current user: public
If you have questions about the server, please let us know.

Query: gi|77358701|ref|YP_338286.1| pilS cassette (NMB0021) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MVEGQKSAVTEYYLNHGEWPGDNSSAGVATSSEIKGKYVKSVEVKNGVVTAQMASSNVNNEIKGKKLSLWAKRQNGSVKWFCGQPVTRDKAKDDAVTAATGKGTANINTKHLPSTAPTRKSTPNLast
1 -12.100IDP01460 fimbrial protein VC2423 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  65.ITALKTNIEDYIATEGSFPATTAGTALGTVEDMGDGKIVIAPTASGALGGTIKYTFDAGVVSSSKIQLARDANG---LWTCS---------------------TTVTSEIAPKGCTAGATIN. 167
2 -8.850IDP02679 Type IV pili fiber building block protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0889c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  47IIGNVKASIQNDINNNLDISQQTYDTP-------TGVTVTGSTSGATIDINLSQTSPQHFTNDNDIIRLSGVVSGSTFQWTCSHN----------------VNASTLTASNVPHTCSSTFSA.. 146
3 -5.600IDP92773 hypothetical protein [Vibrio cholerae O1 biovar El Tor] AGG09409 [Vibrio cholerae O1 biovar El Tor]  ali follow..  5  79...........................................................................................................QGDYAYNNIRWCSHQEN 95
4 -5.600IDP92790 hypothetical protein [Vibrio cholerae O1 biovar El Tor] AGG36645 [Vibrio cholerae O1 biovar El Tor]  ali follow..  5  79...........................................................................................................QGDYAYNNIRWCSHQEN 95
5 -5.170IDP91559 gene: ECs4654; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB38077 [Escherichia coli O157:H7 str. Sakai]  ali follow..  9  100.IESIPLPNADYAFFDDEMPFTLTDEQIENISFLNANFSTTIALTNDSFHISSINNHNSQVIFDENIHLHPYELPESSQW-C-----------------------QLIKNMISLHCRYNNN... 219
6 -4.960IDP90298 bradyzoite-specific surface protein, putative [Toxoplasma gondii ME49] TGME49_120190 [Toxoplasma gondii ME49]  ali follow..  13  168..KAIQSQKWTLKLNEEDLPISDKTFTTGKAAANPAVCQLTVNVKARASSVADENVSYGAESNSEALKVDMTTTRNTVTIDCGSEGTNFVISWWKTPTPGNASILTIPAADFPESCVPNKAPQS 336
7 -4.830IDP04273 gene: YPCD1.23; hypothetical protein YPCD1.23 [Yersinia pestis CO92] YPCD1.23 [Yersinia pestis CO92]  ali follow..  11  22ITMSIKAILLYSYQEYGQHTDVFIQVKFNYGMIEYKFYVNKVKFDDTPDRKLKTTIAHSSQLMGHNLTYE...................................................... 91
8 -4.750IDP95010 Set165a_018 [Vibrio cholerae O1 biovar El Tor]  ali follow..  5  82...........................................................................................................QGDYAYNNIRWCSHQEN 98
9 -4.410IDP92707 putative membrane protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] ABD20650 [Staphylococcus aureus subsp. aureus USA300_FPR3757]  ali follow..  6  66.....RLGGNDSYYFYMSLPVSKKQL-------LNANYITCIVLTLIGTLVISLYAYEADVIEPNSIYFS...................................................... 123
10 -4.320IDP93833 DNA-binding transcriptional repressor ArsR [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007538 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  6  12LSDETRLGIVLLLKEMGELCVCDLCTALDESQPKISRHLAMLR................................................................................. 54
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 1 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.