current user: public

If you have questions about the server, please let us know.

Query: gi|77358703|ref|YP_338288.1| pilS cassette (NMB0023) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in HGM_OVER
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MAEGQKSAVTEYYLNHGEWPGNNTSAGVASSSTIKGKYVKEVTVANGVITATMLSSGVNKEIQGKKLSLWAKRQDGSVKWFCGQPVTRTDAKADTVAAAAKTADNINTKHLPSTCRDASSVVCIETPPTAFYKNTLast
1 -4.750PB128892 A6TNK2_9CLOT/1-174 PB128892; Pfam-B_128892;  ali follow..  14  88IPEEKRLKIDHLLNIKKEEFVRNTEIKGEYEKLTDNEYLVKLSVIEQGTPIFNLKLSVGNVKQAKDM.................................................................... 154
2 -3.170PB009671 Q5LCM2_BACFN/1-111 PB009671; Pfam-B_9671;  ali follow..  17  39....................................................................................................DKFTKITVKELPQVVKSTLSKDYEGTIVKEAFVAE 73
3 -3.070PB019279 Q5LE73_BACFN/1-147 PB019279; Pfam-B_19279;  ali follow..  13  22................................................................................................................TSCEIEIDDFYDDDNIGGSYYNK 44
4 -2.730PB007733 A3U921_9FLAO/1-209 PB007733; Pfam-B_7733;  ali follow..  14  60LRRKTRKVWPYAKLASERLSELNARLASIKSKSERRKYTKIVQKYIEEQFAAELKK---TRTEGQILVKLIHRQTGVTTFQLIKNLRSGWRAFWYDTTAGLFDIELKSEYNPVNNRED................. 175
5 -2.680PB037276 Q24TM0_DESHY/1-190 PB037276; Pfam-B_37276;  ali follow..  16  41IAPGIQMSFNQLTMDSTFQSIAPVKKFLQIDYCIEGCY-TVSFLGEGDLCVTDLSRQVLRKYRGVTLFLEVEKAQHTLS........................................................ 132
6 -2.190PB039305 _Gut.Meta.Jp.0057508_ gi|162726131|dbj|BAAY01002830.1||2 (- 1092:1581~0 complete)  ali follow..  11  2VLDGFEAVGEKTTTNKMTMTVMESSVRFSKGVTEALGCPAYVKL----------------NDKQKKIAVQACDAXDENAIKFCKTKRSKADGVDSDAAGKASSVTVRTTDVLVAVQKYFTFPPVADDQIAYFA.. 120
7 -2.140PB012823 Q5LCS8_BACFN/1-272 PB012823; Pfam-B_12823;  ali follow..  13  21................................................................................................................VACNNGKGQQPSEENEDPKAKEI 43
8 -2.140PB001232 gi|126647001|ref|ZP_01719511.1| hypothetical protein ALPR1_19713 [Algoriphagus sp. PR1]gi|126577049|gb|EAZ81297.1| hypothetical protein ALPR1_19713 [Algoriphagus sp. PR1]  ali follow..  13  14IISPLSRSAFAYYRFT-----------YEGTFFDQDVLVNKIKVTP--------RSRGERVFEG-YIYIIED------LWAIHSLNLKTSLLGFQIQATQQYAPVAENVWMPLTHTYRXXXXXXXXXXXXXY... 119
9 -1.950PB011023 A7V2G7_BACUN/1-167 PB011023; Pfam-B_11023;  ali follow..  88.EGTLKMDNGITFLPNDRYLLENEKFRLYYTAQGDEAHNFIVVVEDNFGNSYELEFDFNNRNVKDDGVITVVPIGNFKPLT...................................................... 167
10 -1.860HGC00429 gi|162734516|dbj|BAAZ01029480.1|1.0 TMP00411;  ali follow..  16  11......................................RRTILFDNQCGFA---------------LGENSRAPNPFVTWQFNGQDGHRD............................................. 47

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.