current user: public

If you have questions about the server, please let us know.

Query: gi|77358700|ref|YP_338285.1| pilS cassette (NMB0020) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MAEGQKSAVTEYYLNHGEWPGNNSSAGVATSANIKGKYVEKVEVKNGVVTATMLSSGVNKEIQGKKLSLWAKRQDGSVKWFYGQPVKRDNASADAVKADTAANGKQIDTKHLPSTASTRKSTPNLast
1 -8.580sp|Q86X10|RLGPB_HUMAN Ral GTPase-activating protein subunit beta OS=Homo sapiens GN=RALGAPB PE=1 SV=1  ali   13  2..DAAEATLTCIMQLLGAFPSPSGPASPCSLPTINKHSFRYFVLDNSVILAMLEQPLGNEQNDFFSVTVLVRGMSGRLAWAQQ......................................... 95
2 -6.570sp|Q2PPJ7|RGPA2_HUMAN Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens GN=RALGAPA2 PE=1 SV=2  ali   3...TARMVMAHLVNHLGHYPLSGGPAILHSFEVFRSPNLQLFVFNDSTLISYLQTPTEGPVGGSSDVRVIVRDISGKYSWDGK......................................... 104
3 -6.570sp|Q6GYQ0|RGPA1_HUMAN Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens GN=RALGAPA1 PE=1 SV=1  ali   2..IAARTVITHLVNHLGHYPMSGGPAMLTSPELFESPNIQFFVLNNTTLVSCI-GLSAGLASANSNVRIIVRDLSGKYSWDSA......................................... 109
4 -5.300sp|Q8N0W7|FMR1N_HUMAN Fragile X mental retardation 1 neighbor protein OS=Homo sapiens GN=FMR1NB PE=1 SV=1  ali   15  1.................................................................................CSGSSYFVLANGHILPNSENAHGQSLEEDFFPTTCNLREN... 49
5 -5.200sp|Q9H3C7|GGNB2_HUMAN Gametogenetin-binding protein 2 OS=Homo sapiens GN=GGNBP2 PE=1 SV=1  ali   1......................................................................PLGGCWMDVWELMSQECRDEVVLIDSSCLLETLETYLRKHRFCTDCKNKV.... 50
6 -5.190sp|Q6IWH7|ANO7_HUMAN Anoctamin-7 OS=Homo sapiens GN=ANO7 PE=1 SV=2  ali   108FTSTKRHQILFEILAKTPYGHEKKNLLGIHQLLAEGVLSAAFPLHDGPFKTPPEGPQAPRLNQRQVLF----------HWA........................................... 179
7 -5.110tr|B7ZBL6|B7ZBL6_HUMAN Family with sequence similarity 183, member A OS=Homo sapiens GN=FAM183A PE=4 SV=1  ali   12  1....MKRRVKSGTHLM---CSLEVHT-------VTRKPMSWHDNLEEPADARFLNLIHHAAQGPRKKYPETQTENQEVGW............................................ 66
8 -4.840sp|Q14008|CKAP5_HUMAN Cytoskeleton-associated protein 5 OS=Homo sapiens GN=CKAP5 PE=1 SV=3  ali   20  10..ENTKEGLAELYEYKKKYSDADIEPFLKNSSQFFQSYVER................................................................................... 48
9 -4.820sp|Q86VR8|FJX1_HUMAN Four-jointed box protein 1 OS=Homo sapiens GN=FJX1 PE=2 SV=1  ali   13  25.LEAARGARMVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLGLQRHVPPLALA-RVEARGAQWAQVQEELRAAHWTEGSVVSLTRWLPNLTDVVVPAPWRSED.... 142
10 -4.760sp|O94885|SASH1_HUMAN SAM and SH3 domain-containing protein 1 OS=Homo sapiens GN=SASH1 PE=1 SV=3  ali   13  16LETLTENKLHAEGIDLTEEPYSDKHGRCGIPEALVQRYAEDLDQPERDVAANM....................................................................... 68

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.