERSFRIRDVGSLNGTYVNRVRVDS-VDLRNGDEIQIGKYRFKF.. 147
349 4.000e-32UniRef50_A0A1F3BIU5 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium RBG_16_58_9 TaxID=1797287 RepID=A0A1F3BIU5_9BACT  ali  27  294................................................TPGTAPAGAPTAGPRLVGSQGTYSGQIFEISAGQVVIGRETG-DIALNDGTVSRRHATITAADGSYTIRDEGSSNGTFVNGAKIAEQT-LAAGDEVQIGATKFRFQ. 398
350 5.000e-32UniRef50_A0A2W4KPH8 Uncharacterized protein n=1 Tax=Candidatus Melainabacteria bacterium TaxID=2052166 RepID=A0A2W4KPH8_9BACT  ali  29  42....................................................ASEGDESELPKQVIVVVQKTGQKVPLKNRKVKIGRDPSNQVVIDDTFTSRHHAWISYEESDFWLEDLGSTNGTLLNGHPVVKRQVLSAGDKIRVGHTELTFE. 144
351 5.000e-32UniRef50_A5UUB0 FHA domain containing protein n=1 Tax=Roseiflexus sp. (strain RS-1) TaxID=357808 RepID=A5UUB0_ROSS1  ali  32  1...........................................................MPPHLASVRGPLIGRTFALGDQPLTIGRAADNAVVIASPRASRHHAHIRREGAAFVIYDLGSANGTLVNGQRVQRAV-LQPGDLIDIGDEVFRFE. 94
352 5.000e-32UniRef50_A0A2A2YTW0 Cell division protein FtsK (Fragment) n=1 Tax=Streptomyces sp. SA15 TaxID=934019 RepID=A0A2A2YTW0_9ACTN  ali  27  12..........................AQRCTLGEPPLIDGAVLSLGAPGVPEPHPELDDAPAQLHVVAGPDAGGVHLLHGGQIHIGRSADADVPLDDPDVSRLHCAITVGDGRVSVADPGSTNGTTLDGRRIGRPVRFTPGALLRIGESTLRLAP 142
353 6.000e-32UniRef50_A0A0K8QIL1 Glycogen accumulation regulator GarA n=1 Tax=Arthrobacter sp. Hiyo1 TaxID=1588020 RepID=A0A0K8QIL1_9MICC  ali  24  30.................YILQGPVRISFRHDDAQREGHFEAAAPVAPRPVVPAAPSREPTRLQPVLDIG---GQRYSLNAPSIVLGRSSEADILVDDTGVSRKHLEIQTADGVIRAVDLGSTNGSYVNGHKVDGSVELTDGSTITMGRTKIIFR. 173
354 6.000e-32UniRef50_A0A2H5Z7F7 Glycogen accumulation regulator GarA n=4 Tax=Bacteria TaxID=2 RepID=A0A2H5Z7F7_9BACT  ali  30  94.................YGFVDQVRVRLIGDPSVPRRQVQVEAQIAQLPASRQAWQRTEPRAFLRVLEGPLAGQTFLIRKKVTTIGRALDNDIVLEVLDVSRRHARIEYVEGHFEVIDQGSTNGTLVNGRAVERA-PLSNGDRLTLGTVALEF.. 243
355 6.000e-32UniRef50_A4BRG4 GGDEF family protein n=1 Tax=Nitrococcus mobilis Nb-231 TaxID=314278 RepID=A4BRG4_9GAMM  ali  27  9....................................................PPGDSPWQNACLVVINGIDLGKKYALLQASMLVGRSNQADIQIDEDAISRKHAVIEGHEGRFVIRDLESTNGTYVNDCAVRE-HPLADGDQVKIGRTILKF.. 108
356 6.000e-32UniRef50_A0A2E7BUR0 Uncharacterized protein n=2 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E7BUR0_9DELT  ali  35  30.............................................................ACLVVVYGEEVGRRLPMGRQETVIGRSRECDIQLRNDSASRRHASVFVSPDGYMVRDLGSTNGTAVNDQPVTES-LLSDGDELRLGRTVMRF.. 120
357 6.000e-32UniRef50_A0A2E0UBX5 Uncharacterized protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2E0UBX5_9ACTN  ali  35  15..............GLCYLFFFRVLRAVWVETREDKKNT------------SKAKKNIEPKTQLVVTNSSTGTTRYEI-SGEITIGRAEGCTITIDDDFVSQSHARVFERVDEIMVEDLGSTNGTYLNKQKVTAPTVMKIGDWLQLGDTIMELK. 142
358 6.000e-32UniRef50_A0A1F8SXU9 Uncharacterized protein n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8SXU9_9CHLR  ali  28  7..............................................................QLVMKTGPAPGKTFAIEKSELFFGRDVANEVFINDAEVSRRHARLTVQTSGYILEDLGSTNGTFVNGQRLTGPRVLRLGDMIMLGEVSLVFE. 99
359 6.000e-32UniRef50_A6W429 FHA domain containing protein n=12 Tax=Actinobacteria TaxID=201174 RepID=A6W429_KINRD  ali  27  94.................YSFVGPVRVDFHEADDLETGVFRVLSSTVGRVAPATPRTNQAGRPRLEV-----DGRGYVLSEAVTVIGRGSDADVVVDDPGVSRRHAEIRVSGHGARLSDLSSTNGTFVDGERVSS-LDLFDGTAITVGRTTLVFH. 225
360 7.000e-32UniRef50_A0A1V6J8K3 Transcriptional regulatory protein EmbR n=3 Tax=PVC group TaxID=1783257 RepID=A0A1V6J8K3_9BACT  ali  26  1............................................................MAKLSGMSGEFKGREFPIEQGEITIGRKADNTILLDHPTISSHHCRIVRSGDSCVLEDLDSTNGTRVNSRDVREAI-LHHKDLIQLGSIEFLF.. 92
361 7.000e-32UniRef50_A0A2W6B8A0 DUF2662 domain-containing protein (Fragment) n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2W6B8A0_9CHLR  ali  23  54..............................DPRLDPAAAEELEGEIERTRAMRIPPATPRPSSLIITTGKHQGSAFAINGALTRIGRGLDNEIVIDDARVSRHHAEIRWAAGGYSVLDMGSTNGTFLNDMQITES-PLTVGDRISLGGLELMFQ. 179
362 7.000e-32UniRef50_A0A076JGY5 FHA domain-containing protein n=184 Tax=Bacteria TaxID=2 RepID=A0A076JGY5_BIFAD  ali  29  44.......................................................RLADGTALLISTRGAVSGSRYLLDEDEITVGRDPSSDILLDDSTVSRTHAVFRRINGNYSVIDAGSLNGTYVNRQRVDS-QELKNGDEIILGKFRLVY.. 140
363 8.000e-32UniRef50_F6CKW2 FHA domain containing protein n=6 Tax=Desulfotomaculum TaxID=1562 RepID=F6CKW2_DESK7  ali  24  24.......................VVRQMFLGLREYPAMATPAAAGRNPGNETKPAAVPKPGGRLVVLASPDPGMTFYL-GERITLGRGEHNGLVIPDPFSSQEHAVIFSRGDQYWVQDLGSLNGTYLNEVRLDRPTVLADGDRLRIGGVTFQF.. 162
364 8.000e-32UniRef50_A7NM46 FHA domain containing protein n=1 Tax=Roseiflexus castenholzii (strain DSM 13941 / HLO8) TaxID=383372 RepID=A7NM46_ROSCS  ali  32  4..............................................................RLTGMRGPLTGRTFDIGDQPLTIGRAADNHIAIASPRASRHHAQIRREGASFVLYDLGSANGTLVNGQRVQRAV-LQPGDLIDIGDEVFRFE. 94
365 8.000e-32UniRef50_UPI000DAC99FB GGDEF domain-containing protein n=1 Tax=Bradymonas sediminis TaxID=1548548 RepID=UPI000DAC99FB  ali  28  15....................................................PTPDSSGQEACLVVINGVELGKKYSLSQPTTVIGRSSKGDIQIDEDAISRSHATIYDSGDHYLLKDMASTNGTYVNDVEVTD-QRLRDGDQIKIGRTIFKF.. 114
366 8.000e-32UniRef50_A0A2S8F1X3 Protein serine phosphatase n=3 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8F1X3_9PLAN  ali  25  4..............................................................YLVALNGPDSGKKIFLAGEEFTLGRHPECDIVVEVGAVSRYHAKITRNDRGYSIEDLKSRNGTFVNDEQIAKPHQLQHGDSIRVCDISFEFK. 95
367 8.000e-32UniRef50_A0A257TK04 Histidine kinase n=1 Tax=Planctomycetia bacterium 21-64-5 TaxID=1970542 RepID=A0A257TK04_9BACT  ali  29  1............................................................MPSLFVFRGNNQGLRFELDGDMLTIGREAANGIQLHDTEVSRRHAEVRRTGGTFTLTDLASSNGTFVNGQPIT-VRELANGDEVQVGGTVMLY.. 92
368 8.000e-32UniRef50_A9ETR7 Uncharacterized protein n=12 Tax=Polyangiaceae TaxID=49 RepID=A9ETR7_SORC5  ali  29  11............................RRSMSTPPPMVGPGRTMSPADDSLGPAPSSSDWGHLEIRLGDLPGTRRPLTESHIVIGRAPGVQLTLDHYTVSRRHAELFCDPGRWWIRDLGSTNGTLVNDERINEKV-LKPGDRIGIGDYILEFQ. 137
369 8.000e-32UniRef50_UPI00082A0AE0 FHA domain-containing protein n=2 Tax=Microbacteriaceae TaxID=85023 RepID=UPI00082A0AE0  ali  36  37........................VRKLPAEQXXXXXXXXXXXXXXRPASAKPASTGPATIAKLVITSGPKAGLELPLGTDVLTIGRSSESSLVIRDDYTSSHHARLLLRGDTWAIQDLDSTNGTFVGGKRVTGPVGLSLGTPIKVGATTFELR. 170
370 9.000e-32UniRef50_A0A0M2U979 Uncharacterized protein n=1 Tax=Clostridiales bacterium PH28_bin88 TaxID=1605376 RepID=A0A0M2U979_9FIRM  ali  26  115......................RVHTHYEGEPEEVVRRPAAGGDTMVFEAVKDGHPGGEGPLYLQVLEGPDQGSSFELTGSRMVLGRKGSSDIFLTDHRVSRRHAMVECRKGFFFITDLGSTNGTWLNGKRVERS-RLQVGDGLQVGDTVMEVR. 245
371 9.000e-32UniRef50_A0A1V6HFH0 Phosphoserine phosphatase RsbU n=1 Tax=Acidobacteria bacterium ADurb.Bin051 TaxID=1852786 RepID=A0A1V6HFH0_9BACT  ali  28  2................................................PPPPDHAPTRESAPCLVARSGPLAGRRIPLER-ELLLGRDPLAGIEIQDPSVSRRHARVTIADDACFLADLRSRNGTFHNGRRITEPVQLASGDEIRVGSSVFVFH. 106
372 9.000e-32UniRef50_F7NLE9 FHA domain-containing protein n=1 Tax=Acetonema longum DSM 6540 TaxID=1009370 RepID=F7NLE9_9FIRM  ali  17  7..QVLTVVLQYSLLAFILYFLFRTIQVIQQDISQRNYEKHYSSHAGNISQTKSRQSVLK-----ILERGQFAPGIAAIPQEEISIGRGPENNVVIPEAVVSHEHACISRRKQEYWLTDLSSTNGTYYNGMLLSGDVLLKHQDIIKVGSTTFRFE. 154
373 9.000e-32UniRef50_A0A2W5XTN7 DUF2662 domain-containing protein n=1 Tax=Solirubrobacterales bacterium TaxID=1909295 RepID=A0A2W5XTN7_9ACTN  ali  28  156.........................................SARRLRRSPATPAAPPLLTSARLIVE-----GRRMRVGPGGVVIGRSRECDIVLGDANVSRRHAEIRHDGSDWVVADLGSTNGVRVNGQRIEGAAPLSSGDVLVLGTDELRFE. 263
374 1.000e-31UniRef50_UPI000970AB36 FHA domain-containing protein n=1 Tax=Actinomyces mediterranea TaxID=1871028 RepID=UPI000970AB36  ali  34  36........................TVVTPRGKGRKEADQRRRESRKSRLADRASGAMDEAPHNILLTGGPLVGTVMPLTGSPLIIGRSPASTLVLEDEYASSRHARLAPSDEGWWIEDLGSRNGTFVDDERLSEPRLLKAGDVVRIGQTTLEL.. 164
375 1.000e-31UniRef50_A0A2W4P4F7 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2W4P4F7_9ACTN  ali  29  5......................RVPEAKPPDPETQVETDPTVFFLPLQEREGVPLTREEAAYALVVERGPSRGVTYLLKQGITTVGRHPESDIFLDDVTVSRQHCRFIVVGDTLRVEDSGSTNGTYVNEVRVDQAT-LRAGDEVLIGRFNFIV.. 141
376 1.000e-31UniRef50_A0A286CH43 FtsK/SpoIIIE family protein n=5 Tax=Streptomyces TaxID=1883 RepID=A0A286CH43_9ACTN  ali  26  67..........................AQRCTLGEPPLTDGAVLSVGAPGEPEPHPELDDAPAQLQVVAGPDAGGVHLLHGGEIRVGRSADADVPLDDPDVSRLHCTVTVSDGRVAVADLDSTNGTTVNGARVDRAVPFAPGALLRIGESALRLAP 197
377 1.000e-31UniRef50_A0A1G9M3J2 FHA domain-containing protein n=1 Tax=Dendrosporobacter quercicolus TaxID=146817 RepID=A0A1G9M3J2_9FIRM  ali  22  25..................YFLFRIIKMLYLELKADPSPALSFQPAGLP---------PQRASLLVLDSGSSNLQAFRYYGETMTVGRNSSNDLIIDDGFVSYDHACISQYKAGYWLTDLNSTNRTYLNGQLVADEVALHHGDIIKIGTVTFKFE. 152
378 1.000e-31UniRef50_A0A2N2MX09 Uncharacterized protein (Fragment) n=1 Tax=Chloroflexi bacterium HGW-Chloroflexi-5 TaxID=2013728 RepID=A0A2N2MX09_9CHLR  ali  33  6..............................................................KLIIQSGTGTGTEFPLEKNELFLGRDLTSDLVINDPEVSRRHLRLVLDGATYRLEDLGSTNGTFMHGQRLTTPTLLKPGEVITLGKIVLRYE. 98
379 1.000e-31UniRef50_A0A1Y2PJW4 Uncharacterized protein (Fragment) n=1 Tax=Streptomyces pharetrae CZA14 TaxID=1144883 RepID=A0A1Y2PJW4_9ACTN  ali  29  71............................RCTLGEPPLLDGAVLSLGAPTDPEPHPEVDDAPARLDVVAGPDAGGVHLLHGGRIDIGRSGDADVPLDDPDVSRLHCAVTLDDGRVTVADLGSTNGTTLDGARVSRPVRLPPGALLRLGESALRLAP 199
380 1.000e-31UniRef50_K9AJ32 FHA domain-containing protein n=38 Tax=Actinobacteria TaxID=201174 RepID=K9AJ32_9MICO  ali  36  50.................................DSARQSAPAPSRPAPQPRPTPAPPRANPGSIRVTAGPLAGTSLILSGAPVTFGRAPDNTIVIGDDFASSHHARIIARGGAWVLEDLSSTNGTFVDGSKITAPFDLGIGNQITIGHTTLE... 168
381 1.000e-31UniRef50_A0A1V5P3Z9 Transcriptional regulatory protein EmbR n=1 Tax=Chloroflexi bacterium ADurb.Bin360 TaxID=1852861 RepID=A0A1V5P3Z9_9CHLR  ali  24  175...............................................QSAPTVRSMAPPMSAKLRMLSGAQVGQEIVV-GPQVRLGREPDNEVVLLDPKVSRHHALLQQQGERFLLTDLGSSNGIFVNGKRIAAPALLEDGDVLTMGDTQMAF.. 279
382 1.000e-31UniRef50_A0A1Q5L7E6 Uncharacterized protein n=1 Tax=Streptomyces sp. TSRI0107 TaxID=1703942 RepID=A0A1Q5L7E6_9ACTN  ali  28  72............................RCTLGEPPLVDGAVLSLGAPADPEPHPEVGDAPARLDVVAGPDAGGVHLLHGGRIDIGRSADADVPLDDPDVSRLHCAVTLDDGRVTVADLGSTNGTTLDGSRVSHPVRLAPGALLRLGESALRLAP 200
383 1.000e-31UniRef50_A0A0F0KMV0 FHA domain-containing protein FhaB n=312 Tax=Bacteria TaxID=2 RepID=A0A0F0KMV0_9MICO  ali  37  63...........................................SRPASAKASTGPATIATAKRLVITSGPKAGLELPLGTDTLTIGRSSESALVIRDDYTSSHHARLMLRGDSWAIQDLDSTNGTFVAGQRVTGPVGLALGTPIKVGATTFELR. 174
384 1.000e-31UniRef50_UPI0009DDB28E FHA domain-containing protein n=3 Tax=Thermogemmatispora TaxID=768669 RepID=UPI0009DDB28E  ali  24  39.............................................PKQASRKEVDTDQGKRSSLVEASLSGPQGRIALGPGVTTVGRAPDNQIRLNDQQVSSHHAEFRAEDGGYSLVDRGSTNGTFVNDQRLTSPRRLNSGDRIRFGETVFTYE. 149
385 1.000e-31UniRef50_A0A095YDV0 Uncharacterized protein n=7 Tax=Micrococcales TaxID=85006 RepID=A0A095YDV0_9MICC  ali  28  100.......................VTVTFRKDESIQPTQIEVDASLGGTKAPSTPQPRPSARPQLHIRPTGNRGNRYALSGDSVVMGRAGDAGLHINDQGASRRHAEIVRRGNRVFIRDLGSTNGTYVNGSRIEGDEELLDGTIISIGHARLTF.. 246
386 1.000e-31UniRef50_A0A1Q8BMC7 Uncharacterized protein n=1 Tax=Cyanobacteria bacterium 13_1_20CM_4_61_6 TaxID=1805100 RepID=A0A1Q8BMC7_9CYAN  ali  25  129.......................IPVWQQTDPNADSKRTVSLQAM----PPEEVASGSGFAALLTFESGPFAGRIVALPSQMVSIGRAPDNDVVVGDPATSGHHGRIEVRAGSFWISDLGSTNGTLVNGEPVLEKQ-LSDNDMIAIGQNTVRF.. 253
387 1.000e-31UniRef50_A0A2L0ENJ8 Diguanylate cyclase n=16 Tax=Myxococcales TaxID=29 RepID=A0A2L0ENJ8_SORCE  ali  32  26.....................................................PARSPKDRAYLIVLAGSNVGEMYRVEGAEIVIGRASGATIRLNDDGISRRHARLLQMDGQVLIEDLNSSNGTMVNGEHVKR-VSLHDGDKIRLGSTTLKF.. 125
388 1.000e-31UniRef50_H8MXJ7 Pkn9 associate protein 1 n=1 Tax=Corallococcus coralloides (strain ATCC 25202 / DSM 2259 / NBRC 100086 / M2) TaxID=1144275 RepID=H8MX  ali  27  44........................PRPQRVPQYPAGPRKAKRRGPGERSRSDRESDPGLTPAFVYVERGPGAGQLVPLRQGSITLGRSSTSDLRLQHASISRRHAQLTRRGNVFTVRDLGSQNGTFVNRLRIKGEVELQPGDELSLGNATLRLR. 184
389 1.000e-31UniRef50_A9B476 FHA domain containing protein n=3 Tax=Herpetosiphon TaxID=64 RepID=A9B476_HERA2  ali  27  10.LDFVILLLRISVIFFLYFFLYQVVRVIRRELQVVGTGTGGAGVLAGA--------AQNLYGKLIVMSGLQRGYAFEL-GAVNMIGRRPDSDVALNDSFLSSEHALLEWRGDSWWLEDQRSTNGTFINDIEVADPTPIVYGDIIRIGRIELKL.. 156
390 1.000e-31UniRef50_A0A2S9XHC0 Response regulator PleD n=5 Tax=Enhygromyxa salina TaxID=215803 RepID=A0A2S9XHC0_9DELT  ali  23  5.................................PPDDSATAIREPTVVTTLRSLEDMVRRPACLVVIHGDNIGHKYDLDVKVLRIGRGRDNDICVNHRSVSRNHVEVHVDERGAQLRDLRSTNGTFVNDQPV-GNVYLRDGDRIKVGRTVLKF.. 123
391 1.000e-31UniRef50_UPI000DD32F7C FHA domain-containing protein n=1 Tax=Glycomyces sp. SJ-25 TaxID=2200759 RepID=UPI000DD32F7C  ali  60  18..............................................................WLVVTTGELQGRRFVLSGQPISIGRAADSTIVIRDDFASNRHARVVPMDGQWMVEDLGSTNGTYLGRARVTRPTPVPLGVPIRIGRSSFELRP 110
392 1.000e-31UniRef50_UPI0009FE56B0 FHA domain-containing protein n=1 Tax=Citricoccus sp. CH26A TaxID=1045009 RepID=UPI0009FE56B0  ali  53  1...........................................................MATRLAITEGPLKDTVIQLNGTPLLLGRAEDADLVLEDDYVSGRHARLFPQGSRWFLEDLGSTNGTFVSGNPLSRTVAVEPGTPIRIGKTVLELR. 95
393 1.000e-31UniRef50_UPI0009A848ED FHA domain-containing protein n=2 Tax=Eggerthellaceae TaxID=1643826 RepID=UPI0009A848ED  ali  24  28.................................GATQQFSPVQFSGSCATPSQQPEPNSKTAYILVLSGITKGSRYELKQGPTSIGRDPKRDIFLNDMTVSRNHASIVFEQNEWIIRDEGSFNGVWVNNKSVETKV-LQNGDIIQLGNFSLEFQ. 149
394 1.000e-31UniRef50_A0A257B3J3 Uncharacterized protein n=2 Tax=Chloracidobacterium TaxID=458032 RepID=A0A257B3J3_9BACT  ali  28  128...............................................PNRDPPVAAPSVPRAKLVIQRGGTIGKEFPLTETESNIGRWPDVDLDQDDPEVSRRHARIVCQDGQYVLEDLGSTNGTFVNGRRLGNRHPLNDGDEIIVGKTFLKFH. 246
395 1.000e-31UniRef50_A0A1G9DZP8 FtsK/SpoIIIE family protein n=35 Tax=Streptomyces TaxID=1883 RepID=A0A1G9DZP8_9ACTN  ali  30  66.........................RLDSRTCVLGEPPLVDGAVLALHSPADPAPTAQGAAARLHVVAGPDAGGVHLLHGGRITIGRSADADVPLDDPDVSRLHCAVTLDDGRVTVTDLGSTNGTGLDGTPVDRPVRLTPGALLRIGESTLRL.. 195
396 2.000e-31UniRef50_A0A2G6CMV7 Uncharacterized protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2G6CMV7_9PROT  ali  29  155.............................PDEAPATGEDELDAEPTSDVPGVGADEPEGPLPKLVVIGGNDRGKEFTLVDGDNGIGRSLDNAVVLADIAVSRKHTLICAEGGQFVVRDLGSGNGTLLNGNKVHT-HQLADGDQIELGNTLLRF.. 280
397 2.000e-31UniRef50_A0A1F9F1G0 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_16_71_12 TaxID=1797848 RepID=A0A1F9F1G0_9DELT  ali  30  20.........................................................PKADACLVVIYGQAIGHKYLLKPGEILIGRSSQAQIQIDHESVSRRHARIVLSENGVALSDLGSTNGTYVNDEAITER-GLGNGDLIKVGRTILKY.. 114
398 2.000e-31UniRef50_S3YJ46 Uncharacterized protein n=47 Tax=Actinobacteria TaxID=201174 RepID=S3YJ46_9MICO  ali  37  33....................FGTTVITRGGSGRKAGAERRTVSDPSALQQGQKTTDPNAVQTQLVVTAGPLRGTTIRLAASPILIGRAPECTLVLSDEYASNRHARVFPHDGEWYVEDLGSTNGTTLAGKPLEGAAPFKPGAAITIGNTQIELR. 167
399 2.000e-31UniRef50_A0A249LIU0 FHA domain-containing protein n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A249LIU0_9ACTN  ali  27  36.........................................SASDADRLAITAIIEGPADRAMVVIHRGPSKGARFLIDSGEVAIGRSVDSPIFLDDVTVSRKHAVIVKDEQKFSIKDQGSLNGTYLNNQSVLNS-PLTTGDEIQIGKFHMLF.. 146
400 2.000e-31UniRef50_A0A2E6RH11 GGDEF domain-containing protein n=1 Tax=Xanthomonadales bacterium TaxID=2006849 RepID=A0A2E6RH11_9GAMM  ali  31  85....................................................ASPSAAHGNACLVVIRGARLGTRVPLDNAQITIGRDSSCDFQISERNVSRTHCRITRHSEAFWLEDLGSTNRTMLNGNAVEQA-PLSDGDQVRVGSTVLKF.. 184
401 2.000e-31UniRef50_UPI0009DF2F55 FHA domain-containing protein n=1 Tax=Nocardia sp. NRRL WC-3656 TaxID=1463824 RepID=UPI0009DF2F55  ali  25  18..........................SVFRADFLNEVDASRSGEQTGEQPVQGVEGLPAGAALLVVKRGPNAGSRFLLDQPTTSAGRHPDSDIFLDDVTVSRRHAEFRQDEDTFQVVDVGSLNGTYVNREPVDSS-ELQNGDV............ 133
402 2.000e-31UniRef50_Q1B022 FHA domain containing protein n=4 Tax=Actinobacteria TaxID=201174 RepID=Q1B022_RUBXD  ali  35  35.....................................RSIPDDEPFRPGVPREAPAKRRGVSELMVEESEAPGTEFPIGNGTTTIGRSSASDIVLSDDYVSGRHARLTRHGGLLYVEDLGSTNGTFVNGRKAVGATPLRDGDLVRVGSTTFRY.. 153
403 2.000e-31UniRef50_A0A193BY79 Uncharacterized protein n=1 Tax=Amycolatopsis orientalis TaxID=31958 RepID=A0A193BY79_AMYOR  ali  24  6.........................RSDPDPLAHTSRTVSAPVPRPSEEPQAAAPVIPRPGATLNIVRGPGIQETIELTKDTTVVGRHPSSDVVLNDPTVSRHHIELRRSGGEVVITDLGSLNGTYVNRIPMDRRV-LADGDMVWVGRYRLLFR. 135
404 2.000e-31UniRef50_A0A2U2SP18 Uncharacterized protein n=1 Tax=Ardenticatenia bacterium TaxID=2099665 RepID=A0A2U2SP18_9CHLR  ali  29  10.......................................................AGVPATPLLEVVRGNEQGRIVRL-KLRTRIGRERDNELVLTDPRVSRYHAVIELDNTRWVIRDQNSANGTFVNGRRISAGKVLHPDDRIQIGDTEIVFHP 108
405 2.000e-31UniRef50_A0A2E7LEC6 Uncharacterized protein n=2 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E7LEC6_9PLAN  ali  31  1...........................................................MTPKLKVLHGKNAGHEIRLKGSKFLIGRGEECQLRPKSDAISRQHCEFTIEGDQVSVKDLGSKNGTLVNGTRIESATSLNDGDEIQIGKLAF.... 92
406 2.000e-31UniRef50_A0A2P8AR37 FHA domain-containing protein FhaB n=68 Tax=Micromonosporaceae TaxID=28056 RepID=A0A2P8AR37_9ACTN  ali  32  5.........................................................PELMPLLTVSGGAMRGLSFRVGRDPQLVGRAPSADIVLADPHLSRRHATVQATPDGVVLTDLGSTNGTWLNDQRIAGSVPLADGDVIRLGRTDLRF.. 100
407 2.000e-31UniRef50_A0A0S7BHV4 Protein containg FOG: FHA domain n=1 Tax=Longilinea arvoryzae TaxID=360412 RepID=A0A0S7BHV4_9CHLR  ali  30  5..............................................................RLVMRSGPNAGQVYSLEKNEVFIGRDLANDIIVNDPEVSRRHLRLFLQGNQYCAEDLGSTNGSFVNGQRLAGPFNLQSGEFLTLGE....... 90
408 2.000e-31UniRef50_F9NYA1 FHA domain protein n=41 Tax=Actinobacteria TaxID=201174 RepID=F9NYA1_9ACTN  ali  32  37...............................VPRNAEAAAVEPGRRSKSRKDRRREPAPEPTGLQVISGSRAGTYVPLANG-VTVGRSNDCTLPIDDDYASTRHAEFTPGDGAWFVEDLASTNGTHVNGERIEDPTRLSVGDEVRIGRTTMTV.. 158
409 2.000e-31UniRef50_A0A1F9ACN2 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_61_14 TaxID=1797834 RepID=A0A1F9ACN2_9DELT  ali  31  2...................................PEPKDDQEITTLGADAQTRELPEGILVMLRVVEGAEPGRGYQVTSVPVTLGRDALSGISLPDPKMSRQHAALALQGSEFVLKDLGSTNGTFVNDKRVKEAA-LCNGDQVRLGNTVLEF.. 118
410 2.000e-31UniRef50_X1HAL5 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1HAL5_9ZZZZ  ali  35  7....................................................AAEGPAQVEYKLVALNQEAGGQEFLLDGPVVSVGRQSATDIDLFDPYVSRRHARLRKDGADWLLEDLGSSNGTYLGDERLDGSAAVKPGDRIRIGHTWLEFQ. 109
411 2.000e-31UniRef50_A0A2D6KIN1 Uncharacterized protein n=3 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2D6KIN1_9ACTN  ali  30  25.NDQVLTIVGLGTLALVYYVFLRVVRSAW-----------------LASRPSRAARRWXASHLFVVEPESMNGRAFDLCDD-LTLGRAAGCSVTIDDDHVSQVHARIFHRSGQFVVEDLGSLNGTYMNRTRVKSPTAIGAGDRLQVGDTILEV.. 158
412 2.000e-31UniRef50_A0A134BH31 FHA domain protein n=6 Tax=Terrabacteria group TaxID=1783272 RepID=A0A134BH31_9ACTO  ali  36  33.........................ISLAATASTKTSTGRSRKANRQPKQSKPRKSKRGGRPRLAFTGGALAGNRLKLDGHPILLGRSGDCTVPLRDSYASNRHARIYHNDGQWFIEDLNSTNGTFVGNNRLTTAQLLEPGMVVRIGQTTMEL.. 161
413 2.000e-31UniRef50_A0A0M9UCF9 Uncharacterized protein n=1 Tax=Ardenticatena maritima TaxID=872965 RepID=A0A0M9UCF9_9CHLR  ali  17  95..................TFAGRPHIEFKPDPAISRGSVEVDATAPMAIETPETPSVMATGARLRWGD-----RLIPLDLPFMTIGRSMDNDIIIESEGVSRHHAQIKLRQGQYVLRDLESANGTFVNGQRIQDECVLQDGDRIRFANVELIFE. 239
414 3.000e-31UniRef50_A0A2H3L4L6 Uncharacterized protein n=1 Tax=Candidatus Chloroploca asiatica TaxID=1506545 RepID=A0A2H3L4L6_9CHLR  ali  27  16............................RTILDDAVYTTPGPSRPAERTELLSDETPPAVMAWLIIVSGARHGEMFRLIGKSLTIGRADDCEIQLEDRAISRQHAKVRLEGSRYMLHDLATDNGTFVNGDP-TTPVELKNGDTIKIGRTELMFK. 145
415 3.000e-31UniRef50_A0A257LG33 Uncharacterized protein n=2 Tax=Burkholderiales bacterium PBB5 TaxID=2015567 RepID=A0A257LG33_9BURK  ali  31  4..................................PSTIAIDRRELTRPRPLHEAESRA---CCLVIYSGDEAGRAHTLEPGVNLLGRSVEVQVLLDHPGVSRRHAEVVVDGAQVLLRDLASANGSYVNDEPVTAPVLLNDGDVVRLGSVALKF.. 119
416 3.000e-31UniRef50_A0A2H5ZTS6 Glycogen accumulation regulator GarA n=1 Tax=bacterium HR32 TaxID=2035427 RepID=A0A2H5ZTS6_9BACT  ali  28  2........................................RETGVASAEDQTRVYRVGAAPALLRVVEGPGQGSVLVLHRAVHTVGRREGCDLMLPDPRVSREHLRVERDASGTEVVDLGSTNGTFVNGQRVQR-CRLQHGDRIQLGGVVLEY.. 113
417 3.000e-31UniRef50_A0A2N0GXE7 FHA domain-containing protein n=9 Tax=Streptomyces TaxID=1883 RepID=A0A2N0GXE7_9ACTN  ali  51  310........................TRVTQRGSRRGGGAAAAPQQTGRQAAPPQQRQRRGAPTKLVVSEGTLTGTTVTLSGQTITLGRAHDSTIVLDDDYASSRHARIYPRDGQWIVEDLGSTNGTYLDRTRLTTPTPIPPGAPIRIGKTVIELR. 440
418 3.000e-31UniRef50_A0A0H5S049 FHA domain-containing protein n=8 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A0H5S049_9MYCO  ali  24  11..................................AVRRAPQDPAAQTTAHYCAPTNAELGSGVLSIVRGAASGAKFALAHPYTTAGRYPDSTVLLDHVTVSRRHAEFRWVDGHYWVIDTGSLNGVYVNQIRVESA-PLNNGDEIWIGKFDLVF.. 128
419 3.000e-31UniRef50_A0A1F8KGI9 Uncharacterized protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A1F8KGI9_9CHLR  ali  31  9.................................................................MRSGPTPGKIFPLERPEIIIGRDNISSLMINDAEVSRKHCRLIWQGSGYVIEDLGSTNGTFVNGQRLSAPFVLRGGESISLGE....... 91
420 3.000e-31UniRef50_A0A101E673 Putative signaling protein n=1 Tax=Clostridia bacterium 41_269 TaxID=1635275 RepID=A0A101E673_9FIRM  ali  29  41.............................................................PKLVVIAGPHRGETFFLKEGETFIGRIEGAPIILKDNSVSRRHAKVQFSGGKVSIHDLGSTNGVYINGHRIKSKI-LEPKDIISLGRTVLIFE. 136
421 3.000e-31UniRef50_A0A177QYK1 Diguanylate cyclase n=1 Tax=Planctomycetaceae bacterium SCGC AG-212-F19 TaxID=1799658 RepID=A0A177QYK1_9PLAN  ali  26  14.............................................TRPVPPKRSSSQNGRNATLVHISGPAMGSRYPLEKKDLLVGRAPECQIVLDEDSVSRQHVRIEVTPTGFYAVDLESTNGTFVNDVRIDSA-RLRDGDYLRVGDCIFRF.. 122
422 3.000e-31UniRef50_A0A1Q7Y9H6 Uncharacterized protein n=9 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A1Q7Y9H6_9BACT  ali  32  91.........................................................EGAHARLIIERGRSAGKQFPLSEDESQIGRWPDVDLDADDPEVSRRHARIMRRNGQYFIEDLGSTNGTFINGRRLGDRQPLRDGDEIIVGKTFLRFH. 199
423 3.000e-31UniRef50_A0A1W9Q3X7 Uncharacterized protein n=4 Tax=Anaerolineae TaxID=292625 RepID=A0A1W9Q3X7_9CHLR  ali  28  4............................................................RYQLVMRNGPNPGATYSLDADLMTIGRDPSNTIAINDAEISRQHARMSAQGGKIVIEDNGSTNGTAINGKRISGPHVLKSGEMISFGDIVFMFE. 98
424 3.000e-31UniRef50_E3J3H4 FHA domain containing protein n=59 Tax=Actinobacteria TaxID=201174 RepID=E3J3H4_FRAIE  ali  48  31.........................RAIRADLLEPARRRVQRRGTPVRAGGGGGDAVARPRGKVVVTKGPLAGTVIPLTGEPITIGRAPDSTLVLDDDFASGRHARLVPHDGRWFVEDLNSTNGTFLEHTKVTTPMPVSLGAPVRIGKTVLELR. 185
425 3.000e-31UniRef50_A0A2A2R1T5 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium Tous-C9LFEB TaxID=1982333 RepID=A0A2A2R1T5_9BACT  ali  25  99..........................ALRADQGAPSAPLEVGGNNVAVAPVIMTR-IQGGQPKLTVIDGDEAGRSFELTEEYTHLGRVLNNEITLAYPAISSRHCMFILSGSDVIVRDLNSSNGTYVNGVQITE-VILQLGDQIQIGPVVLKFE. 224
426 3.000e-31UniRef50_A0A0H0ZS66 Uncharacterized protein n=10 Tax=Micrococcales TaxID=85006 RepID=A0A0H0ZS66_9MICC  ali  29  151.................................PASPKTTAQPRPTSRPKPEPAAPSIPKQAILEV-----DGERFALHHHSIVLGRSASTDIPVDDSGVSRQHVRVETRGNTYVVSDLGSTNGTYVDGKKISSETRIFDGSIINIGQTKIVFR. 267
427 3.000e-31UniRef50_R7B6G9 Uncharacterized protein n=1 Tax=Eggerthella sp. CAG:298 TaxID=1262876 RepID=R7B6G9_9ACTN  ali  23  28.....................................ATEAFEAISIDTEGERAHAADQAPASLRVCYGKQEGLVFPLESDFIEIGRSPQCGVMLNDMTVSRVHAEMEKINGEWTITDRDSFNGVWVNNEAIKNAV-LNPGDLLQIGCFVLRF.. 142
428 3.000e-31UniRef50_A0A2N2ACX2 DUF2662 domain-containing protein n=2 Tax=unclassified Firmicutes sensu stricto (miscellaneous) TaxID=84086 RepID=A0A2N2ACX2_9FIR  ali  30  192.....................................................TAVARKPGAELVEKTGTRRGSSFPLSTRCMIIGRRNSNDICLEDSNVSRVHVSIDYVDGDYYITDLGSTNGTFVNEIRVSKK-KLTEGDRIRLGTTVLEFR. 291
429 3.000e-31UniRef50_A0A2V8RC33 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8RC33_9BACT  ali  26  102...............................PTRTSVVGRAGTREHGESSSPRHGSSAVPHAKLVIHRGRSVGKEFPMCEDESHIGRWPDVDLDTDDPEVSRRHARITRRGGQYYIEDLGSTNGTFVNGRRLGDRQPLRDGDEVIVGKTFLKFQ. 236
430 4.000e-31UniRef50_A0A1R4F8W0 Adenylate cyclase n=125 Tax=root TaxID=1 RepID=A0A1R4F8W0_9ACTO  ali  23  95.................YSFVGPVAVTFTEDPSLHTGRIRVQSATKRGAVAPAAAAQASVHPILDI-----DGRRYLLTGPVTVLGRGSESDIVLDDSGVSRRHLEVRVSPQGVIATDLGSTNGSFVEGHRITAAT-LVDGNTITMGRSRIMF.. 225
431 4.000e-31UniRef50_Q7UIF2 GGDEF family protein n=10 Tax=Planctomycetaceae TaxID=126 RepID=Q7UIF2_RHOBA  ali  27  38........................TKPMTTVTSQPTAAQIDVSEATLRQQPTVPPCNSSNECCLVQIYPPDVGMQ-LLEQEEFQIGRSPDSDLPLFDGSVSRQHAKLIRGQDGYLIRDLGSTNGTMVNETTIQSDHMLESGDTVRIGSFLFRF.. 167
432 4.000e-31UniRef50_A0A1A5P499 Cell division protein FtsK n=8 Tax=Actinobacteria TaxID=201174 RepID=A0A1A5P499_9ACTN  ali  26  69..........................AQRCTLGEPPLIDGAVLAVGAPGEPEPHPELDDTPTRLHVVAGPDAGGVHLLHGGEIRIGRSADADVPLDDPDVSRLHCAVTVGDGRVSVADLGSTNGTTLDGRRVSRPVGLAPGALLRIGESVLRLTP 199
433 4.000e-31UniRef50_A0A2N3G769 Uncharacterized protein n=1 Tax=Actinobacteria bacterium HGW-Actinobacteria-3 TaxID=2013648 RepID=A0A2N3G769_9ACTN  ali  25  114.....................FRIEPRVEGDLPRAHEKVETRDGIIKRS-------SEGRPAVLELLDSGDVSPVFDLGRKVAQIGRIADNDIVLPDPNVSRVHARVEWRDGAYFVSDLESTNGTWVNEERVSGK-KLQENDVIRLGSTRLIFR. 238
434 4.000e-31UniRef50_A0A2E0XVT7 Uncharacterized protein n=1 Tax=Phycisphaerae bacterium TaxID=2026778 RepID=A0A2E0XVT7_9BACT  ali  32  1............................................................MLALEVIRGVDQGRIYPLDGEPQLVGRSSEA-LPLTDRSVSRRHAELTPDGHTWWLRDLRSANGTWVNGRRLDDRVALTPGDEITCGETVLRF.. 93
435 4.000e-31UniRef50_A0A1F2XYC3 Uncharacterized protein n=5 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A1F2XYC3_9ACTN  ali  25  141......................................VEPAQTMVYRAPEPVAETDPAPEPEREVVTLTVAGRSHAITTPRVILGRSRDCDVRISDLNVSRRHAELQQEGATYWIVDLGSMNGTLLNGRRVERE-RLRDGDRITLGECEIVF.. 254
436 4.000e-31UniRef50_UPI000D3133C2 FHA domain-containing protein n=1 Tax=Nocardioides terrigena TaxID=424797 RepID=UPI000D3133C2  ali  31  252.............................HDPRLAPVPAQEPGGRPVRATSLVASGVPGSPPMLT----GHGGVKVALTGAPVVLGRHGDCDLVLADEQASRRHAQVEAGADGFVLVDLGSTNGTYLNGTAVKAPVALTDGDTIVVGHTVVRF.. 371
437 4.000e-31UniRef50_A0A0B2JUJ0 Uncharacterized protein n=4 Tax=Anaerovibrio TaxID=82373 RepID=A0A0B2JUJ0_9FIRM  ali  26  13......IALQYGLLLLLLYFVYKLMKFMKKD------------SQHVVEDIYAVTEISNVEAVLTVLEAADQGQRFAFSNH-ISIGRGNDNDIVLNDSFASHHHAEIALLNNLYVIEDMGSVNKTYVNNEPITGRQYLQSGDLISVGSATFEF.. 149
438 4.000e-31UniRef50_A0A2H0PG35 Fis family transcriptional regulator n=11 Tax=root TaxID=1 RepID=A0A2H0PG35_9DELT  ali  33  26.............................................................GQLVVIEGEDKGRKFRLEKPQIKIGKKEGNDLLLSDKTVSRNHIEIEYTSDSFLLRDLGSTNGTYLNGTRVKEAY-LAPGDVIKLGNTSIEFQ. 117
439 4.000e-31UniRef50_A0A177HGS5 FtsK/SpoIIIE family protein n=1 Tax=Streptomyces jeddahensis TaxID=1716141 RepID=A0A177HGS5_9ACTN  ali  29  70....................................PPLVDGAVLALGAPADPGPEFEGATAQLHVVAGPDAGGVHLLHGGRIDIGRSADADVPLDDPDVSRLHCAVTVADGGVSVTDLGSTNGTTVNGTPIDRPVRLQPGALLRLGESAIRLAP 190
440 4.000e-31UniRef50_A0A2G4FCZ7 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2G4FCZ7_9ACTN  ali  22  26............................AKDATTAAIALVDDKDSIVKEYEETVAKLAPDAALLVARRGPNAGSSFLLTQDQTTLGRTPKADIFLDDITVSREHAVIAREGGVYLVRDHDSLNGTYLNHEVVNEGV-LDDLSELQIGRYIFTF.. 149
441 5.000e-31UniRef50_A0A1V5XNR6 Response regulator PleD n=13 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1V5XNR6_9DELT  ali  34  1.................................................................MIYGPELGRRIPLRRNSMEIGRHPSNDFPLDQESVSRRHARIVWSNDHWHAIDLGSTNGTYVNDELVTDRV-LRDGDQIKVGRTILKF.. 88
442 5.000e-31UniRef50_A0A2H5X2D0 Glycogen accumulation regulator GarA n=1 Tax=bacterium HR16 TaxID=2035411 RepID=A0A2H5X2D0_9BACT  ali  32  339..............................................................RLVGARGAYGGSIFEITGAEASIGREVGNTIQLDDNTVSRRHARLLKQGDSWVIRDEGSSNGTWVNGVRITE-QPLRPGDEIQIGATFFRWE. 430
443 5.000e-31UniRef50_UPI000B4BA6B3 GGDEF domain-containing protein n=1 Tax=Ideonella sp. A 288 TaxID=1962181 RepID=UPI000B4BA6B3  ali  29  21.......................................................GGPGRRPCLILYSGADTGRPFALDAGRVVIGRAPDAAVHIDSPGLSRRHAELTVSDEAVTLRDLGSFNGTHVNDRRIDGEVALREGDLVRLGDLLFKF.. 118
444 5.000e-31UniRef50_G1WG39 Uncharacterized protein n=16 Tax=Coriobacteriales TaxID=84999 RepID=G1WG39_9ACTN  ali  28  24...........................................PLDDATAPDLMRKVQVSTPVLTIIKGPQTGNTFELDEVETTVGRDPANSIFLNDMTVSRAHAKIKRGPMGVLIEDLGSLNGTWVDGAIVNSA-PLHDGSSVQIGTFTLIYH. 133
445 5.000e-31UniRef50_A0A0M8WD03 Uncharacterized protein (Fragment) n=4 Tax=Streptomyces TaxID=1883 RepID=A0A0M8WD03_9ACTN  ali  27  79..........................AQRCTLGEPPLIDGAVLALGTPAEPEPHPEADEVAAQLHVVAGPDAGGVHLLHGGQITIGRSADADVPLDDPDVSRLHCAVTVEDGRIAVADLNSTNGTTLSGTRLTRPVRLAPGALLRIGESALRLTP 209
446 5.000e-31UniRef50_A0A132NF78 Uncharacterized protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A132NF78_9ACTN  ali  27  94.................YSFVGPVQIRFERVDDLETGMFRVRSQAGVVPMAAAAPPAGRPVAYLEI-----NGARHPLTKPVMTIGRGLDVDLRIEDPGVSRRHAEIRAGGDTAIITDLGSTNGVIVDGRPVDQA-PLRDGSVIILGNTTLIFR. 226
447 5.000e-31UniRef50_A0A2M7KPN6 Uncharacterized protein n=1 Tax=Armatimonadetes bacterium CG_4_8_14_3_um_filter_66_20 TaxID=1973912 RepID=A0A2M7KPN6_9BACT  ali  24  109...........................VRAGQVRVHGKADSRAPSGSASPSPRAAPAADSGGRLRIASGPRRGASFTIPPAGAVLGRDPDCQVHLLEPSASRRHAEVVPLADGFLLRDLGSTNGTLVNNQPATER-PLVPGDLIAIGSTLLEFQ. 234
448 5.000e-31UniRef50_A0A2E7ZTM7 GGDEF domain-containing protein n=2 Tax=Myxococcales bacterium TaxID=2026763 RepID=A0A2E7ZTM7_9DELT  ali  26  2...................................SRPDHLDAETRITSVREIAARNASTIACLVQLRGPQMGRRLELTDRTFSIGRDPSSDIVLESDSVSRRHARIEPDRAGHCIIDNESTNGTYLNEVVVSGEAQLRSGDYIQIGEAIFKY.. 119
449 6.000e-31UniRef50_A0A2V2SFE1 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium TaxID=2026799 RepID=A0A2V2SFE1_9BACT  ali  32  3............................................................MPKLVVLSAELSGRSHELKTDRTTIGRLEDNTFQIAESSVSSHHCEVLLKGTEVLIRDLNSTNGTYINGQKITESV-LKPGQTLRLGQIELRLE. 95
450 6.000e-31UniRef50_A0A136JPW1 Serine/threonine protein kinase n=5 Tax=unclassified Acidobacteria (miscellaneous) TaxID=305072 RepID=A0A136JPW1_9BACT  ali  28  69..............................TEADPTPPVMPAPFQAETTAPTETAPVTTISAKLVIERGDGQQIEFPLSGTEATIGRDADNDVDLDEAKVSRRHARIKIANGRYTIEDLGSTNGTYVNGRRLGNPHLIEDNDEVIVGKTFLRFR. 204
451 6.000e-31UniRef50_A0A1G9TZ52 Inner membrane component of T3SS domain-containing protein n=37 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1G9TZ52_9MICO  ali  38  79......................................VARASPAGGNSGADGGRATAQNTTRLVITSGPKAGTEFPLGAETITIGRSSDSSLVIRDDYTSTHHARLMLWNDEWMLQDLDSTNGTFLAGSRVTVPTKIPLNATVKIGATSFELR. 194
452 6.000e-31UniRef50_UPI000D0EAB32 DUF2662 domain-containing protein n=1 Tax=Janibacter sp. Marseille-P4121 TaxID=2058291 RepID=UPI000D0EAB32  ali  23  157..............................DPNDPYAEDHGERYEDDAYDEPAPIMSAKDRPWLEI-----DGDRYPLLGPTVVLGRDESADIILDDGSISRRHCEIRTTTDGFTLRDLGSTNGTFVNGDRIPSQHV-HDGDTITIGKTRMTFR. 278
453 6.000e-31UniRef50_D0LUL5 FHA domain containing protein n=2 Tax=Haliangium ochraceum TaxID=80816 RepID=D0LUL5_HALO1  ali  25  116...........................QRRAGSAVSRLPAPPTPRPIAPARPRASVPEAARGSLEVISGNDNGRSFPLHGTAVTIGRGIDNDVVLTDIAVSRKHLTLEFDGSRYRLTDKGSGNGTLINDRLETGSSLLRHDDRIEIGNTVMRLE. 242
454 6.000e-31UniRef50_A0A085WA95 FHA domain containing protein n=1 Tax=Hyalangium minutum TaxID=394096 RepID=A0A085WA95_9DELT  ali  25  51.....................FPAGSRRTGARRTGVREGTKDRELATRFDTQEYSDPGYVLAFLYVEKGPGAGQLMPVKQGPLIIGRASACDLRLQHPSISRRHAQLMRQGERFTLRDLGSQNGTFVNRIKLSADQEIVVGDEISLGNAVLKLR. 183
455 6.000e-31UniRef50_D5STK3 Stage II sporulation E family protein n=4 Tax=Planctopirus TaxID=1649480 RepID=D5STK3_PLAL2  ali  27  1............................................................MASLKVIKGPVVGQIVELREPRMILGRHATSQIVLDHQSVSRHHAQILREHGQYRVEDLRSLNGTHVNHELIPGPRELRDGDLLRICDFVFEFQ. 94
456 7.000e-31UniRef50_S9PBK4 FHA domain protein n=6 Tax=Cystobacter TaxID=42 RepID=S9PBK4_9DELT  ali  29  3..................................................................TAGPCAGQEFGLEDGEYVIGRANDNPICIPDSSVSRRHVLIRRLGGGWTVNDLGSGNGTLMNGEPLSEETPLVSGAVLTLGDTELTF.. 89
457 7.000e-31UniRef50_U2PWT3 FHA domain protein n=4 Tax=Propionibacterium TaxID=1743 RepID=U2PWT3_9ACTN  ali  32  27..........................TIRTDLFGRTATAAELSDVPGPTRPAARRRRRKGPSRLAVIAGRRTGTEVPLD-GEISIGRSVDCVLDIDDDYASGHHAQLWQDAGRWVITDLQSTNGTYVNGAKIAEPTLVGPNDVIRIGRSQLKLE. 156
458 7.000e-31UniRef50_UPI0004BEEFFF FHA domain-containing protein n=1 Tax=Streptomyces TaxID=1883 RepID=UPI0004BEEFFF  ali  26  65..........................PQRRTLGEPPLTDGAVLTLGAPAEPGPEASDDDVPAELHVVAGPDAGGVHLLHGGQIRVGRSADADVPLDDPDVSRLHCAVTVADGRVTVADLGSTNGTTLDGVRVTRPVRLAPGALLRLGESTLRLTP 195
459 7.000e-31UniRef50_W4UGY3 FHA domain protein n=1 Tax=Cutibacterium acnes JCM 18920 TaxID=1302244 RepID=W4UGY3_CUTAC  ali  35  2.........................................ESGRRSKGRRTRRREPAPIPTGLQVISGSQAGTFVPLANG-VTVGRGNDCTLPIDDDYASTHHAEFSPGDGAWFVEDLASTNGTHVNGERIENPTRLSVGDEVRIGRTTMTV.. 113
460 7.000e-31UniRef50_A0A1G1I679 Uncharacterized protein n=1 Tax=Nitrospirae bacterium RIFCSPHIGHO2_01_FULL_66_17 TaxID=1801712 RepID=A0A1G1I679_9BACT  ali  33  13...................................PPAVDETTVEAADSFGKRLDRPVRDLACLVVIAGAAIGEKIPLTQHRVVIGRLSDVEICLDDSMVSRRHAELAIGDGRAVIRDLGSRNGTFCNERRVTEEV-LHDGDLIRIGGTALKY.. 130
461 7.000e-31UniRef50_A0A2V7Q526 Uncharacterized protein (Fragment) n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7Q526_9BACT  ali  30  1..........................RLRHTVHGLEAFVPASPRSVXXXXXXXXXXXXXXFASFLVRSGGLSGHRLSVKTPVANIGRAEYNDLVVPDPSVSTSHAKLQRREGVWVLVDLDSTNGTFVDGERVKGEAPLAPGAAVRFGDVQLVFEP 129
462 7.000e-31UniRef50_A0A2M8FY74 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium CG_4_9_14_0_2_um_filter_42_21 TaxID=1973964 RepID=A0A2M8FY74_9DELT  ali  25  220..............................DTSSTQTGNASGETLVEDHSAKATKITNVRPAKLVHVNGSNAGEAITLLQ-KTSLGRAESNTIPLNDPKSSRQHAQILKKGAEFILVDLNSSNGTYVNGQRIDE-YVLSDGDEVKIGDSLMQFE. 341
463 8.000e-31UniRef50_A0A2D6YVU7 Uncharacterized protein n=9 Tax=Planctomycetes TaxID=203682 RepID=A0A2D6YVU7_9BACT  ali  35  1............................................................MYCLLVVEGPDSGARFLLDREPQLIGRSTEA-VPLHDDSVSRRHAELTPDEGRWWIRDLDSSNGTWINDRPIEDRTPLAPGDRIRCGDTTLVL.. 93
464 8.000e-31UniRef50_A0A1W9VJ39 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium 4572_5.2 TaxID=1971725 RepID=A0A1W9VJ39_9CHLR  ali  29  15..........................................................RPKANLIVKQGPQIGILFPITTDSVILGREETCTVIVQDAESSRQHCELTWDEGTYFAQDLGSTNGTFVDGVQITTPTPLKSGSSIGIGQTTLVLE. 112
465 8.000e-31UniRef50_A0A2H6B500 FHA domain-containing protein FhaB n=1 Tax=bacterium HR41 TaxID=2035436 RepID=A0A2H6B500_9BACT  ali  26  26.........................RSARRDVAGPAPPEPVMATVGENARAVALDLHSGLRPRLEVVAGHQPGEELAIDGGA-TLGRAASADVVVQDPFASAAHARIFAHGGFMWIEDLGSTNGTYVNCRRVTSPQRLRPSDVIRIGDSEYRY.. 156
466 8.000e-31UniRef50_A0A1F9I2C5 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_02_FULL_47_10 TaxID=1797880 RepID=A0A1F9I2C5_9DELT  ali  24  183......................................TPEEESRPSISQEVTKKTANAGEARVIIIEGSQAGHEYKLKK-ETTIGRANTSVIVLKDAKVSRQHAVIKRAGAEFVIEDLNSSNGVIVNHEKVKE-HVLGDGDQIQIGDHIFQFK. 296
467 8.000e-31UniRef50_U3GWA0 Uncharacterized protein n=3 Tax=Corynebacterium TaxID=1716 RepID=U3GWA0_9CORY  ali  34  3......LAFRIGLLVVLWVFVFAVLRELRRDLSGVGGAPAAPVMTAAATAASPSVPGSSGADVLEVIGGPA----YDLSGDQVVIGRHPECDIVISDDFASSRHARLFRRPGSWFVEDLNSRNGTFVGQWRVEQPERVS--DVITVGQTALR... 162
468 8.000e-31UniRef50_A0A0M8QH57 Cell division protein FtsK n=6 Tax=Streptomyces TaxID=1883 RepID=A0A0M8QH57_9ACTN  ali  27  71..........................AQRCTLGEPPLIDGAVLAVGAPGEPEPHPELDGTPTRLHVVAGPDAGGVHLLHGGEIRIGRSADADVPLDDPDVSRLHCAVTVADGGVSVADLGSTNGTTLDGRRVGRPVRLAPGALLRIGESALRL.. 199
469 8.000e-31UniRef50_A0A1A9GJS4 FHA domain-containing protein FhaB n=653 Tax=Actinobacteria TaxID=201174 RepID=A0A1A9GJS4_9ACTN  ali  40  35...........................ARVPETARGAQPAGGKKEKKAKAAKVPAKRRGAPTHLLVVEGGNAGERAELVDAPLLIGRGSDAAIRLDDDYVSTRHARVAASGDQWFVEDLGSTNGTYIGTVRINQPTTITMGTQVRIGKTILELR. 161
470 9.000e-31UniRef50_A0A2N3TQK7 Type III secretion system (T3SS) inner membrane Yop/YscD-like protein n=3 Tax=Streptomyces TaxID=1883 RepID=A0A2N3TQK7_9ACTN  ali  28  74............................RCTLGEPPLVDGAVLSLGAPAAPEPHPELDDAPTQLHVVAGPDAGGVHLLHGGRITVGRSADADVPLDDPDVSRLHCAVTVADGRVSVADLGSTNGTALDGTRVDRPVRFPPGALLRIGESALRVTP 202
471 9.000e-31UniRef50_A0A1F9E741 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RIFCSPHIGHO2_02_FULL_38_15 TaxID=1797857 RepID=A0A1F9E741_9DELT  ali  26  3.............................................................GCLRILTGEHQGGFYPLASHTVTLGRAPDNDIVLDDKGISRHHAQITYENKCYFIIDLNTPNGTYVNKRRVLN-QPLKEGDIIQLGHCSFQF.. 93
472 9.000e-31UniRef50_A0A142Y2G3 Phosphoserine phosphatase RsbP n=14 Tax=Planctomycetes TaxID=203682 RepID=A0A142Y2G3_9PLAN  ali  27  1............................................................MPYLDAVTGPAMGRRYNLDANQYVLGRHPDCDIVLESGSVSRQHAKLIRSGVGYALEDLKSRNGTFVNGRLIGDTTQLVEGDSIRICDIELTFH. 94
473 9.000e-31UniRef50_UPI0004781060 FHA domain-containing protein n=4 Tax=Streptomyces TaxID=1883 RepID=UPI0004781060  ali  29  77..........................TQRCTLGEPPLTDGAVLSLGAPAEPEAHPELDDAPTQLHVVAGPDAGGVHLLHGGQIHIGRSADADVPLDDPDVSRLHCAVTVDGGRVSVADLGSTNGTTLAGTRVTRPVRFAPGALLRIGESALRLTP 207
474 9.000e-31UniRef50_S3X960 Uncharacterized protein n=11 Tax=Terrabacteria group TaxID=1783272 RepID=S3X960_9ACTN  ali  28  27..........................TIRVDLFGRHVSAEELVAADEKPSSRRQTRGSSTPTKITITTGRAAGASAPLPSGEIMLGRTSAADLDVDDDYASSRHARVWRDEQGWVVEDLLSTNGTYVNGQKISQPTRIGVGDVVRIGRSQMQLE. 156
475 9.000e-31UniRef50_A0A2N1PT65 Uncharacterized protein n=1 Tax=Candidatus Wallbacteria bacterium HGW-Wallbacteria-1 TaxID=2013854 RepID=A0A2N1PT65_9BACT  ali  35  10.......................................................QNDATGARLVVMMGERQ-REFDFSKNPLTIGRTPENDVAVSDKVASRRHAQVEFRDGEYLVSDLGSRNGTLLNGKKVEGEVHLNNGDVITIGDTDIRFE. 108
476 9.000e-31UniRef50_H6RJD4 Uncharacterized protein n=30 Tax=Actinobacteria TaxID=201174 RepID=H6RJD4_BLASD  ali  32  154...................................RGRMATDTGKQNPSIVGRAGSRVTSTHVLVV-DGP--GTRHELSTGRNVIGRGTEADIRLPDTGVSRKHVDVVLDGDVATVEDLGSTNGTLVNGRRVTR-QPLSDGDVIRIGHSVLVYR. 268
477 9.000e-31UniRef50_A9WEE2 Forkhead-associated protein n=14 Tax=Bacteria TaxID=2 RepID=A9WEE2_CHLAA  ali  23  109.......................VPRRSIQVEAEMRDNQSDQPTMTMIMQSDRAPGRSSGAFFLLQI--GNAPQALPIATTTVTIGRGLDNDIILEDTRVSRKHAQLRYRQRRFWLTDLGSTNGTFVNGERISERA-LRDGDVVSLGGLELTFR. 236
478 9.000e-31UniRef50_X8CFM1 FHA domain protein n=2 Tax=Mycobacterium TaxID=1763 RepID=X8CFM1_MYCIT  ali  95  1..................................................................................MLIGRADDSTLVLTDDYASTRHARLSQRGSEWYVEDLGSTNGTYLDRAKVTTAVRVPIGTPIRIGKTAIELRP 73
479 1.000e-30UniRef50_A0A2N3S9H1 Type III secretion system (T3SS) inner membrane Yop/YscD-like protein n=3 Tax=Plantactinospora TaxID=673534 RepID=A0A2N3S9H1_9ACT  ali  30  22.............................................................PILTVTSGPLRGASFRLHPGVRRIGRQDGADVLLDDPKVSRWHATVELTAGRVLLTDTGSTNGTFLNDERLRGHTELRDGDRIRLGNLELRF.. 113
480 1.000e-30UniRef50_A0A1H4TR09 FtsK/SpoIIIE family protein n=3 Tax=Streptomyces TaxID=1883 RepID=A0A1H4TR09_9ACTN  ali  29  91............................RSTLGEPPLTDGAVLSLGAPAAPEPHPELDDAPTQLHVVAGPDAGGVHLLHGGEIRIGRSADADVPLDDPDVSRLHCAVTVADGRVSVADLGSTNGTTLDGARLTRPVRFAPGALLRIGESALRLTP 219
481 1.000e-30UniRef50_A0A142WZ84 Phosphoserine phosphatase RsbU n=1 Tax=Planctomyces sp. SH-PL14 TaxID=1632864 RepID=A0A142WZ84_9PLAN  ali  26  1............................................................MAQLLVVKGSASGTVHPVFGERTVLGRHPQCDVVLDNVAVSRQHAQILEGHGNYYVEDLRSRNRTFVNGVEVDGRVQLRHGDQLRICDTILKF.. 93
482 1.000e-30UniRef50_A0A1C5KCA8 FHA domain-containing protein n=12 Tax=Micromonosporaceae TaxID=28056 RepID=A0A1C5KCA8_9ACTN  ali  26  12..................LFGGRQVSARGRGDDRAGGEVVTRSWQADGGRLWESGDHPELMPLLTVAGGPMRGASFRVRPQPQVIGRAPTADIAVADAHLSRRHAEVRLTDAGVVLTDLASTNGTWLNDRRITGSEPLTDGDVIRLGRTELRY.. 150
483 1.000e-30UniRef50_A0A124GVF2 Cell division protein FtsK n=14 Tax=Streptomyces TaxID=1883 RepID=A0A124GVF2_9ACTN  ali  30  80............................RSTLGEPPLTDGAVLSLGAPAAPEPHPELDDAPTQLHVVAGPDAGGVHLLHGGEIRIGRSADADVPLDDPDVSRLHCVVTVTDGRVSVADLGSTNGTTLDGSRVTTPVRFGPGALLRIGESALRLTP 208
484 1.000e-30UniRef50_A0A0M5M0B9 Uncharacterized protein n=104 Tax=Bacteria TaxID=2 RepID=A0A0M5M0B9_9MICC  ali  50  31........................RRDLVIGQKAKVGAPTARQARKHPELVQAAPPAKAAARQLVVTEGPLSGTTLELTGTPILLGRAQEATLVLEDDYASGRHARLFPQGTRWFIEDLGSTNGTYLGGTQLTRALPVELGVPVRIGKTVIELR. 160
485 1.000e-30UniRef50_A0A062XVY2 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A062XVY2_9BACT  ali  20  174...................................SVEATEAMALATPPPEEAGATIALAMPRLLVQTPEGVSQEFQLKAQVTTIGRSPRNDICIAEASVSRQHAEIFLSARGYSIRDLGSNNGVFVNGQKVVE-HLLASGDVIELG........ 284
486 1.000e-30UniRef50_A0A1C5DN63 Forkhead associated (FHA) domain, binds pSer, pThr, pTyr (Fragment) n=2 Tax=Streptomyces TaxID=1883 RepID=A0A1C5DN63_9ACTN  ali  25  57..................LFAGRERLDAQR-CALGEPPLVDGAVLSLQVPGEDEAADDAVPAQLHVVAGPDAGGVHLLHGGRIRIGRSADADVPLDDPDVSRLHCTVTVSADGLVVADLGSTNGTLLDGTEVDRPVRLKPGALLRLGESTLRL.. 192
487 1.000e-30UniRef50_A0A2E8K613 GGDEF domain-containing protein n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8K613_9GAMM  ali  25  20..............................................REGPAVLEDEEEVKRPCLIMIKGDFIGQVYELQKDVTMIGRSDEVELVVSDISMSRKHAMIVDRTDGFHVSDLGSTNGCWVNKDRVSEPTKLEEGDKLTLGNVVFKF.. 126
488 1.000e-30UniRef50_A0A2T2R9T1 Uncharacterized protein n=1 Tax=Actinobacteria bacterium QS_8_72_14 TaxID=1919086 RepID=A0A2T2R9T1_9ACTN  ali  29  41.......................................VDTRMEVTQPTVVGPAKRLTPLPSLVVTEGPLQGHSFSLDGDELVVGRREHSDVHMPDPHVSRTHAVIRKHSGAVWIEDLGSTGGTWVNDQQVAGARALRHGDQVRFGAVTTRFE. 156
489 1.000e-30UniRef50_W4LWA0 Uncharacterized protein n=3 Tax=Candidatus Entotheonella TaxID=93171 RepID=W4LWA0_9BACT  ali  32  1............................................................MAFLEIYAGCESGRQFPL-GDTMSIGRNSDNDIVISDSRASRYHARVTRRGDDFFLEDLSSSNGTFVGEKQLSPGIRLTDGDEIRIGSTRLIFR. 95
490 1.000e-30UniRef50_D0YP63 FHA domain protein n=21 Tax=Actinobacteria TaxID=201174 RepID=D0YP63_9ACTO  ali  44  29............................RRDIYGTMVTRRTRAAKSKKRPKKNAK--SKAVSTLLVTEGPLTGSSLQLSNRPIIVGRAPTSTLVLDDDYASAQHARIYLQDNQWYVEDLGSTNGTVVGGVRITAPTPLNAKTPVRFGQTIVELR. 152
491 1.000e-30UniRef50_W9G0I4 Uncharacterized protein (Fragment) n=3 Tax=Intrasporangiaceae TaxID=85021 RepID=W9G0I4_9MICO  ali  22  5.................................PARPQVPHAPAHDERAGARPPRANPSSRPWLDI-----AGDRYPLLGSLTTLGRDESADVVLDDPGVSRRHSEIRVTTDGPHIRDLNSTNGTFVNGERISS-QRLTDGDRITLGRTTAVFR. 123
492 1.000e-30UniRef50_A0A094PB56 Uncharacterized protein n=1 Tax=actinobacterium acAMD-5 TaxID=1504319 RepID=A0A094PB56_9ACTN  ali  26  8.............................PDLSPVEATSAIPIVESFSGEMPAVTDLPDGSAVLLVIRGPQVGDQFVLTPAGVVIGRAGDGDLSLDDVTVSRKHAHIYRTNDAWFLEDLQSLNGSYVNRSRVDK-TELSGGEEIQIGKYRFAF.. 134
493 1.000e-30UniRef50_A0A0I9W335 Uncharacterized protein n=3 Tax=Dermacoccaceae TaxID=145357 RepID=A0A0I9W335_9MICO  ali  40  34................................GAKTGGGRASRASSRERGTKTPRAVKKGPTHVAVIEGAMRGTTLPLTESGVLLGRNPECSLVLSDDFASGRHARIYPEADGWYLDDLGSTNGTYIGAERIGEHVHVDAGTRIRIGRTVLELR. 155
494 1.000e-30UniRef50_E2MZ05 FHA domain protein n=25 Tax=Corynebacteriaceae TaxID=1653 RepID=E2MZ05_CORAY  ali  22  179.............................PTASRPIPAVDPEAATELSSAAVGEDPPQEKTVTLLLQDGSS--RIFEVRHGSNIIGRGTASDFRLPDTGVSRQHAEITWDGQDAVLVDLHSTNGTIVNGEPIDN-WLLADGDEISLGHSVLEVQ. 300
495 1.000e-30UniRef50_A0A221R9P5 Uncharacterized protein n=1 Tax=Sinomonas sp. R1AF57 TaxID=2020377 RepID=A0A221R9P5_9MICC  ali  28  3.......................................................EAGSGRRLLTVLDGPHAGQKFYLPDGETILGRSADADIVLDDESISRRHAAVTVSNGRVRLDDLGSRNGTWLNDERVAASQELLDGDEVGLGEVRLSFH. 102
496 1.000e-30UniRef50_A0A2M9CCT4 Type III secretion system (T3SS) inner membrane Yop/YscD-like protein n=15 Tax=Bacteria TaxID=2 RepID=A0A2M9CCT4_9CELL  ali  54  84........................................................RSAGPTRLVVTTGALRGTTIPLTSQAILIGRAPGCTLVLEDDYSSSRHARVFPQGGQWYVEDLGSTNGTYIHDKRISGVVQISPGTPVRIGQSTVELQ. 181
497 1.000e-30UniRef50_UPI0009312C45 FHA domain-containing protein n=1 Tax=Ndongobacter massiliensis TaxID=1871025 RepID=UPI0009312C45  ali  26  22LYTILATGLKFLFVILVLRFIYTIVKMITLDIRSNQKEVPRAPHLQLLSRPESFDFPVQAEYYL---------------SDNTTIGRADDNSIVLKDSRVSKHHARIVRDTDFYYIDDLGATNPTYVNNQPLEGPVQLESEDQIRIGGLLFRF.. 160
498 1.000e-30UniRef50_A0A0Q0UFY9 FHA domain-containing protein FhaB n=112 Tax=Bacteria TaxID=2 RepID=A0A0Q0UFY9_9CORY  ali  38  29............................RKDTAVVSGAQSNKRP---RGKATSTPRKAAPAQRITIVEGPLQGSYMEISSGEVVMGRSPDCDFVLGDDFASARHARLFRRGSDWFVEDLDSRNGTFVAGTRIDQPERVDTGTSIRVGRTTVRLVP 153
499 2.000e-30UniRef50_A6GKD7 FHA/GGDEF domain protein n=1 Tax=Plesiocystis pacifica SIR-1 TaxID=391625 RepID=A6GKD7_9DELT  ali  25  14.................................................PHVTKRESGARRAFVVVLAGDRMGEMFPLNEGRTSIGRGLHADVRINDEGISRSHAQVEHEDGHYYLSDAGSTNGTFANGERVDR-YPLKEGDKIQIGSSVLRF.. 117
500 2.000e-30UniRef50_A0A255HCR8 FHA domain-containing protein n=3 Tax=unclassified Propionibacteriaceae TaxID=185283 RepID=A0A255HCR8_9ACTN  ali  36  38......................................PASELPRDLENPRKRRRMKKGAPRRFAIVSGDQTGISADLASGVVQIGRSADCQIILDDDYVSTRHARLEADAGGWFIEDLGSTNGTYVNNQRITAPTTITLTDTVRIGRTQLRL.. 153
501 2.000e-30UniRef50_UPI000835D0F5 FHA domain-containing protein n=1 Tax=Corynebacterium provencense TaxID=1737425 RepID=UPI000835D0F5  ali  37  26.........................RAMNRDVRATSGAAPVGPGTGHAPSAHSARGRSAAPRSLILTSGPLAGTTLALSGDEITVGRSSGCTLVLEDDFASGTHARLIRRGPDWFLEDLDSRNGTFLDGQRIDQPEPLHVGSEFRVGQTSVR... 158
502 2.000e-30UniRef50_A0A2U2SRD2 Uncharacterized protein n=1 Tax=Ardenticatenia bacterium TaxID=2099665 RepID=A0A2U2SRD2_9CHLR  ali  37  23.........................................................GHAPVRLRVQVGDQIGRAYIMSGETMRIGRALDNDLVLDDVQVSRYHARLIRRGDTLIIEDLGSTNGTLVSGRRIAQPQALQPDDTIAIGRTVF.... 116
503 2.000e-30UniRef50_A0A172RZB1 FHA domain-containing protein n=3 Tax=Coriobacteriia TaxID=84998 RepID=A0A172RZB1_9ACTN  ali  28  284..........................................QAPATRTFNDASPAAAVYPARLVNTA---TGRTYALTVSRMVMGRSSGCGIVVDDINASRSHAEFTCDGNGWTITDLGSTNGTYVNGQRITS-QPLYEGDRISLGMTDLMF.. 391
504 2.000e-30UniRef50_A0A1Q7HYD8 Uncharacterized protein n=7 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1Q7HYD8_9CHLR  ali  31  158.....................................................AVQPRGPKASLEV---SGEGRRVPVGSGTISVGRAPDNDIVLDDRRVSRRHAEVRLRLGKHTLYDLGSTNGTFVNGKKVNE-IALSEGDRITFGAATLIYH. 254
505 2.000e-30UniRef50_UPI0009C0FFD3 FHA domain-containing protein n=4 Tax=Mycobacterium fortuitum TaxID=1766 RepID=UPI0009C0FFD3  ali  25  22..................................AVRRTPQQLPTHTTAHLCAAPHAELGSAVLYVVRGPTSGAEFELAHPYTTAGRHHDSTVLLDHVTVSRRHAEFRWVDGHYWVIDTGSLNGVYVNQIRVESA-PLTNGDEIWIGAFDLTF.. 139
506 2.000e-30UniRef50_R5FNQ3 FHA domain-containing protein n=5 Tax=Eggerthellaceae TaxID=1643826 RepID=R5FNQ3_9ACTN  ali  24  45......................................................PNTSASTPTLTVLYGKQEGLVYQLTGDRATIGRSPQCDVFLNDMTVSREHALLERVGNDWSIRDTESFNGVWVNNTNVD-HVMLHDRDIIQIGCFVLRY.. 142
507 2.000e-30UniRef50_A0A2V8QF79 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8QF79_9BACT  ali  31  4........................................................PGKPHARLVIEKGRSSGKQFMLCDVESHIGRWPDVDLDTDDPEVSRRHARITLTNGQYFVEDLGSTNGTFINGKRLTQRQALCDGDEIIVGKTFLRFH. 113
508 2.000e-30UniRef50_A0A1C6N5I3 FOG: FHA domain n=3 Tax=Variovorax TaxID=34072 RepID=A0A1C6N5I3_9BURK  ali  29  1............................................................MARLLLMRKNSAPKQIELSGERTLIGRDASNDLQIDHPQVSRHHVELRVEGATTWVIDLGSRNGTLVNGRRVK-HWPLHHGDVVSIGDCSIRF.. 92
509 2.000e-30UniRef50_A0A1R4JZP7 FHA-domain-containing proteins n=1 Tax=Luteococcus japonicus LSP_Lj1 TaxID=1255658 RepID=A0A1R4JZP7_9ACTN  ali  35  31............................RLETDKPSPQRRGLRRRREDKKSQAVE-LPPVATRLVLTEGRGQGAVYPLD-GVMGLGRAHNSTVRIDDDFSSSRHAVLRPEDGSWLVEDLNSTNGTYVNAVKITQPTRVGPGDLIRIGRTQLRLEP 156
510 2.000e-30UniRef50_K2AQE0 FHA/GGDEF protein n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2AQE0_9ZZZZ  ali  25  16.......................................................AATQAEPYLIIVAGMHIGKTYSLAEGEIIAGRSPDCDIWIEDNTISRKHFRIRKSEGQCTIQDMNSTNGTFVNSKRLTKPVTLQASDKIQISDTIIQF.. 114
511 2.000e-30UniRef50_C7N632 FHA domain-containing protein n=2 Tax=Slackia TaxID=84108 RepID=C7N632_SLAHD  ali  24  28....................................GRTQAFTPIAMQPNDVTANAGLLNEATLRIVKGAQVGSIFHLSADTITMGRNPHCDIFLNDMTVSRNHAVFERRGSGYAIIDQGSFNGLWINHENVHEAV-LRDGDLIEVGAFILLYQ. 144
512 2.000e-30UniRef50_A0A2W5TAV6 Uncharacterized protein n=1 Tax=Archangium gephyra TaxID=48 RepID=A0A2W5TAV6_9DELT  ali  27  4..............................................................QLVIAEGKEAGREFEFDQASVLIGRTAECDVILYEAGVSRKHARIVIEEASFFIEDLGSSNGTKVNGSTISGKQSLKDGDAISMGPVVFNFKP 96
513 2.000e-30UniRef50_A0A2W5UY93 Uncharacterized protein n=1 Tax=Archangium gephyra TaxID=48 RepID=A0A2W5UY93_9DELT  ali  27  48..............................EEHIPTSIFDTEADQEMQAEY-GVSGTEYKPAFLYVERGPGAGQLLEVKQGTVVVGRASVSDLRLQHPSISRRHTQLKRQGEQFFVKDLGSQNGTFVNKQRIATEVEVKPGDSIALGNALLRLR. 170
514 2.000e-30UniRef50_A0A1F3XUK3 Uncharacterized protein n=4 Tax=unclassified Bdellovibrionales TaxID=404130 RepID=A0A1F3XUK3_9PROT  ali  30  43.............................................................ACLIIIRGTPQGHRFFLTQNEMTIGRDPAADITVADQSISRTHAKLTKEGSQVRLTDLGSSNGTHVNDKKVNDSVLLEKEDMIRIGSSILKFLP 138
515 2.000e-30UniRef50_A0A2N2JMJ1 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium HGW-Deltaproteobacteria-14 TaxID=2013741 RepID=A0A2N2JMJ1_9DELT  ali  33  117......................................................PGTKSCVGWLVALNGALKGQDFRIVDGKNMIGTAADADIVLTDQYMSSRHAVLRHEEGMFVLVDLDSTNGTYVNETRVSKE-ELIDNDRVRLGRTELKFK. 215
516 2.000e-30UniRef50_A0A2G6CPE1 GGDEF domain-containing protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2G6CPE1_9PROT  ali  25  13............................................TASPMASKKPEASKQRSACLIMLSGNNVGQVYRLRADETTIGRDDSSTIQLMDAGISRRHAKIRLSDGGYRLFDAGSRNGTFANNHRLEGAHELQDGDKVQVGMTILKF.. 123
517 2.000e-30UniRef50_A0A2H0P3U1 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_49_13 TaxID=1973976 RepID=A0A2H0P3U1_  ali  21  195...............................PEEDASRTPSESSIDITKKTAAETSTPSGAARLIIIEGGHVNQEYKLRK-ETTIGRANSNTIILKDGKVSRQHAVVKQTGNEYVMLDLNSSNGVIVNHERVKE-HVLSDGDQIAIGDHTLQFK. 315
518 2.000e-30UniRef50_A0A2S8F5L6 Histidine kinase n=1 Tax=Blastopirellula marina TaxID=124 RepID=A0A2S8F5L6_9PLAN  ali  26  41..................................................PSSRFPENSSLASLFVIQGDDQGRRFELSRDMISIGRDRGNEIVLHDTEISRRHAEIRTTKDGFMLVDLQSSNGCYVNQKRVSE-CQLTHGDRLQLGHTLMIF.. 142
519 2.000e-30UniRef50_C8W067 FHA domain-containing protein n=2 Tax=Desulfotomaculum acetoxidans TaxID=58138 RepID=C8W067_DESAS  ali  31  186.............................................................ACLQIKEGPDKTKFFQLTQDKFVIGRDQDCDIVLSDSSISRRHAVLEKTGKLYVIRDLNSTNGTFINGVKITEKI-IQPEDEIKLGTTI..... 273
520 2.000e-30UniRef50_UPI000A008D37 FHA domain-containing protein n=1 Tax=Nocardia vermiculata TaxID=257274 RepID=UPI000A008D37  ali  23  15..........YLLIFTSSYCINKYRRCRQTAPRPGPAPSTRGFEMTVHELVRQPPAPTGPTLVIEVTRGPCTGVRFPLRTGTTVIGSHPECDVVLPDTTVSRRHAAIHI-DGCAKLTDLGSLNGTYLN-RRVIDEAPLTAGDELCIGRFRTVVR. 156
521 2.000e-30UniRef50_F4H3W3 FHA domain containing protein n=46 Tax=Bacteria TaxID=2 RepID=F4H3W3_CELFA  ali  22  95.................YAFVGPVTVSFGEDAALETGRFRVHSATGAVAPAASTTAPTSRHPLLIVDD-----QRYILTGPVTVIGRGSEADIIVDDPGVSRRHLEIRVTPDGVIASDMGSTNGLYVEGHHVPAAT-LVDGNTLMIGRTRIQF.. 226
522 2.000e-30UniRef50_A0A1V5WHC4 FHA domain-containing protein FhaB n=2 Tax=Chloroflexi bacterium ADurb.Bin222 TaxID=1852858 RepID=A0A1V5WHC4_9CHLR  ali  36  40........................................................PRPAPALLRWQTAAGEEATLAL-GPVTGLGRADDNSLPLEDPFASAHHALIVWREGQWHIEDLGSHNGTYLNGERVSSNRVLTSGDEIQIGETRLRFE. 136
523 2.000e-30UniRef50_A0A0U3HS71 Cell division protein FtsK n=15 Tax=Actinobacteria TaxID=201174 RepID=A0A0U3HS71_9ACTN  ali  28  71..........................AQRCTLGEPPLIDGAVLAVGAPGEPEPHPELDAAPTRLHVVAGPDAGGVHLLHGGEIRIGRSADADVPLDDPDVSRLHCAVTVADGRVSVADLGSTNGTTLDGRAVARPVRLTPGALLRIGESALRLTP 201
524 2.000e-30UniRef50_A0A2E8GJ45 Uncharacterized protein n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A2E8GJ45_9ACTN  ali  35  20...................FFFRVIRAVWVGVRPARENLPKRNRFVRNDRPARV---------LVVRTPELGGQRHNLTE-ELTIGRAATCDVTIDDTYASQIHARVFRRDNDHVLEDLGSTNGTYLNRQKVASATNLKTGDHLQIGSTVFEV.. 144
525 3.000e-30UniRef50_A0A2U2SLY3 Uncharacterized protein n=1 Tax=Ardenticatenia bacterium TaxID=2099665 RepID=A0A2U2SLY3_9CHLR  ali  30  2........................................HRNGRPDWDDGSGFPMNEACVAMLILQEGSSPQRQWLLDAPEVLIGRGPDCRVVVNDRQASRHHARIACTQEGYILEDLGSKNGTYLNGQRLTQPVRLVDGDEIGIAAARLRF.. 115
526 3.000e-30UniRef50_H1QFL0 Uncharacterized protein (Fragment) n=4 Tax=Streptomyces TaxID=1883 RepID=H1QFL0_9ACTN  ali  28  83..........................AQRSTLGEPPLIDGAVLCLGAPGEPDPHAEPADVPAQLHVVAGPDAGGVHLLHGGQIRLGRSADADVALDDPDVSRMHCAVTVGPDRVSVADLGSTNGTTLDGARVGRPVRFAPGALLRIGESALRLVP 213
527 3.000e-30UniRef50_A0A2L0F9W3 Diguanylate cyclase n=12 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A2L0F9W3_SORCE  ali  32  4......................................FDEKTRVTQVVQPPPGGGSKNTTDCLVVIEPTLLGKRFVLEHNPTRVGRGADNHIVLDGDSVSRRHAHFEQRPSAWMVVDDGSTNGTYCNDEQISREVVLKNGDRVKIGPTIFKF.. 121
528 3.000e-30UniRef50_A0A1I3IWH4 Forkhead associated (FHA) domain, binds pSer, pThr, pTyr n=5 Tax=Bacteria TaxID=2 RepID=A0A1I3IWH4_9BACT  ali  43  74....................................................PVPATRDAVSRIVITSGPKAGLELPLGGEPLTIGRSSESGLVIRDDYTSSHHARLLLWGDKWMIQDLDSTNGTWHDGARVTTPVPIVVGAPIKVGATTFELR. 175
529 3.000e-30UniRef50_A0A1W9RHD2 Uncharacterized protein n=1 Tax=Candidatus Latescibacteria bacterium 4484_7 TaxID=1970771 RepID=A0A1W9RHD2_9BACT  ali  29  234..........................................................GRPPKLVVKLKNRPLKTYTLSGHKMSIGRLQDNDIVIDNLSVSRKHAVIESTRDGFVVSDLGSKNGTFVNGEKIDK-VHLSNGDVITIGKYDVVFQ. 328
530 3.000e-30UniRef50_A0A1W9UIW0 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium 4572_32.2 TaxID=1971624 RepID=A0A1W9UIW0_9CHLR  ali  34  97..............................................................MLVVQAGPGAGARYPFTQSTVVMGRSADCQVVINYPNVSLHHAQLAWDGRQFAVQDLDSTNGTFVNGHRITEPVLFRLGDVLSLGGTVLVLR. 189
531 3.000e-30UniRef50_UPI000DD9DA01 FHA domain-containing protein n=4 Tax=Ktedonobacteria TaxID=388447 RepID=UPI000DD9DA01  ali  26  515.....................................................DAQGRVVLASLTLQSGPLAGRSFRFHQDVTTIGRTNGNDFIIAGRTVSRRHARLWFDNGLWYLEDLQSANGTLVNGERIQQ-TVLRDGDLIQFGDERLIFH. 614
532 3.000e-30UniRef50_A0A0J0UT36 FHA domain-containing protein n=1 Tax=Actinobacteria bacterium IMCC26207 TaxID=1641811 RepID=A0A0J0UT36_9ACTN  ali  28  30.....................................PEVTELATGSYPIVGVDVAGAGEVGQLIITRGSTAGARFALTADVVTIGRDPKSIVFLDDITVSRNHAEVRRDDGQFQLIDSGSLNGTYLDGERVTQA-LLREGAQVQVGKFRFVF.. 145
533 3.000e-30UniRef50_A0A143X6B2 Transcriptional regulatory protein EmbR n=1 Tax=Clostridiales bacterium CHKCI006 TaxID=1780379 RepID=A0A143X6B2_9FIRM  ali  31  217..............................DAFHPSPILQEERSTYLSGQAT-TELSAANKTQLLVHYGNEDGQSIPLQAD-FHIGRESDNDLVLADANVSRHHARIYAKTDGLYLEDLASTNGTWLNEQPLEHAHHLQEGDRLRIGQTILIYH. 343
534 3.000e-30UniRef50_A0A2H0XX60 Uncharacterized protein n=1 Tax=Candidatus Marinimicrobia bacterium CG08_land_8_20_14_0_20_45_22 TaxID=1975524 RepID=A0A2H0XX60_9  ali  28  3...............................................................LIVEIGPNRGSVYKIGQKRTSIGRVPTNTIVFNDDKISRNHCVIEERDGRFFAKDLGSTNGTFVNNVKISD-TELHHGDMITVGSCVFRV.. 91
535 3.000e-30UniRef50_A0A2H0PKZ2 GGDEF domain-containing protein n=1 Tax=Deltaproteobacteria bacterium CG11_big_fil_rev_8_21_14_0_20_45_16 TaxID=1973974 RepID=A0A  ali  26  38..........................................................ERTPSLLMISGPQIGRSFPLNNEEFMIGRASNCDLPVEDDLVSRHHCKIVLSAEGAELIDLASTNGTLLNGRRVDRA-ELKEGDQIQVGSVILKFH. 134
536 3.000e-30UniRef50_A0A2V8MC06 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8MC06_9BACT  ali  26  119.....................GALARREPSLALANSSGAQPAVVSEQETSAPLAGGKRRPHATLAIERGSSAGKQFLLIEKDANIGRWPDVDLDSDDPEVSRRHARISLSDGQYLIEDLGSTNGTFVNGRRLANRYPIKDGDEIIVGKTFLRFR. 263
537 3.000e-30UniRef50_A0A1M3MZU0 Uncharacterized protein n=1 Tax=Myxococcales bacterium 68-20 TaxID=1895795 RepID=A0A1M3MZU0_9DELT  ali  27  2.................................................ALPGLTLPGKDRATLTVLAGINAGQVFALDGTDHVIGRGTEADIWVDDGGVSRRHARITRSDGRYFVEDLGSTNGTFVGPQRVD-ILEIRPGDRIQVGHVTLRFQ. 107
538 3.000e-30UniRef50_A0A2J6X359 DUF2662 domain-containing protein (Fragment) n=1 Tax=Chloroflexus aggregans TaxID=152260 RepID=A0A2J6X359_9CHLR  ali  22  1...........................LAEDPAVPRRSIQVVAEMGSNQVDQPQAAGRSSGAFLLLQTGDTS-QALPIATTMVSIGRGLDNDIILEDTRVSRKHAQLRYRQRRFWLTDLGSTNGTFVNGERIAERA-LRDGDVISLGGLELIFR. 134
539 3.000e-30UniRef50_A0A0J7YXW2 Cell division protein FtsK n=9 Tax=Streptomyces TaxID=1883 RepID=A0A0J7YXW2_STRVR  ali  29  67............................RSTLGEPPLIDGAVLSLGAPAAPEPHPELDDAPTQLQVVAGPDAGGVHLLHGGEIRIGRSAEADVPLDDPDVSRLHCAVTVADGRVSVADLGSTNGTTLDGTRVTRPVRFAPGALLRIGESALRLAP 195
540 3.000e-30UniRef50_D2PQK6 FHA domain containing protein n=3 Tax=Kribbella TaxID=182639 RepID=D2PQK6_KRIFD  ali  35  37...............................VDSRALAGAVPAAGRTPKPAKPVKKKKGLPGSVTIADGPQAGVGAALGDEPVVIGRGSDCQIRLDDDYSSTRHARVFQSEGQWWVEDLGSTNGTYLDGQRVTRPVPAEIGGSIRIGRTTL.... 156
541 3.000e-30UniRef50_D5BZU0 Stage II sporulation E family protein n=1 Tax=Nitrosococcus halophilus (strain Nc4) TaxID=472759 RepID=D5BZU0_NITHN  ali  24  1............................................................MACLQTLCGFKFHKSYPISGERTVLGRHSDCSIVFDDKTVSRHHAQILQIDQKYYLEDLNSSNGTYVNGQQIQGRHRLQENDQVTMGDISVVFH. 94
542 3.000e-30UniRef50_UPI000D6AE769 FHA domain-containing protein n=1 Tax=Pleionea mediterranea TaxID=523701 RepID=UPI000D6AE769  ali  28  1............................................................MAYLVLMTEGQNGPRFSLDKMSLSIGRSPECDIHLDDPSVSFEHAELMLADDEVWINDVNSTNGTFVNNQKVNKAM-LKDNDNINIGLSNFRFH. 96
543 3.000e-30UniRef50_A0A117RNV3 Cell division protein FtsK n=2 Tax=Streptomyces TaxID=1883 RepID=A0A117RNV3_9ACTN  ali  29  67............................RSTLGEPPLTDGAMLSLGAPAAPEPHPELDDAPTQLQVVAGPDAGGVHLLHGGEIRIGRSAEADVPLDDPDVSRLHCAVTVSDGRVSVADLGSTNGTTLDGTRVTRPVRFAPGALLRIGESALRLAP 195
544 3.000e-30UniRef50_A0A1F8TCT6 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_19FT_COMBO_56_12 TaxID=1797670 RepID=A0A1F8TCT6_9CHLR  ali  28  3..........................................................TPAYQLVMRKGPTPGLVFDLVRSDITIGRDMTNDFVINDVEISRRHAVLRLEAGSYVVEDQGSTNGTFINGVRLMGPHSLSVGELITFGENVLIFE. 99
545 3.000e-30UniRef50_A0A1H5NJT6 FtsK/SpoIIIE family protein n=2 Tax=Streptomyces TaxID=1883 RepID=A0A1H5NJT6_9ACTN  ali  27  73..........................ARRRILGEPPLVDGAVLSLGAPAAPEPHPELDDAPTQLHVIAGPDAGGVHLLHGGQITIGRSAEADVPLDDPDVSRLHCAVTVADGRVSVADLHSTNGTALDGTRVTRPVRLTPGSLLRIGESALRLTP 203
546 4.000e-30UniRef50_A0A2E3RDU2 Protein serine phosphatase n=3 Tax=unclassified Planctomycetaceae TaxID=69476 RepID=A0A2E3RDU2_9PLAN  ali  24  2...........................................................PAGSLIITVGPAMGQKFELNRPKMVMGRHPDCEIKIDAGAVSRQHAQIIIADDNFYVEDLQSRNGTFVNDKRIDGRQILRHADSLRICDVGFRFE. 96
547 4.000e-30UniRef50_A0A0H4WZ57 Adenylate cyclase n=21 Tax=Cystobacterineae TaxID=80811 RepID=A0A0H4WZ57_9DELT  ali  31  1...........................................................MPFQLTISEGREAGKEFVFDQDSVLIGRSTDCDVALFDPGVSRRHCRIFLDGDAYAVEDQGSANGSLINGSPVKTQV-LEDGDKLTLGPVTFVF.. 93
548 4.000e-30UniRef50_A0A2T2RJD6 Uncharacterized protein (Fragment) n=1 Tax=Actinobacteria bacterium QS_5_72_10 TaxID=1919085 RepID=A0A2T2RJD6_9ACTN  ali  29  177.......................................VDTRMEVTQPTVVGPAKRLTPLPSLVVTEGPLQGHSFSLDGDELVVGRREHSDVHMPDPHVSRTHAVIRKHSGAVWIEDLGSTGGTWVNDQQVAGARALRHGDQVRFGAVTTRFE. 292
549 4.000e-30UniRef50_A0A2P8AQT2 FHA domain-containing protein FhaA n=131 Tax=Actinobacteria TaxID=201174 RepID=A0A2P8AQT2_9ACTN  ali  27  94.................WTVYGDVIVEVERGEGLDTGMFRVTAEVGEVAPVSAPGGYDAGPAYVRLVSGD--GRTYPLQMGSTVIGRGDQANLRLPDVGISRRHARLDFDGGQVVLTDLGSTNGTMVNGQRV-SAVALNPGDMIQLGTTTLTFR. 250
550 4.000e-30UniRef50_UPI00068622B3 GGDEF domain-containing protein n=1 Tax=Methylocaldum szegediense TaxID=73780 RepID=UPI00068622B3  ali  24  30.............................................................ACLIMIRGPQVGRRVVLDKDEIVLGRSKNADVQIEESCVSRQHAVIKREASTFIIIDQNSTNGTFVNERRVT--CVLRDQDLITIGNTIFKF.. 120
551 4.000e-30UniRef50_UPI000B3BB8BA DUF2662 domain-containing protein n=1 Tax=Brachybacterium massiliense TaxID=1755098 RepID=UPI000B3BB8BA  ali  23  93.................YMFVGAVSVDLEQDDEVRAGRFETESRTERGSVAPATGAAASGAGGSPIIE--IDGQQYLLTGPVTVIGRGGDADIILEDTGVSRHHLELRAEEDGTLITDLGSTNGTFVDGERIRTPVTLHDRSLLKIGRTRLTV.. 227
552 4.000e-30UniRef50_UPI00069BBD87 FHA domain-containing protein n=4 Tax=Streptomyces TaxID=1883 RepID=UPI00069BBD87  ali  26  71...........................QRAALGEPPLIDGAVLSLQSPGPA-PAHGLPAGPARLRVVSGPDAGGVHLLHGGQIRIGRSADADVPLDDPDVSRMHCSVTVADGAVTVADLHSTNGTAVDGTEIDDPAPLPPGALLRIGESALRLQP 199
553 4.000e-30UniRef50_UPI0009DDD3BF FHA domain-containing protein n=1 Tax=Amycolatopsis orientalis TaxID=31958 RepID=UPI0009DDD3BF  ali  26  56.............................PDPLAHTSRTVSAPVPRPSEETRAAPVIPRSGATLNIVRGPGIQETIELTKDTTVVGRHPSSDVVLNDPTVSRHHIELRRSGGEVVIADLGSLNGTYVNRIPMDRRV-LADGDMVWVGRYRLLFR. 181
554 4.000e-30UniRef50_A0A1L2ZPN0 Uncharacterized protein n=1 Tax=Neomicrococcus aestuarii TaxID=556325 RepID=A0A1L2ZPN0_9MICC  ali  25  180.............................................TSVPPPQRPAEAPRTQPVIEV-----NGKRFAINASAIVIGRSKEADITVDDSRVSRKHIEIFRDANGIFVEDLGSTNGTSVNGYRIDGPEELLDGTHIMIGSTRINFR. 283
555 4.000e-30UniRef50_E1IC36 FHA domain containing protein n=2 Tax=Chloroflexi TaxID=200795 RepID=E1IC36_9CHLR  ali  31  1...........................................................MPLQIVALSGPLAGRTFALGSGPLSFGRTPENTIVISSPLASRRHAELRFEGGGYVLYDLNSSNGTLLNGQRVQ-VQRMRPGDVITIGDESFRF.. 93
556 4.000e-30UniRef50_A0A2E1DLX5 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2E1DLX5_9ACTN  ali  35  15..............GLCYLFFLRVLRAVWIETREVKKKKIKTKS------------------QLVVTN-SLTGRNFEI-AGEITIGRAEGCTITIDDDFVSQAHARVFEKADEVIVEDLGSTNGTYLNKQRVSSPMVVNTGDWLQLGDTIMELK. 136
557 4.000e-30UniRef50_A0A0K1F8I7 Uncharacterized protein n=2 Tax=Micrococcales TaxID=85006 RepID=A0A0K1F8I7_9MICO  ali  27  207............................ARDYLDDEGLGATQVQQPVQPPEQRPRLDPTRRPWLDI-----DGDRYPLLGAITVIGRDGVADIVLDDPGISRRHAEIRVHHDGPHIRDLGSTNGTFVEGHRVTS-QRLADGDRVTIGRTSFTFR. 330
558 4.000e-30UniRef50_A0A2E3JBR7 Uncharacterized protein n=1 Tax=Acidimicrobiaceae bacterium TaxID=2024894 RepID=A0A2E3JBR7_9ACTN  ali  27  93.................YLFLGTLVIHIESKSEYRNGLFQIVSDFTENKNGLPPGA--------VVING---GERILLKESNVILGRAEDAFIQIHDPEASRNHAEIRLTGRNFIISDLGSTNGTIVNGNRISE-HILHDYDTITIGKTSLRFE. 217
559 4.000e-30UniRef50_M5RX72 FHA/GGDEF domain-containing protein n=2 Tax=Rhodopirellula europaea TaxID=1263866 RepID=M5RX72_9PLAN  ali  25  20..........................ALTATAINAAQSNHDVAEATLRQQTTTQPQSVQNECCLVQIYPPDVEGMMLLEQDEFHIGRSPDSDLPLLDGSVSRQHALLFRDHDGYAVRDLGSTNGTIVNESTIDSDRYLKSGDTVRIGSFLFRF.. 147
560 4.000e-30UniRef50_A0A0Q9J0M8 Uncharacterized protein n=2 Tax=Agromyces sp. Soil535 TaxID=1736390 RepID=A0A0Q9J0M8_9MICO  ali  37  2.....................................................TGSDAATLPSLVVVEGRRTGERIAIPDGRWIIGRDVGSDIVLDDAGVSRRHAALTLEGGEAMIEDLGSTNGTRVNGVRLESGRRLVSGDEVRLGAAAVRFE. 102
561 4.000e-30UniRef50_A0A1G0ZMV5 Uncharacterized protein n=1 Tax=Lentisphaerae bacterium RIFOXYC12_FULL_60_16 TaxID=1798582 RepID=A0A1G0ZMV5_9BACT  ali  20  10......................KVVRKQPTSTRDVRNTQALSSTMPIPVQELYDEVASRHECNIRMEIPNHPPRLIRLDKEPLTLGRDSGCDIILNITNVSRQHARILCNEEEYQIEDLDSTNGTFVNNVRIRRCV-LRDQDQIRIGEARLLFQ. 140
562 4.000e-30UniRef50_L1L272 FtsK/SpoIIIE family protein n=5 Tax=Streptomyces TaxID=1883 RepID=L1L272_9ACTN  ali  32  84....................................PPLIDGAVLSLGAPSEPGPEVDEAAAQLHVVAGPDAGGVHLLHGGKIHIGRSADADVPLDDPDVSRLHCAVTLSDGRVSVVDLGSTNGTTLDGHRVTRPVRLAPGALLRIGESALRL.. 202
563 4.000e-30UniRef50_A0A2V7UXH2 Uncharacterized protein n=2 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7UXH2_9BACT  ali  26  160...................................GRPMAEFNVLTAGDIQSPAFPAWRPMAELKIQTADGSKERFPLSKPRVTIGRARSSDVFLPDQWLSRHHAAIEQRNGAYYILDLGSKNGTLLNGDRVSGDRRLRDGDIITLGEHVLIF.. 277
564 4.000e-30UniRef50_A0A2P1PVR2 Uncharacterized protein n=1 Tax=Ahniella affigens TaxID=2021234 RepID=A0A2P1PVR2_9GAMM  ali  30  21....................................QQRIRQPMTDPTQTLDALPQRHAAQPCLVVLTGSRKGHAFWLEQPRVVIGRADDATIQIDDVSVSRYHAELNRGQDTWLLKDLDSKNGSFLGDRPLTVESPIRDGDLCRFGTVALQF.. 137
565 4.000e-30UniRef50_A0A1M4UCT0 Forkhead associated (FHA) domain, binds pSer, pThr, pTyr n=1 Tax=Ferrithrix thermotolerans DSM 19514 TaxID=1121881 RepID=A0A1M4UC  ali  32  80..............................................................RLLALEGPFQGREFRL-KEETVIGRSEGCDIALDDNFASSKHAKIERRDDGFWITDLGSTNGTVVNSLRVSVPIQLMKGDLVKIGKSLFVVQP 173
566 4.000e-30UniRef50_A0A1F5BT78 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=A0A1F5BT78_9BACT  ali  26  36.........................................................PQGKSGLVIIKGPNIGDKFLINKQELSIGRNPASDIFLDDITVSRKHAVIIKSGKDFRIKDSESLNGSYLNG-KIVENAILKDMDRIQIGKYIFLF.. 130
567 5.000e-30UniRef50_UPI00098A816F GGDEF domain-containing protein n=1 Tax=Methylocaldum TaxID=73778 RepID=UPI00098A816F  ali  23  17.......................................ETSPDETTRPSATQWSERKSGRACLIMIRGPHVGKRIVLNKDEMVIGRSKSADAQIDESSVSRKHAVIRKRGSEFIIEDQNSKNGTLVNMEK-QMLCVLRDQDLITFGNTLFKF.. 133
568 5.000e-30UniRef50_A0A2V9JLX4 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V9JLX4_9BACT  ali  26  1...........................................................MEPRLVGVAGSLKGEVFPLTGEELSLGRDASNRVRIIDRSVSRHHCVLRVAEGRYRICDLDSRNGTFVNNLPVRERA-LEHGDRIRIGDFVFLLHP 97
569 5.000e-30UniRef50_A0A0F9BXI9 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9BXI9_9ZZZZ  ali  33  1............................................................MASIEVIQGPETGRTVQIAGDEVILGR-EGNPLRLTDGTVSRQHARLSCTDDTWSIQDVGSVNGTFVNGTKISKSVELNIGDQIRCGRTLLVF.. 92
570 5.000e-30UniRef50_S2X126 Uncharacterized protein n=80 Tax=Terrabacteria group TaxID=1783272 RepID=S2X126_9ACTN  ali  24  94.................YVFNGPIKIEYECDDKLSVGQFNVKSQSVATVAESDGPASERAPLVLEV-----NGVRHPLTPPGFTIGRGSEADLRINDPGISRLHARISCEDDKITIQDLNSTNGVIVNGERVTS-TELGDGSRIEIGKTRMLVH. 232
571 5.000e-30UniRef50_A0A2M7T6Y4 Uncharacterized protein n=2 Tax=unclassified Actinobacteria TaxID=1752188 RepID=A0A2M7T6Y4_9ACTN  ali  33  43......................................................GAATEKLPRIVIVEGAEPGAAYPIDE-QLIIGRSPDCDIILEDTFASAHHARVYPANSAYWLEDLKSTNGTTTNNKQINAPVRLKKGSTFRIGQSVFKF.. 142
572 5.000e-30UniRef50_A0A1C0AL17 Uncharacterized protein n=2 Tax=Propionibacteriales TaxID=85009 RepID=A0A1C0AL17_9ACTN  ali  32  94.................YVFNGPVTIDYELDTSLPTGQFTVTSQAVSVDTGAAAPAPEPRPGRLVLE---VNGVRHPLVAPGLLIGRGAEADLRLNDPGVSRRHAMLTVSGDVVTIEDLGSTNGVHVNGNRVTK-TRVGEGTRIEIGSTRMLIH. 232
573 5.000e-30UniRef50_A0A2V8TE34 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8TE34_9BACT  ali  34  4..........................................AERTIKLDLREVPQSNTKRPVLVVLQGNSLGQTIKLEKDRTTLGRGSQADLVLRDEIASRQHAEIIREGNEYYVNDLDSTNGTFLNGAKVTSQQLLQDGDKIKIGDHLMKY.. 119
574 5.000e-30UniRef50_A0A0G3A177 FHA domain containing protein n=7 Tax=Archangiaceae TaxID=39 RepID=A0A0G3A177_9DELT  ali  30  72........................................RDRELPTRFDSGEYEDPGHTPAFLYVERGPGVGQLLPVKQGVLVLGRASNSDLRLQHPSISRRHAQLTRRGDHLTLKDLGSQNGTYVNRTRLSGEVELRSGDELALGNALLQLR. 185
575 5.000e-30UniRef50_A0A2E0MBS5 Uncharacterized protein n=19 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2E0MBS5_9CHLR  ali  33  31.................................................................VTEGPLAGSRXLLDXEISTLGRHPKXDLFFDDITVSRRHAEVKVSANTAXVRDVGSLNGTYVNMSQIDEETEISPGDTLQIGKFKLVF.. 118
576 5.000e-30UniRef50_A0A1V5GZA0 FHA domain-containing protein FhaB n=1 Tax=Lentisphaerae bacterium ADurb.BinA184 TaxID=1852901 RepID=A0A1V5GZA0_9BACT  ali  32  1............................................................MSKLVCTKGSNKGDEFAIHEGTTVIGRGNECGILLFDQKCSRAHCQIIRKGRHYAVEDLDSRNGTLLNDKRIKSAISLSVGDQIRIGKTVLLF.. 95
577 5.000e-30UniRef50_UPI000BE38048 FHA domain-containing protein n=1 Tax=Clostridium peptidivorans TaxID=100174 RepID=UPI000BE38048  ali  29  126.............................................................AFLVQLNGTKRGTNYEIKPGESHIGRSDENDIVLDDMYVSGNHAIIKQQEDKMYIYDLNSKNGVFVNGDKIEEAKELNNNDTVIIGETKLRF.. 217
578 5.000e-30UniRef50_D6U5V9 Serine/threonine protein kinase with FHA domain n=4 Tax=Ktedonobacter TaxID=363276 RepID=D6U5V9_9CHLR  ali  24  368....................................................TDASGRPVLARLTLQSGPLAGRSYRFHQDVTKIGRTNGCDLVISGRTVSRHHARLWFAEGRWFLADLNSVNGTTVNNIRIQQPVVLNDGDVIHFGDEGVVF.. 468
579 5.000e-30UniRef50_A0A1V5SWR7 Response regulator PleD n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5SWR7_9BACT  ali  25  17...................................TAPEEELSERTVVTSIEKVSIPVDEKAYILFISGPLIGKMYLLEDEVTIIGRAPDIDISISDSRISRRHLEISLREGRAVIKDLDSTNGTFVNGKRVATKV-LENGDKIHISDTFFKF.. 134
580 5.000e-30UniRef50_A0A1S8C5S5 Uncharacterized protein (Fragment) n=1 Tax=Modestobacter sp. VKM Ac-2676 TaxID=1678130 RepID=A0A1S8C5S5_9ACTN  ali  27  1.........................................GPSDTGTPDAGAVGRAGQRTSHVLVVDGP--GTKHVLEQGSNVLGRGTDADVRLPDTGVSRKHADVQLTGSRVAVEDLGSTNGTLVNGRRVSR-QELADGDVIRIGHSVLVYR. 110
581 5.000e-30UniRef50_A0A172X6B2 FHA domain-containing protein n=18 Tax=Actinobacteria TaxID=201174 RepID=A0A172X6B2_9MICO  ali  40  78....................................AAPVSSLPSGANRASTHTNASVQTARRLVITSGPRAGTELPLGRDPITIGRSSESNLVIRDDYTSTHHARLLLWNDEWMIQDLDSTNGTFLDGRRVTVPTQVPLDTPIKIGTTTFELR. 195
582 6.000e-30UniRef50_A0A1W9WEE3 Uncharacterized protein n=1 Tax=Anaerolineaceae bacterium 4572_78 TaxID=1972460 RepID=A0A1W9WEE3_9CHLR  ali  23  11.......................................................ESQHTQACLVVKQGSQIGMVFPIANEITVVGREPTCNVILHDLEVSRRHFQIVLKDKQFIIQDLGSTNKTFVNQTELIESRPMNYGDTISLGQTILMF.. 108
583 6.000e-30UniRef50_A0A1G8DH96 FHA domain-containing protein (Fragment) n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1G8DH96_9PSEU  ali  28  112................................................APPATQGGNRQLNATLHLDDGSN--RTYNLKQGGNVVGRGQEADFRLPDTGVSRRHLEISWDGQNAMLADLGSTNGTTVNGTPVQT-WQLAEGDVVRIGHSSLVFR. 214
584 6.000e-30UniRef50_A0A2T4V6P3 Nuclease PIN n=1 Tax=Vitiosangium sp. GDMCC 1.1324 TaxID=2138576 RepID=A0A2T4V6P3_9DELT  ali  29  67...................................SPREPRDRELPARFDSGEYEDPGHSPAFLYVERGPGAGQLLPIKQGVLVLGRASTSDLRLQHPSISRRHAQLTRRGDRLSLKDLGSQNGTYINRARLTSELDIRSGDEIALGNALLRVR. 185
585 6.000e-30UniRef50_M5TU79 Protein serine phosphatase with GAF(S) sensor(S) n=17 Tax=Planctomycetaceae TaxID=126 RepID=M5TU79_9PLAN  ali  30  15..........................................................................QFELDRDEMRIGRHPECDIVVDAGAVSRYHAKLNHVGGAWIVEDLGSRNGTFVNGQLLTRPHSLAQGDRIRISEVELLFH. 94
586 6.000e-30UniRef50_W9G4K7 Signal peptide protein (Fragment) n=2 Tax=Micrococcales TaxID=85006 RepID=W9G4K7_9MICO  ali  23  1...................................PVPAAQATAVDHPAPPRPPRTNPAARPWLDI-----AGDRYPLLGSLTIIGRDEGADIVVDDAGVSRRHSEIRVTNDGPHIRDLNSTNGTFVNGDRITS-QRLEDGDRITLGRTSATFR. 117
587 6.000e-30UniRef50_A0A1I1JGQ2 DNA-binding transcriptional activator of the SARP family n=1 Tax=Nocardioides terrae TaxID=574651 RepID=A0A1I1JGQ2_9ACTN  ali  28  246..........................VLRQDPRLDPLPALRSLSPRVLTRTTLVDSGGSLRAPAVIGPG---GQRLVLDAGPVVVGRHGDCDLVVDDDQASRRHAEIVWSGAGYLVKDLGSTNGTYVNGRRLDRPHLLSGGDRIEVGATVVRF.. 370
588 6.000e-30UniRef50_A0A2E0SLG9 Uncharacterized protein n=1 Tax=Planctomyces sp. TaxID=37635 RepID=A0A2E0SLG9_9PLAN  ali  21  1............................................................MPELLIKSGKHQGKRLVLPQAEVILGRDPSCQIRISSEDVSRQHCKLVITEEGVLARDLNSQNGTFINDVPLEGEALLNPGDEIRVGPMIFQ... 92
589 6.000e-30UniRef50_A0A2A2R276 Uncharacterized protein n=1 Tax=Verrucomicrobia bacterium Tous-C9LFEB TaxID=1982333 RepID=A0A2A2R276_9BACT  ali  26  1............................................................MPRLIVQSQEFAGKVFELSGPTLSIGRLPDNALHIDHNSVSGHHAEILLDDKDYKVKDLDSTNGTRVNGERIAE-QKLRRNDIVRFGNIELLY.. 92
590 6.000e-30UniRef50_S2W1S1 Uncharacterized protein n=3 Tax=Propionimicrobium TaxID=203133 RepID=S2W1S1_9ACTN  ali  31  35........................RKVSAEELASESAAAERTSKRQERRKLRKERKDAKAAARIVVTDGPNAGIWAPLPTGAVLLGRSNNATIDIMDDYASSRHARVYDHDGVWVIEDLKSTNGTYVNGQQIVAPTIISPEDSIRIGRTHLALE. 170
591 7.000e-30UniRef50_B5WW81 FHA domain containing protein (Fragment) n=1 Tax=Burkholderia sp. H160 TaxID=516466 RepID=B5WW81_9BURK  ali  27  65..........................VLVPPPDETRPPEPKQQRQATRIGVLFPPPSPGRPAALLVNEGAGATNSYAIEKPNVRIGADEANDLIVRDYYVSRKHANIRFESGTLYLSDLGSSNGTFLNGARVKRVMTLSPGDQIRFGHTTWEVR. 193
592 7.000e-30UniRef50_A6CF81 Uncharacterized protein (Fragment) n=1 Tax=Gimesia maris DSM 8797 TaxID=344747 RepID=A6CF81_9PLAN  ali  28  7..............................................................SLKVVGGRHDGKQIPINGKKFLIGREEDCHLRPNSDMVSRHHCVFTVDEYSVRLRDFGSTNGTMVNGKRIKGEVQLSHGDQIQIGKLEFIIQ. 98
593 7.000e-30UniRef50_C7M1L3 FHA domain containing protein n=1 Tax=Acidimicrobium ferrooxidans (strain DSM 10331 / JCM 15462 / NBRC 103882 / ICP) TaxID=525909 Rep  ali  27  28....................VWRETRRAQRTPASVNARPVVASAEAHQTAARVTPSGGPKTGALVVVAGPLEGRRLELATPA-TIGRDASCDLTLDDRFVSGHHAEVVKEGRRIIVRDLGSTNGTFVNGERVEGSMRVTRGDVLQVGQSAFRV.. 168
594 7.000e-30UniRef50_A0A2V7YMS6 Uncharacterized protein (Fragment) n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V7YMS6_9BACT  ali  27  4.........................................................AAPLAEVTIYSPLASPTRQQLNGEMASIGRASDCTIPIKDRYLSRKHAEIAPVNGAWVLKDCGSANGTFLNGMRVERDRPLHTGDRIRLGDTEIVFE. 100
595 7.000e-30UniRef50_A0A202DGV4 Uncharacterized protein n=1 Tax=bacterium E08(2017) TaxID=1932693 RepID=A0A202DGV4_9BACT  ali  25  1............................................................MAFLQIISGDNKGQKFEIDRDRVVIGRSHDNLIAIDSPSVSGSHCEIVRDGRKFTLRDLDSTNGTRLNEVKIRE-YRLSPKDIITVGDIQIKF.. 92
596 7.000e-30UniRef50_A1R0V3 Putative FHA domain protein n=59 Tax=Micrococcaceae TaxID=1268 RepID=A1R0V3_PAEAT  ali  24  94.................YTLQGAVRISFRRNDEERAGHFEDAAPQAPRAHVPAAPARKPTRLQPVLDIG---GQRYSLNALSVVLGRSSEADILVDDTGVSRKHLEVRTENGSTWAVDLGSTNGSYVNGHKVNGSVELTDGSTITMGRTKIIFR. 237
597 7.000e-30UniRef50_A0A2B8AWQ6 Uncharacterized protein (Fragment) n=1 Tax=Streptomyces sp. Ru87 TaxID=2044307 RepID=A0A2B8AWQ6_9ACTN  ali  30  148.........................................APVEPGSHPGVAQEPASDAAARLHVAAGPDAGGVHLLHGGRVRIGRSADADVPLDDPDVSRLHCAVTVDDGAVTVADLGSTNGTSLDGAPVDRPRPFGPGAQLRIGESVLRLE. 262
598 7.000e-30UniRef50_A0A1F8TK07 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_19FT_COMBO_62_14 TaxID=1797671 RepID=A0A1F8TK07_9CHLR  ali  33  34.................................................RAAVAPRASAPSASLIVLEGASIGMVYPL-REVNLVGRAADSTLRIKDKTISAHHARLSFHAGQWWLEDLGSRNGSRVNEVHVSEPMVVTYGDRIALGEMLFRFQ. 137
599 7.000e-30UniRef50_D1NW61 FHA domain protein n=1 Tax=Bifidobacterium gallicum DSM 20093 = LMG 11596 TaxID=561180 RepID=D1NW61_9BIFI  ali  40  302................................................AADRSAQQAAFRPTLLVIIDGPLAGSSIPLNDAPVTLGRAASNSLVLDDEFVSSHHARVYPDPGVWAVEDLHSTNGTVVNQQRITTPTILGPRVPVRIGATTFELR. 409
600 7.000e-30UniRef50_UPI000373D08C DUF2662 domain-containing protein n=1 Tax=Sporomusaceae TaxID=1843490 RepID=UPI000373D08C  ali  25  113....................IFKVIVQKAPKAEAQEEEGCTRVFQALSGEALAPRKNASSFASLCIHEGPGAGKRYLCADGRVNMGRREQNEIPLEDRNASRLHAYVQWEDNRHILYDAKSLNGTFVNGHRIMRQV-LEPDDLVRIGHTVLRYE. 246
601 7.000e-30UniRef50_A0A1E9HLK4 Uncharacterized protein n=1 Tax=Brevibacterium sp. HMSC063G07 TaxID=1739261 RepID=A0A1E9HLK4_9MICO  ali  41  54..................................PQSTPAAAPSASGGAVQPGDQVTTAHYAQLVFTSGALQGRVISLNGQPVTMGRAGGNDVVLHDDFASGVHARVVADNGLWYVEDLGSTNGTFVGDRRLHGAVPLPAFTPVRIGNTTMELQ. 173
602 7.000e-30UniRef50_A0A1I2JLF1 FHA domain-containing protein n=17 Tax=Microbacteriaceae TaxID=85023 RepID=A0A1I2JLF1_9MICO  ali  36  34....................FGQRVRTIPTDPKAGASGPTTXXXXXXXXXXXXSAGATPAATRLVITEGSREGMEMPLGGGPITIGRSSESNVVIRDDYTSTNHARLDLRADGWLLTDLESTNGTFVNGQKVTVPVIIAERTPITIGTTTFELR. 182
603 7.000e-30UniRef50_A0A2D9TGG8 Uncharacterized protein n=1 Tax=Sandaracinus sp. TaxID=2024858 RepID=A0A2D9TGG8_9DELT  ali  29  38............................KKDQLDVTATLPLDDTDSLRRQVLSSAIAEARRPMLVVVVGADVGQRARLADG-FTIGRIPGQDMMIADPRVSSRHCRIEDRGDDWVIVDLGSTNGIRVNGERVQEKA-LQPFDKVELGDTMLRFE. 161
604 7.000e-30UniRef50_A0A0D8FWB4 FHA domain-containing protein FhaB n=1 Tax=Ferrimicrobium acidiphilum DSM 19497 TaxID=1121877 RepID=A0A0D8FWB4_9ACTN  ali  27  28....................VWRETRRQARTTVSTNLVAVPINEPTSNAIAVGTHKQKGSGKVL-VLEGPYSGKTFTF-ETPALVGRDSGCSIVLEDTFVSQRHAEIYLDRRHIIVADLGSRNGTFVNGDQIDAPMRVTKGDVIQLGKTALKV.. 159
605 8.000e-30UniRef50_F8CDW6 FHA domain-containing protein n=1 Tax=Myxococcus fulvus (strain ATCC BAA-855 / HW-1) TaxID=483219 RepID=F8CDW6_MYXFH  ali  31  1...........................................................MPFQLTISEGREAGKEFVFDQDSVLIGRSTDCDVALFDPGVSRRHCRIFLDGDAYSVEDQGSANGSLVNGSPVKTQV-LEDGDKLTLGPVTFIF.. 93
606 8.000e-30UniRef50_A0A1I4VLD0 Diguanylate cyclase (GGDEF) domain-containing protein n=2 Tax=Dokdonella immobilis TaxID=578942 RepID=A0A1I4VLD0_9GAMM  ali  26  3..................................................PLRRAGAGEVPACLVVLQGQRLGQRIDLGESALVIGRAPEADFQIVERSISRAHCRITREPAGYRIKDLDSTNKTFLNDQPIIEA-ELKDGDHIAVGSCVLKF.. 104
607 8.000e-30UniRef50_D0LIN2 Diguanylate cyclase n=2 Tax=Haliangium ochraceum TaxID=80816 RepID=D0LIN2_HALO1  ali  28  12..........................................SGVSLRPNTPRDDSFARDRPCLVVISGSNIGQMFHLDSGEVVIGRSRQATIQLTDEGISRKHTSIRVDDRQFWLHDLGSRNGTYCNGQRVH-ARRLRDGDKIQLGRVMLRF.. 125
608 8.000e-30UniRef50_UPI000C069919 FHA domain-containing protein n=1 Tax=Actinomyces minihominis TaxID=2002838 RepID=UPI000C069919  ali  36  33....................IYGTVVTRRGSGRAASEDKKKSAKKERKAALSRQPS------KLMITDGPLTGTLIPLGTAPITIGRSPSSTLVLDDPYVSTRHAELRQLDGEWTLIDLGSTNGTFVEDERVFQPIILTTGVSARIGQTSFEL.. 159
609 8.000e-30UniRef50_A0A2G4FZ75 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2G4FZ75_9ACTN  ali  24  35...........................................AEPDRKVVREIESGNGEKAMILIYRGTNKGGRFLITEEETNIGRSPSSAIFLDDVTVSRLHATIERDGAGFLLRDSVSLNGTYLNNRSVTKEH-LQSGDEIQIGRFHLLF.. 143
610 8.000e-30UniRef50_Q08SI1 FHA domain protein n=20 Tax=Cystobacterineae TaxID=80811 RepID=Q08SI1_STIAD  ali  26  158........................................................LPSSAATLTCLTGLDAGRIFPLADAQTDIGRGAHADLPIRDRTVSRAHARILRDGPTFTVSPLNSQNGVFLNGQRVDRAQPLGEGDVIELGQTLLRFQ. 255
611 8.000e-30UniRef50_A0A1F8M2B7 Uncharacterized protein n=5 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8M2B7_9CHLR  ali  31  2.........................................................AGAQYRLVMRQGPIPGQIFELDRREITIGRDITNEIVINDAEVSRKHARLTLEGDRYKIEDLDSTNGTYIDGQRLIGPHVMAVGEIIMFGD....... 92
612 8.000e-30UniRef50_A0A2G7EYM2 FtsK/SpoIIIE family protein n=4 Tax=Streptomyces TaxID=1883 RepID=A0A2G7EYM2_9ACTN  ali  27  73............................RSTLGEPPLIDGAVLSLGAPAEPEPHPELDDAPTQLHVIAGPDAGGVHLLHGGEIRIGRSADADVPLDDPDVSRLHCAVTVADGRVSVADLDSTNGTTLDGTRLTRPVRFTPGALLRIGESALRVAP 201
613 8.000e-30UniRef50_A0A136P793 Putative winged helix family two component transcriptional regulator n=1 Tax=Chloroflexi bacterium OLB13 TaxID=1617414 RepID=A0A1  ali  26  8..............................................................RLVQRRGPQPNTVYELTKEVHSLGRDIANDIVINDAEVSRHHLRFQRGVDGFTIADLGSTNGTFINGQRLVGSRPLNHGDTVSLGETV..... 95