current user: public

If you have questions about the server, please let us know.

Query: gi|77358703|ref|YP_338288.1| pilS cassette (NMB0023) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MAEGQKSAVTEYYLNHGEWPGNNTSAGVASSSTIKGKYVKEVTVANGVITATMLSSGVNKEIQGKKLSLWAKRQDGSVKWFCGQPVTRTDAKADTVAAAAKTADNINTKHLPSTCRDASSVVCIETPPTAFYKNTLast
1 -8.390sp|Q86X10|RLGPB_HUMAN Ral GTPase-activating protein subunit beta OS=Homo sapiens GN=RALGAPB PE=1 SV=1  ali   13  145VKDAAEATLTCIMQLLGAFPSPSGPASPCSLPTINKHSFRYFVLDNSVILAMLEQPLGNEQNDFFSVTVLVRGMSGRLAWAQQNQKLFVPEPRPVPKNDVGFKYSVKHRPFPEEVDKIPFVKADLSIPD...... 296
2 -8.030sp|Q2PPJ7|RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens GN=RALGAPA2 PE=1 SV=2  ali   171IPLTARMVMAHLVNHLGHYPLSGGPAILHSFEVFRSPNLQLFVFNDSTLISYLQTPTEGPVGGSPVVRVIVRDISGKYSW------------------------DGKVLYGPLEGCLAPNGRNPSFLISSWH... 300
3 -7.900sp|Q6GYQ0|RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens GN=RALGAPA1 PE=1 SV=1  ali   2ISIAARTVITHLVNHLGHYPMSGGPAMLTSPELFESPNIQFFVLNNTTLVSCI-GLSAGLASANSNVRIIVRDLSGKYSWDSA.................................................... 111
4 -7.020sp|Q9NZN1|IRPL1_HUMAN(removed signalp:1-18) Interleukin-1 receptor accessory protein-like 1 OS=Homo sapiens GN=IL1RAPL1 PE=1 SV=2  ali   13  3.................................LLPTREPEILWYKECRTK---TWRPSIVFKRDTLLIREVREDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPTCRAFFGYSGDVSPLIYWMKG. 118
5 -6.990sp|Q6GYQ0|RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens GN=RALGAPA1 PE=1 SV=1  ali   152ISIAARTVITHLVNHLGHYPMSGGPAMLTSPELFESPNIQFFVLNNTTLVSCI-GLSAGLASANSNVRIIVRDLSGKYSWDSA.................................................... 261
6 -6.990sp|Q2PPJ7|RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens GN=RALGAPA2 PE=1 SV=2  ali   21IPLTARMVMAHLVNHLGHYPLSGGPAILHSFEVFRSPNLQLFVFNDSTLISYLQTPTEGPVGGSPVVRVIVRDISGKYSWDGK.................................................... 125
7 -6.560sp|Q76N32|CEP68_HUMAN Centrosomal protein of 68 kDa OS=Homo sapiens GN=CEP68 PE=1 SV=2  ali   25  274...............................................................................WACV----------------------LPDSLPPSPDRHSPL------NPNKEYE.. 300
8 -6.410sp|P09693|CD3G_HUMAN(removed signalp:1-22) T-cell surface glycoprotein CD3 gamma chain OS=Homo sapiens GN=CD3G PE=1 SV=1  ali follow..  10........................................................KVYDYQEDGSVLLTCDAEAKNITWFKDGKMIGFLTEDKKKWNLGSNAKDPRGMY---QCKGSQNKSKPLQVYYRMCQNC 85
9 -6.370sp|Q9UK22|FBX2_HUMAN F-box only protein 2 OS=Homo sapiens GN=FBXO2 PE=1 SV=2  ali follow..  11  223LLSEHENVLAEFSSGQVAVPQDSDGGGWMEISHTFTDYVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP................................................................ 296
10 -6.280sp|Q9NTG1|PKDRE_HUMAN Polycystic kidney disease and receptor for egg jelly-related protein OS=Homo sapiens GN=PKDREJ PE=2 SV=2  ali   13  136.NSPLFIHIPNNSLQWGVY-TVSITTGNPKMPEVKDSDAVYVWIVRSSLQAVMLGDANITANFTEQLILDGSTSSDQFFWYCTTDPRN............................................... 235

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.