current user: public

If you have questions about the server, please let us know.

Query: gi|15675978|ref|NP_273104.1| UDP-N-acetylglucosamine pyrophosphorylase (NMB0038) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .
# Score Template Links and tools%idFirst MPQNTLNIVILAAGKGTRMYSKMPKVLHRIGGKPMVGRVIDTAAALNPQNICVVIGHGKEQVLDTVKRDVVWVEQTEQLGTGHAVKTALPHLSAEGRTLVLYGDVPLIDVETLETLLEAAGNEVGLLTDVPNDPTGLGRIIRDSNGSVTAIVEEKDADAVQKAVKEINTGILVLPNAKLENWLNSLSSNNAQGEYYLTDLIAKAVADGIKVHPVQVRASHLAAGVNNKLQLTELERIFQTEQAQELLKAGVTLRDPARFDLRGRLKHGQDVVIDVNCIFEGDIELGDNVEIGANCVIKNAKIGANSKIAPFSHLESCEVGENNRIGPYARLRPQARLADDVHVGNFVEIKNAAIGKGTKANHLTYIGDAEVGCKTNFGAGTIIANYDGVHKHKTVIGDEVRIGSNCVLVAPVTLGNKVTTGAGSTITRNVEDNKLALARARQTVIEGWVRPEKDKQLast
1 -134.0003foq_A mol:protein length:503 Bifunctional protein glmU  ali model follow..  38  5.FPGDTAVLVLAAGPGTRMRSDTPKVLHTLAGRSMLSHVLHAIAKLAPQRLIVVLGHDHQRIAPLVGETIDVALQDRPLGTGHAVLCGLSALPDDGNVVVTSGDTPLLDADTLADLIATHSAAVTVLTTTLDDPFGYGRILRTQDHEVMAIVEQTDATPSQREIREVNAGVYAFDIAALRSALSRLSSNNAQQELYLTDVIAILRSDGQTVHASHVDDSALVAGVNNRVQLAELASELNRRVVAAHQLAGVTVVDPATTWIDVDVTIGRDTVIHPGTQLLGRTQIGGRCVVGPDTTLTDVAVGDGASV-VRTHGSSSSIGDGAAVGPFTYLRPGTALGADGKLGAFVEVKNSTIGTGTKVPHLTYVGDADIGEYSNIGASSVFVNYDGTSKRRTTVGSHVRTGSDTMFVAPVTIGDGAYTGAGTVVREDVPPGALAVSAGPQRNIENWVQRKRPGS 470
2 -134.0001hm0_A mol:protein length:468 N-ACETYLGLUCOSAMINE 1-PHOSPHATE URIDYLTRANSFERASE  ali model follow..  40  1MRGSSNFAIILAAGKGTRMKSDLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVGHKAELVEEVLAGQTEFVTQSEQLGTGHAVMMTEPILEGSGHTLVIAGDTPLITGESLKNLIDFHKNVATILTAETDNPFGYGRIVRNDNAEVLRIVEQKDATDFEKQIKEINTGTYVFDNERLFEALKNINTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAESVMRRRINHKHMVNGVSFVNPEATYIDIDVEIAPEVQIEANVILKGQTKIGAETVLTNGTYVVDSTIGAGAVI-TNSMIEESSVADGVTVGPYAHIRPNSSLGAQVHIGNFVEVKGSSIGENTKAGHLTYIGNCEVGSNVNFGAGTITVNYDGKNKYKTVIGDNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKDEYATRLPHHP 459
3 -133.0002v0h_A mol:protein length:456 BIFUNCTIONAL PROTEIN GLMU  ali model follow..  55  1MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDTAHQLGSENIHLIYGHGGDLMRTHLANQVNWVLQTEQLGTAHAVQQAAPFFKDNENIVVLYGDAPLITKETLEKLIEAKENGIALLTVNLDNPTGYGRIIRE-NGNVVAIVEQKDANAEQLNIKEVNTGVMVSDGASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVMEVEGANNRLQLAALERYFQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIEGNVKLGDRVKIGTGCVLKNVVIGNDVEIKPYSVLEDSIVGEKAAIGPFSRLRPGAELAAETHVGNFVEIKKSTVGKGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGDDVFVGSDTQLVAPVKVANGATIGAGTTITRDVGENELVITRVAQRHIQGWQRPIKKK. 456
4 -133.0004fce_A mol:protein length:459 Bifunctional protein GlmU  ali model follow..  54  4MSNSSMSVVILAAGKGTRMYSDLPKVLHPLAGKPMVQHVIDAAMKLGAQHVHLVYGHGGELLKKTLADSLNWVLQAEQLGTGHAMQQAAPHFADDEDILMLYGDVPLISVDTLQRLLAAKEGGIGLLTVKLDNPSGYGRIVRE-NGDVVGIVEHKDASDAQREINEINTGILVANGRDLKRWLSLLDNNNAQGEFYITDIIALAHADGKKIATVHPTRLSEVEGVNNRLQLSALERVFQTEQAEKLLLAGVMLLDPSRFDLRGELTHGRDITIDTNVIIEGHVILGDRVRIGTGCVLKNCVIGDDSEISPYTVLEDARLDANCTVGPFARLRPGAELAEGAHVGNFVEIKKARLGKGSKAGHLSYLGDAEIGAGVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVANGATIGAGTTVTRDVAENELVISRVKQVHIQGWKRPVKKK. 459
5 -133.0001hv9_A mol:protein length:456 UDP-N-ACETYLGLUCOSAMINE PYROPHOSPHORYLASE  ali model follow..  54  1MLNNAMSVVILAAGKGTRMYSDLPKVLHTLAGKAMVQHVIDAANELGAAHVHLVYGHGGDLLKQALKDNLNWVLQAEQLGTGHAMQQAAPFFADDEDILMLYGDVPLISVETLQRLRDAKQGGIGLLTVKLDDPTGYGRITRE-NGKVTGIVEHKDATDEQRQIQEINTGILIANGADMKRWLAKLTNNNAQGEYYITDIIALAYQEGREIVAVHPQRLSEVEGVNNRLQLSRLERVYQSEQAEKLLLAGVMLRDPARFDLRGTLTHGRDVEIDTNVIIEGNVTLGHRVKIGTGCVIKNSVIGDDCEISPYTVVEDANLAAACTIGPFARLRPGAELLEGAHVGNFVEMKKARLGKGSKAGHLTYLGDAEIGDNVNIGAGTITCNYDGANKFKTIIGDDVFVGSDTQLVAPVTVGKGATIAAGTTVTRNVGENALAISRVPQTQKEGWRRPVKKK. 456
6 -132.0005vmk_A mol:protein length:462 Bifunctional protein GlmU  ali model follow..  54  2..AMSTTVIILAAGKGTRMRSQLPKVLQPLAGRPLLGHVIKTAKQLLAENIITIYGHGGDHVKKTFAQNIQWVEQAEQLGTGHAVQMTLPVLPKDGISLILYGDVPLVRQTTLEQLIEVSKTGIGMITLHVDNPTGYGRIVRQ-DGKIQAIVEHKDATEAQRQIQEINTGIYCVSNAKLHEWLPKLSNENAQGEYYLTDIVAMAVADGLEIASIQPELAFEVEGVNDRLQLAALEREFQKQQAKELMQQGVTFADPARFDLRGTVKVGHDVRIDVNVIIEGNCELGDFVEIGAGCILKNTTIAAGTKVQAYSVFDGAVVGENTQIGPFARLRPGAKLANEVHIGNFVEVKNTTIGLGSKANHFTYLGDAEIGAESNIGAGTITCNYDGANKHKTTIGDAVFIGSNSSLVAPVTIGNGATVGAGSVITKDVAEQSLSFERAQQISKANYQRPQKLKK 456
7 -132.0001g95_A mol:protein length:459 N-ACETYLGLUCOSAMINE-1-PHOSPHATE URIDYLTRANSFERASE  ali model follow..  39  2....SNFAIILAAGKGTRMKSDLPKVLHKVAGISMLEHVFRSVGAIQPEKTVTVVGHKAELVEEVLAGQTEFVTQSEQLGTGHAVMMTEPILEGSGHTLVIAGDTPLITGESLKNLIDFHKNVATILTAETDNPFGYGRIVRNDNAEVLRIVEQKDATDFEKQIKEINTGTYVFDNERLFEALKNINTNNAQGEYYITDVIGIFRETGEKVGAYTLKDFDESLGVNDRVALATAESVMRRRINHKHMVNGVSFVNPEATYIDIDVEIASEVQIEANVTLKGQTKIGAETVLTNGTYVVDSTIGAGAVI-TNSMIEESSVADGVIVGPYAHIRPNSSLGAQVHIGNFVEVKGSSIGENTKAGHLTYIGNCEVGSNVNFGAGTITVNYDGKNKYKTVIGNNVFVGSNSTIIAPVELGDNSLVGAGSTITKDVPADAIAIGRGRQINKDEYATRLPHHP 456
8 -72.6002ggo_A mol:protein length:401 401aa long hypothetical glucose-1-phosphate thymidylyltransferase  ali model follow..  24  1.....MKAFILAAGSGERLEPTRPKAFVPILSKPLIEYQIEYLRKCGIRDITVIVSSKNKEYFEKKLKEISIVTQKDDIGTGAAILSA----KFNDEALIIYGDLFFSNEKEICNIITLKEN--AIIGVKVSNPKDYGVLVLDNQNNLSKIIEKPEIPPSN----LINAGIYKLNSDIF-TYLDKISI-SERGELELTDAINLMAKDH-RVKVIEYEGYWMDIGKPWNIIDV------NKWALDNLVFSQNLGNVEDNVKIKGKVIIEEDAEIKSGTYIEGPVYIGKGSEI----------------------------------GPNSYLRPYTILVEKNKIGASVEVKESVIMEGSKIPHLSYVGDSVIAEDVNFGAGTLIANLSGRRKLGAFIGGHVRTGINVTILPGVKIGAYARIYPGAVVNRDVGYGEFF.................... 399
9 -59.2003c8v_A mol:protein length:496 Putative acetyltransferase  ali model follow..  12  1..........................................MGSDKIENLYFQGMTQLELLLERIIDRVNVNLRHQKFDVGDYVRRQTPHLHKFYAFYGLSADDPVHFHFKNSSLAGSY----LLGRVNVLHSALYKSDIRGDKGQHFVCDGKMIPLHDDEVITIKDSFLNKT-------VHSNSHDPESPEEFTIRNTVAMPYANIHGSLT-----EGSFIGSFATVDLSTIHNVVRYFSYVQTGELVGKCVEPGQIWIKSGDELEFHYSFDKAILDKYISQEAGSCPTGVLMEFVEVRQEDFEEVFASGHMSGAGSASGASVSGYAVIKGDTVIGENVLVSQRAYLDNAWMGKGSNAQENCYIINSRLERNCVTAHGGKI--------INAHLGDMIFTGFNSFLQSPLKIGDGCVVMPHTIIDLEIPAGHLVWGYIRNKAD........... 396
10 -42.6002rij_A mol:protein length:387 Putative 2,3,4,5-tetrahydropyridine-2-carboxylate N- succinyltransferase  ali model follow..  13  2.........................................................................................................MINTKEDFLLLIKQIEQDRGQLNKNKILQASFALINYEQNFGSAAIMLEAFMQRGVEIDFNASEFVQTLKLEDIDFALSCFKPFLEEDGHQNIDLLKIIKDKFK-------DDEFSFVCLFEDKEPLSVESIYL-----KLYLLSTKKVPLRSINLNGAFGLLSNVAWSDDKPIELEYLRANEMRLKMSNQYPKIDFVDKF----PRFLAHIIPEDNTRILESSKVRMGASLAAGTTIASYVNFNAGTTGACMVEGRISS--SAIVGEGSDVGGGAILGVLSGTSGNAISVGKACLLGANS--VTGIPLGDNCIVDAGIAVLEGTKFLLKDAEELAKLNPYFNFDKEIYK. 350
11 -42.5003bxy_A mol:protein length:285 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase  ali model follow..  14  2.............................................................................................................................................................................................GSSGSQQLQNIIETAFERRAEITPANA-DTVTREAVNQVIALLDSGAL--------------------------RVAEKIDGQWVTHQWLKKAVLLSFRINDNQVIEGAESRYFDKVPMKFADYDEARFQKEGFRVVPPAAVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGCAQIGKNVHLSGGGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYIGQSTRIYDRETGDIHYGRVPAGSVVVSGNL 243
12 -38.9001kgq_A mol:protein length:274 2,3,4,5-TETRAHYDROPYRIDINE-2-CARBOXYLATE N-SUCCINYLTRANSFERASE  ali model follow..  12  14.....................................................................................................................................................................................................................................RRADITPANVDTVTREAVNQVIGLLDSGALRVAEKI----DGQWVTHQWLKKAVLLSFRINDNKVMDGAETRYYDKVPMKFADYDEARFQKEGFRVVPPATVRQGAFIARNTVLMPSYVNIGAYVDEGTMVDTWATVGCAQIGKNVHLSGGGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVIVEEGSVISMGVYLGQSTRIYDRETGEIHYGRVPAGSVVVSGNL 238
13 -38.8006ckt_A mol:protein length:284 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase  ali model follow..  13  16.....................................................................................................................................................................................................................................NRQNLSLDTASSDLINAINEVLSGLDNGQFRVAEKINGEWTVHQWLKKAVLLSFKLFPNQIID----AGFCKFYDKIPLKYTDCSNEQFQQSGVRVVPHAMVRRGAYIAKNTVLMPSYVNIGAYIDEGVMVDTWATVGCAQIGKNVHISGGAIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEKNSVISMGVFLGQSTKIYNRITGEVSYGRIPAGSVVVAGNL 240
14 -37.0003pnn_A mol:protein length:303 Conserved domain protein  ali model follow..  15  2.NAMKPTLFVLAAGMGSRYGS--LKQLDGIGGDTIMDYSVYDAIRAGFGRLVFVIRHSEKEFREKILTKSCPEGREKPWGTNHAVLMGRDAIR--EPFAVINADDFYGRNRKLMTLEGKQGEYCMVGYRVGNTLSESGGVSRDEKHLLTGVVERTGIERTDGTISFVSMNMWGFTPDYFFINFLNAHGQEPKSEFFIPFVVNDLIRSG-RASVEVLDTTARWFGVTYSDDRPGVVAKLRELTEAGEYPTKL............................................................................................................................................................................................................. 302
15 -36.9004ho0_A mol:protein length:297 Glucose-1-phosphate thymidylyltransferase  ali model follow..  16  1.....MKGIILSGGSGTRLYPVVSKQLLPVYDKPMVYYPLSVLMLAGIKDILIISTPEDTPRFEQLGISLSYAVQSSPDGLAQAFIIGEEFIGDDNVALVLGDN--IFYGHGFTELLQRAKSGATIFGYNVKDPQRFGVVEFDEKGKVISIEEK----PEEPKSSYAVTGLYFYDNRVVDIA--KNITPSARGELEITDVNKAYLELGELHVELLGRGFA--LDTGTHESLLQASQFIETIEKRQSLKVACL----RMGYISREQLIKLAEPLMKNEYGQYLMNLAHRSKDLVTV................................................................................................................................................................. 295
16 -36.0003zlk_A mol:protein length:303 GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE  ali model follow..  15  4..AMKRKGIILAGGSGTRLHPAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTQDTPRFQQLLGDDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDN--LYYGHDFHELLGSAQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEK----PLEPKSNYAVTGLYFYDQQVVDIA--RDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYA--LDTGTHDSLLEAGQFIATLENRQ------------GLKVACPEEIAYRQKWIDAAQL--EKLAAPLAKNGYGQYLKRLLTET........................................................................................................................................................ 295
17 -35.5005b04_I mol:protein length:678 Probable translation initiation factor eIF-2B subunit epsilon  ali model follow..  15  14.PKHALQAIVLSDSYNYRFRLDKPRCLLPLANTPLIEYTFEFLALAGVQEVYVFCCAHAGQIREYIEKSVNTIVSRESLSVGDALRELDSKQLITSDFILVSGD--VVSNVPLNEVLKEHRKKNAIMTMVVREASPFHRTRARTESSVFVIDKKTSHEELEVRNDLIDCQIDICSNDVPALFTENFDYQDIRKDF-VYGVLTSDLLGKKIHCHVAKENY--AARVRSLQTYDAISKDVLSRWVYPFV-PDSNLLNQTFSYQRHQIYKEEDVVLARSCIIKARTLIGAYTKVGDASVVANTIIGRNCTIGSNCSIDSAFL-------------------EDVVIGDNCRIGKAILANSVK-----------IGNNCSIEDGAI-------------VAAGVVIGDNTIIEKNKRLTTFESHSQGTLNDPSL.......................... 436
18 -35.4003fsx_A mol:protein length:332 Tetrahydrodipicolinate N-succinyltransferase  ali model follow..  15  2............................................................................................................................................................AVSTVTGAAGIGLATLAADGSVLDTWFPAP-ELTESGTSATSRLAVSDVPVELAALIGRDDDRRTETIAVRTVIGSLDDVAADYDAYLRLHLLSHRLVAPHGLNAGGLFGVLTNVVWTNHGPCAIDGFEAVRARLRRRGPVTVY------GVDKFPRMVDYVVPTGVRIADADRVRLGAHLAPGTTVMHFVNYNAGTLGASMVEGRISA--GVVVGDGSDVGGGAIMGTLSGGGTHVISIGKRCLLGANS--GLGISLGDDCVVEAGLYVTAGTRVTMPDSNSVKARELSGSSNLLFRRN 294
19 -35.4006b5e_A mol:protein length:296 Glucose-1-phosphate thymidylyltransferase  ali model follow..  17  1.....MRGIILAGGSGTRLYPGISKQLLPVYDKPMIYYPLTTLMMAGIRDIQLITTHDAPGFHRLLGDNISYATQDQPDGLAQAFVIGANHIGADSVALVLGDN--IFYGPGLGTSLKRFQSGGAIFAYWVANPSAYGVVEFGAEGMALSLEEK----PVTPKSNYAVPGLYFYDNDVIEIA--RGLKKSARGEYEITEVNQVYLNQGRLAVEVLARGTA--LDTGTFDSLLDAADFVRTLERRQGLKVSI-----------------------PEEVAWRMGWIDDEQLVQRARALVKSGYGNYLLELLERNLE............................................................................................................................................. 290
20 -35.2001h5r_A mol:protein length:293 GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE  ali model follow..  18  1..MKMRKGIILAGGSGTRLYPAVSKQLLPIYDKPMIYYPLSTLMLAGIRDILIISTPDTPRFQQLLGDNLQYKVQPSPDGLAQAFIIGEEFIGGDDCALVLGDN--IFYGHDLPKLMEAAESGATVFAYHVNDPERYGVVEFDKNGTAISLEEK----PLEPKSNYAVTGLYFYDNDVVQMA--KNLKPSARGELEITDINRIYLEQGRLSVAMMGRGYA--LDTGTHQSLIEASNFIATIEERQGLKVS---------------------CPEEIAFRKGFIDVEQVRKLAVPLIKNNYGQYLYKMTKDSN................................................................................................................................................ 293
21 -35.2001lvw_A mol:protein length:295 glucose-1-phosphate thymidylyltransferase  ali model follow..  15  2...AHMKGIVLAGGSGTRLYPAVSKQLLPIYDKPMIYYPLSVLMLAGIRDILIISTPRDLPLYRDLGVRFSYRVQEEPRGIADAFIVGKDFIGDSKVALVLGDN--VFYGHRFSEILRRAEDGAVIFGYYVRDPRPFGVVEFDSEGRVISIEEK----PSRPKSNYVVPGLYFYDNQVVEIA--RRIEPSDRGELEITSVNEEYLRMGKLRVELMGRGMA--LDTGTHDGLLEASSFIETIQKRQGFY-----------------------IACLEEIAYNNGWITREDVLEMAEKLEKTDYGKYLRDLAEGNFHG............................................................................................................................................ 295
22 -34.9005ify_A mol:protein length:305 Glucose-1-phosphate thymidylyltransferase  ali model follow..  16  2..AMARKGIILAGGSGTRLYPAVSKQLLPVYDKPMIYYPLSTLMIAGIRDVLIISPQDTPRFESMLGDNIQYATQPSPDGLAQAFVIGRDFVGNEPSALILGDN--IFYGHDLAKQLERADTGATVFAYHVQDPERYGVVEFDREFRAISIEEK----PAKPRSSYAVTGLYFYDRQVCDIA--ADIKPSARGELEITDVNSRYLAAGQLDVELMGRGYA--LDTGTHDSLIEAGTFIATLQKRQGLM-----------------------VACPEEIAYRRNWIDAEQVLKLAQPLAKNAYGQYLR----NLLTHQVAWQST..................................................................................................................................... 299
23 -34.8001mc3_A mol:protein length:296 GLUCOSE-1-PHOSPHATE THYMIDYLYLTRANSFERASE  ali model follow..  16  2...SHMKGIILAGGSGTRLHPGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPDKGYFQRLLGDQLEYAEQPSPDGLAQAFIIGETFLNGEPSCLVLGDN--IFFGQGFSPKLRHVTEGATVFGYQVMDPERFGVVEFDDNFRAISLEEK----PKQPKSNWAVTGLYFYDSKVV-EYAKQVKP-SERGELEITSINQMYLEAGNLTVELLGRGFA--LDTGTHDSLIEASTFVQTVEKRQGFKIAC-----------------------LEEIAWRNGWLDDEGVKRAASSLAKTGYGQYLLELLRARPRQ............................................................................................................................................ 295
24 -34.7006caj_J mol:protein length:452 Translation initiation factor eIF-2B subunit gamma  ali model follow..  16  2....EFQAVVMAVGGGSRMTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQKALCAEFKDIVCIPDDADMGTADSLRYIYPKLKTD--VLVLSCD--LITDVALHEVVDLFRAYDASLAMLMKAVEQRDFIGVDSTGKRLLFMANEADLDEELVIKGVDAHLYCLKKYIVDFLMENGSITSIRSELIKEEDLKKKELKSLDIYSFIKEANTLNLAVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGPETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQ-GSVICNNAVIEKGADIKDCLIGSGQRIEAKAKRVNEVI..................................................................................... 443
25 -34.5003gos_A mol:protein length:276 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase  ali model follow..  12  16.....................................................................................................................................................................................................................................RRADITPANVDTVTREAITHVIDLLDTGALRVAEKI----DGQWVTHQWLKKAVLLSFRINDNQVMEGAETRYYDKVPMKFAGYDEARFQREGFRVVPPATVRKGAFIARNTVLMPSYVNIGAFVDEGTMVDTWATVGCAQIGKNVHLSGGGIGGVLEPLQANPTIIEDNCFVGARSEVVEGVIVEEGSVISMGVFIGQSTRIYDRETGEVHYGRVPAGSVVVSGNL 240
26 -33.9006caj_B mol:protein length:721 Translation initiation factor eIF-2B subunit epsilon  ali model follow..  14  39.PPPPLQAVLVADSFDRRFFKDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSVRIITSELYRSLGDVLRDVDAKALVRSDFLLVYGD--VISNINITRALEEHNVSVMTMIFKESSPSHPTRAVDSTTNRVLHFQKTQGLRRFEVRYDLLDCHISICSPQVAQLFTDNFDYQTRDD--FVRGLLVNEEILGNQIHMHVTAKEYGARVSNLHMYSAVCADVIRRWVYPLTPEANFT-TTQSCTHSRHNIYRGPEVSLGHGSILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYL-------------------QGVRVAAGAQIHQSLLCDN-----------AEVKERVTLKPRSV-------------LTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDS...................... 469
27 -33.3005ids_A mol:protein length:302 Glucose-1-phosphate thymidylyltransferase  ali model follow..  15  1MAMTQRKGIILAGGSGTRLHPAISKQLLPVYDKPMIYYPLSTLMLAGMRDVLVISTQDTPRFQQLLGDNLQYAVQPSPDGLAQAFIIGEQFIGNAPSALVLGDN--IYYGHDFQPLLKAASSGATVFAYHVHDPERYGVVQFNAQGQAVSIEEK----PKAPKSNYAVTGLYFYDQQVVDIA--KAVKPSARGELEITSVNQAYMQQGQLNVQTMGRGYA--LDTGTHDSLLDASQFIATLENRQGLKVACP---EEIAWRSGWINASQLEAL-----------VQPLTKNGYGQYLMQIL........................................................................................................................................................... 291
28 -33.2001iim_A mol:protein length:292 glucose-1-phosphate thymidylyltransferase  ali model follow..  18  1..MKTRKGIILAGGSGTRLYPAVSQQLLPIYDKPMIYYPLSTLMLAGIRDILIISTQDTPRFQQLLGDNLQYKVQPSPDGLAQAFIIGEEFIGHD-DCALVLGDN-IFYGHDLPKLMEAAESGATVFAYHVNDPERYGVVEFDQKGTAVSLEEK----PLQPKSNYAVTGLYFYDNSVVEMA--KNLKPSARGELEITDINRIYMEQGRLSVAMMTGTHQSLIEASNFIATIEERQGLKVSCPEEIAFRKNFINAQQVIELAGPLSKNDYGKYLLKMV.................................................................................................................................................................................. 289
29 -33.2005b04_E mol:protein length:458 Probable translation initiation factor eIF-2B subunit gamma  ali model follow..  14  35.IPIEFQAVVFA-GFGNSLYPALPKALLPIGNKPMLHYPLYWLEAAGFTSAILICMEEAEAHINAWLRSEAPTILDDSKSSADALRAVSHLIKND--FVCLSCD--SIVGLPPYTVLDKFNPSALAVYSPVLKYEHITSQSKEIDAKQLIGIEEKTSPRVTLNTNLSDAHIFVFKHWVI-----DLIREKESISSIRGDLIPYLVKCQYQKSFTVRENIQRFLSSPNNIDNYDGGLSSQEIKINALIAKDGIIC-NKCIAKLTPEQRLVDVTVSERALVGADCMVNEGTTIKDNSNIKKSIIGKNCVIGKGVVVSNSILMDNIVVEDGVRLE-SCIVASGAQIGAKSKLRECEIGVDHRVEAGRIARGERLVDMEKIE.............................................................................. 454
30 -32.9005e3p_A mol:protein length:302 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase  ali model follow..  16  6......................................................................................................................................................................TGIATLTSTGDVLDVWYPEIGSTDQSA---LTPLEGVDEDRNVTRKIVTTTIDIDAAPTDTYDAWLRLHLLSHRVFRHTINLDGIFGLLNNVVWTNFGPCAVDGFALTR-------------------ARLSRRGQVTVYSVDKFPRMVDYVVPSGVRIGDADRVRLGAYLADGTTVMHEGFVNFNAGTLGASMVEGRISAGVTVDDGTDVGGGSIMGTLSGGGQHVISLGKRCLLGANS--GCGIPLGDDCIIEAGLYITAGTKVLFDGSLHKASTLAG.......... 263
31 -32.7004evw_A mol:protein length:255 Nucleoside-diphosphate-sugar pyrophosphorylase  ali model follow..  16  2.......IVIPMAGMSSRFFKTQPKYMLEAHGQTLFEHSVNSFAAYFASTPFLFIVRNVYDTAVFVREKATAELHTETRGQAETVTLGLEELAKQGSITVFNIDT--FRPNFVFPDISQHSDGYLEVFQGGGDNWSFAKPEHAGSTKVIQTAEKNPIS------DLCSTGLYHFNREAYREYVARPSQEWERGELYIAPLYNELIQKGLNIHYHLI-ARHEVIFCGVPDEYTDFLRQPQP........................................................................................................................................................................................................................ 247
32 -32.4004jd0_A mol:protein length:251 Nucleotidyl transferase  ali model follow..  16  1FQGAMREAIVLASGAGKRLRSDVPKVFYRFDGCELVKYPMISLMKNGVERFVLVVSEGYRDLGEKVLNDIVVENKKVELGNAYSFFLSEPYVESE-KFFLSCGDS-LFPPSALKSAFSEDEFHIKLGVSDLIDPEKASKVLVN-ENRIVKIGKRID------QYNYFDTGVFVMTK----KVYSLKESFSWTEDISLYHVLQKAVDTGMIVKVFDFGNAL--TEIDSPADLNSKVYELMSKIKEGV.................................................................................................................................................................................................................. 243
33 -32.1003fs8_A mol:protein length:273 QdtC  ali model follow..  16  7................................................................................................................................................................................................................................................................KSAIIKEGVIIGENVTIEDNVYIDYGCIIRDNVHIKKGSFIHPLIIGENALIRTENVIGDTIIGDNFQTGHKVTIRENTKIGNNVKIGTLSDIHHVYIGNYVNIHSNVFVGKSIIKDFVWLFPHVVLTNDPTPPSNGVTIELFAVIAARSVVLPGIHINEDALVGAGAVVTKDVPKETVVVGNPAREICS.......... 223
34 -30.7004mnd_A mol:protein length:479 CTP L-myo-inositol-1-phosphate cytidylyltransferase/CDP-L-myo-inositol myo-inositolphosphotransferase  ali model follow..  13  37.RIKLMKAVILAAGLGTRLGG-VPKPLVRVGGCEIILRTMKLLSP-HVSEFIIVASRYADDIDAFLKDKKIVRHDRPEKGNGYSLLVAKNHVEDR--FILTMGDH-VYSQQFIEKAVR-GEGVIADREPRFVDIGEATKI-RVEDGRVAKIGKDLREF------DCVDTGFFVLDD----SIFEHAEKLRDREEIPLSEIVKLARLPVTYVDGELWMD------VDTKEDVRRANRALVSAAVKGSGDGSTRISAAIVNKVNPNQMTLISFLVGAFSALASFFSIPLAGLLYQFSSILDGCDGEIARASLKMSKKGGYVDSILDRFVDFLFLAIIALLYPKTATAMFAIFGSVMVSYTSEKYKAEFGESIFGK................................................................................... 400
35 -30.5002pa4_A mol:protein length:323 UTP-GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE  ali model follow..  20  10..NAVKTVVVPAAGLGTRFLPTVPKELLPVVDTPGIELIAAEAAELGATRLAIITAPNKAGVLAHFERKAVPVTQDKPLGLGHAVGLAESVLDDDEDVVAVMLPDDLVLPTGVMERMEFGGSVLCAVEVSEADVSKYGIFEIEADKKVKGMVEKP--AIEDAPSRLAATGRYLLDRK-IFDALRRITP-GAGGELQLTDAIDLLIDEGHPVHIVIHQGKRHDLGNPGGYIPACVDFGLSHPVYGAQLKDAIKQILAE---HEAAERIADDSQVKL..................................................................................................................................................................................... 316
36 -30.0005l6s_A mol:protein length:431 Glucose-1-phosphate adenylyltransferase  ali model follow..  16  15QLPLKSVALILAGGRGTRLKNKRAKPAVHFGGKRIIDFALSNCINSGIRRMGVITQYQSHTLVQHIQRGQRMKGENWYRGTADAVTQNLDIIRRYEYVVILAGDH--IYKQDYSRMLIDHVEKGARCTVACEEASAFGVMAVDENDKIIEFVEKPPSMPNDPSKSLASMGIYVFDADYLYELLEEDDRDENSSHDFGKDLIPKITEAG-LAYAHPFPLSCVQSDPDAERDVGTLEAYWKANLDLASVVPELDMYDRNVQDRSGSHGMTLNSLVSGGCVISGQSVLFSRVRVNSFCNIDSAVLLPEVWVGRSCRLRRCVIDRACVIPEGMVIGENAEEDARSEEGIVLVTREMLRKLGHKQER.............................................................................................. 431
37 -29.3003hl3_A mol:protein length:269 Glucose-1-phosphate thymidylyltransferase  ali model follow..  17  14FQSNAMKGIILAGGTGSRLYPVTNKHLLPVGRYPMIYHAVYKLKQCDITDIMIITGKHMGDVVSFLGSSFTYRVQDKAGGIAQALGLCEDFVGND-RMVVILGDN--IFSDDIRPYVEEFKEGAKVLLQSVDDPERFG-VANIQNRKIIEIEEK----PKEPKSSYAVTGIYLYDSKVFSYI--KELKPSARGELEITDINNWYLKRG-VLTYNEMSGWWTDAG--THVSLQRANALARDINFGKQFNG............................................................................................................................................................................................................... 262
38 -29.3001yp2_A mol:protein length:451 Glucose-1-phosphate adenylyltransferase small subunit  ali model follow..  15  17.ASRSVLGIILGGGAGTRLYKKRAKPAVPLGANRLIDIPVSNCLNSNISKIYVLTQFNSASLNRHLSRAQSPENPDWFQGTADAVRQYLWLFEEHLEYLILAGDH--LYRMDYEKFIQAHRETDADITVAAKRATAFGLMKIDEEGRIIEFAEKPDDKRAKEMPFIASMGIYVISKDVMLNLLRD---KFPGANDFGSEVIPGATSLGMRVQAYLYDGYWEDIGTIEAFYNANLGITKKPVPDFSFYDRSAPI-----------YTQPRYLPPSKMLDADVTDSVIGEGCVIKNCKIHHSVVGLRSCISEGAIIEDSLLMGADYYETDADRKLLAAKGSPIGIGKNCHIKRAIIDKNARIGD-----NVKIINKDNVQEAARETDGYFIKSGIVTVIKDALIPSGIII................................................ 451
39 -29.2005j49_A mol:protein length:301 UTP--glucose-1-phosphate uridylyltransferase  ali model follow..  22  1MAMLKVKAVFPVAGLGTRFLPASPKEMLPIVDKPLIQYAVEEAMAAGITEMIFVTGRSKRAIEDHFDKDCFYVRQPEALGLGHAVLCAEKLVGDNPFAVILADDLLYGTPPVMAQMIHYHSSVIGVEEIPAQETKSYGIVWEDSIIKMSGIVEKPEPNVAPSNL--GVVGRYVLKPR-IFEHLRALKP-GAGGELQLTDAIQSLLADE-QVLAYKYHGTRFDCGSKLGYLKATVEFALRHPEVAADFEEYLRTRSP........................................................................................................................................................................................................ 291
40 -28.7002ux8_A mol:protein length:297 GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE  ali model follow..  21  3MTIKPLKAVFPVAGLGTRFLPAMPKEMLPVVDRPLIQYAVDEAVEAGIEQMIFVTGRGKSALEDHFDINIAYVRQQEPMGLGHAVWCARDIVGDEPFAVLLPDDFMFGQPGCLKQMVDAYNKVICAEEVPDDQTHRYGIITPGTQDEVKGLVEKPAPGTAPSNL--SVIGRYILQPE-VMRILENQGK-GAGGEIQLTDAMQRMIGDQ-PFHGVTFQGTRYDCGDKAGFIQANLAVALSRPDLEPAVRAFAV............................................................................................................................................................................................................ 287
41 -28.6005xhw_A mol:protein length:237 Putative 6-deoxy-D-mannoheptose pathway protein  ali model follow..  24  4.GGGMYDVVILAGGLGTRLKSDIPKPMVDISGKPFLYRLMEYLEDQGVQRIILSLSYKADYIIDSLIKKVDFIIENEPLGTGGAIKNACKYIEAS-KFIVINGDT-YCELDYKKFIESSLDSDLQISGVEVDDVCRYGSLDIDHDFHVNSIVEKGHQGTG-----IINSGTYILSKKII..................................................................................................................................................................................................................................................................................... 183
42 -28.5005i1f_A mol:protein length:302 UTP--glucose-1-phosphate uridylyltransferase  ali model follow..  21  1MAMLKVKAVFPVAGLGTRFLPASPKEMLPVVDKPLIQYAVEEAIEAGITEMIFVTGRSKRAIEDHFDKDCFYVRQAEALGLGHAVLCAEKLVGDNPFAVILADDLLDGPTPVLRQMIDVFDHYIGVEEIAPADSKSYGVIWEDDLFKLSGIVEKP--EPAQAPSNFGVVGRYVLKPK-IFKHLRGLKP-GAGGELQLTDAIQSLLTDE-QVLAYRYDGTRFDCGSKLGYLKATVEFALRHPEVAADFERYLLARMSEQLVV................................................................................................................................................................................................... 296
43 -28.5005vct_A mol:protein length:302 UTP--glucose-1-phosphate uridylyltransferase  ali model follow..  21  1MAMLKVKAVFPVAGLGTRFLPASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRSKRAIEDHFDKDCFYVRQPEALGLGHAVLCAEKLVADNPFAVILADDLLDGNPPVMKQMVDVFDHYIGVEEIPPSETKSYGIVWEESIVKMSAIVEKP--APEVAPSNLGVVGRYILKPR-IFEHLRALKP-GAGGELQLTDAIQALLADE-QVLAYKYQGTRYDCGSKLGYLKATVEFALRHPEVGTEFDAYLR............................................................................................................................................................................................................ 287
44 -28.5004y7t_A mol:protein length:231 Nucleotidyl transferase  ali model follow..  24  1.....MKAMILAAGKGERMRPHTPKPLVPVAGQPLIEYHLRALAAAGVTEVVINHAWLGQQIEDHLGDSIRYSPEGEPLETGGGIFKALPLLGD-APFLLVNGD--VWTDYDFARLQAPLQGLAHLVLVDNPGHHGRGDFRLVGEQVV---------DGDDAPGTLTFSGISVLHPALFEGC--------QAGAFKLAPLLRQAMAAG-KVSGEHYRGHWVDVG--TLERLAEAESLIGERALE.................................................................................................................................................................................................................... 225
45 -27.9002e3d_A mol:protein length:302 UTP--glucose-1-phosphate uridylyltransferase  ali model follow..  20  4INTKVKKAVIPVAGLGTRMLPAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLVTHSSKNSIENHFDTTIMQVRQGLAKGLGHAVLCAHPVVGDE-PVAVILPDESDLSQDNLAEMIRRFDEHSQIMVEPVADVTAYGVVDPGESVPMVGVVEKPKADVAPSNL--AIVGRYVLSAD-IWPLLAKTPP-GAGDEIQLTDAIDMLIEKE-TVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGTEFKAWLE............................................................................................................................................................................................................ 295
46 -27.7003brk_X mol:protein length:420 Glucose-1-phosphate adenylyltransferase  ali model follow..  13  10..ARDAMAYVLAGGRGSRLKDRRAKPAVYFGGKAIIDFALSNALNSGIRRIGVATQYKAHSLIRHLQRGQRVSETQWYEGTADAVYQNIDIIEPYEYMVILAGDH--IYKMDYEYMLQQHVDSGADVTIGCMEATGFGVMHVNEKDEIIDFIEKPPGIPGNEGFALASMGIYVFHTKFLMEAVRRDAADPTSSRDFGKDIIPYIVEHG-KAVAHRFADSCVRSDFEHERDVGTIDAYWQANIDLTDVVPDLDIYDKSW--IWTYAEITPPAKFVHDDEDRRGSSVVSGDCIISGAALNRSLLFTGVRANSYSRLENAVVLPSVKIGRHAQLS-NVVIDHGVVIPEGLIVGEDPELDAKRFRRTE--SGICLITQSMIDKLDL.......................................................................... 420
47 -27.7003juj_A mol:protein length:281 UDP-glucose pyrophosphorylase (GalU)  ali model follow..  17  3.....KKCLFPAAGYGTRFLPTIPKEMLPIVDKPLIQYAVEEAMEAGCEVMAIVTGRNKRSLEDYFDTCFSYVRQKQMKGLGHAILTGEALIGNE-PFAVILADHPSVLKQMTSLYQKYQCSIVAIEEVALEEVSKYGVIRGEWLYEIKDMVEKPNQEDAPSNL--AVIGRYILTPD-IFEILSETKP-GKNNEIQITDALRTQAKRK-RIIAYQFKGKRYDCGSVEGYIEASNAYYKKR........................................................................................................................................................................................................................ 272
48 -27.1002mzb_A mol:protein length:196 Adenosylcobinamide-phosphate guanylyltransferase  ali model follow..  17  1.....MDALIMAGGKGTRMGG-VEKPLIKLCGRCLIDYVVSPLLKSKVNNIFIATSPNTPKTKEYINSAYKVVIDTSGKGYIEDLNECIGYFSE--PFLVVSSDLINLKSKIINSIVDYFYCIKAKTPDVEA----------------VMIPKEKYPNPSIDFNGLVPAGINVVSPKHGYQKEEIMVIDEL------------------------------IFNINTKDDLKLAEMLLKKD....................................................................................................................................................................................................................... 194
49 -26.6001tzf_A mol:protein length:259 Glucose-1-phosphate cytidylyltransferase  ali model follow..  16  3.....SKAVILAGGLGTRLSEVKPKPMVEIGGKPILWHIMKMYSVHGIKDFIICCGYKGYVIKEYFANNVTLVDTGDSSMTGGRLKRVAEYVKDDEAFLFTYGDG--VADLDIKATIDFHKAHGKKATLTTFPPGRFG-ALDIQAGQVRSFQEKPKGDGA------INGGFFVLNPSVIDLI-------DNDATTWEQEPLMTLAQQG-ELMAFEHPGFWQPMDTLRDKVYLEGL............................................................................................................................................................................................................................. 247
50 -26.5001jyk_A mol:protein length:254 CTP:phosphocholine Cytidylyltransferase  ali model follow..  15  15MKEIRVKAIILAAGLGTRLRPNTPKALVQVNQKPLIEYQIEFLKEKGINDIIIIVGYLKEQFDEKYGVRLVFNDKYADYNNFYSLYLVKEELANS--YVIDADN--YLFKNMFRNDLTRS----TYFSVYREDCTNEWFLVYGDDYKVQDIIVDSKAG-------RILSGVSFWDAPKIVSFIDKAYVSGEFVDLYWDNMVKDNIKELDVYVEELEGN--SIYEIDSVQDYRKLEEILKNE....................................................................................................................................................................................................................... 247
51 -26.5004d48_A mol:protein length:302 GLUCOSE-1-PHOSPHATE URIDYLYLTRANSFERASE  ali model follow..  21  4YNSKVKKAVIPVAGLGTRMLPAIPKEMLPLVDKPLIQYVVNECIAAGINEIVLVTHSSKNSIENHFDTTIMQVRQGLAKGLGHAVMCAWPVIGNE-PVAVILPDESDLSKDNLAEMIRRFDGHSQIMVEPVADVTAYGVVNPGDSAPMVGVVEKPKADQAPSNL--AVVGRYVLSAD-IWPLLAKTPP-GAGDEIQLTDSIAMLMEKE-TVEAYHLKGVSHDCGNKLGYMQAFVEYGVRHETLGSDFKAWLE............................................................................................................................................................................................................ 295
52 -26.1003mqg_A mol:protein length:192 Lipopolysaccharides biosynthesis acetyltransferase  ali model follow..  18  1...........................................................................................................................................................................................................................................................................GHMATIHPTAIVDEGARIGAHSRIWHWVHIC----------------GGAEIGEGCSLGQNVFVGNRVRIGNRVKIQNNVSVYD----------------NVFLEDDVFCGPSMVFTNERKSEYRDTIVRQGATLGANCTVVCGATIGRYAFVGAGAVVNKDVPDFALVVGVPARQIG........... 154
53 -24.3004mzu_A mol:protein length:312 WxcM-like protein  ali model follow..  19  2...................................................................................................................................................................................................................................................................................................................IHKLADVQSQNIGDNTKVWQFCVILAGAVIGRNCNICANSLINDVVIGDNVTIKSGVQIWDIHIQDDVFIGPNVTFTN-YPDEYLKTIVKKGASIGANSTILPGILIGENAMVGAGAVITKNVPDNAIVIGNPGRI............. 146
54 -23.1003eg4_A mol:protein length:304 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase  ali model follow..  17  123.................................................................................................................................................................................................................................................................................................................................GFRAVPNCIVRHSAYIAPNAILMPSFVNLGAYVDKGAMIDTWATVGCAQIGKNVHLSGGGIGGVLEPMQAGPTIIEDNCFIGARSEVVEGCIVREGSVLGMGVFIGKSTKIVDRATGEVFYGEVPPYS....... 252
55 -22.6003tk8_A mol:protein length:316 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase  ali model follow..  15  127...............................................................................................................................................................................................................................................................................................................DKVPSKFANYTAEDFAAGGFRVVPPAIARRGSFIAKNVVLMPSYTNIGAYVDEGTMVDTWATVGCAQIGKNVHLSGGVIGGVLEPLQANPVIIEDNCFIGARSEVVEGVIVEENSVISMGVYLGQSTKIYDRETGEVTYGRIP.......... 271
56 -21.7003t57_A mol:protein length:305 UDP-N-acetylglucosamine O-acyltransferase domain-containing protein  ali model follow..  15  12................................................................................................................................................................................................................................................................PSAVVHPNAVIGKGVSVGPYCTIGSSVKLGNGCKLYPSSHVFGTELGESCVLMTGAVV-------GDELPGYTFIGCNNIIGHHLCIGNNNEIRECSIHRSSKPSDKTVIGDCHIAHDCKIGDRNIFANNTLLAGH-VVVEDNTHTAGASVVHQFCHIGSFAFIGGGSVVSQDVPKYMMVAGERAELRGLNLEGLRRN.. 229
57 -21.6004e6t_A mol:protein length:294 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase  ali model follow..  19  1......................................................................................................................................................................................................................................................MGSSSSGLVPRGSHYFQGAGTSNHDLIHSTAIIDPSAVIASDVQIGPYCIIPQVTIGAGTKLHSHVVVGGTRIGQNNEIFQFASVETWLEIGNNNLIREHCSLHRGTVQDNAL----TKIGSTHIAHDCIVGDHNIFANNVGVAGH-VHIGDHVIVGGNSGIHQFCKIDSYSMIGGASLILKDVPAYVMASGNPAH.............. 218
58 -21.6002jf2_A mol:protein length:264 ACYL-[ACYL-CARRIER-PROTEIN]--UDP-N-ACETYLGLUCOSAMINE O-ACYLTRANSFERASE  ali model follow..  18  1.......................................................................................................................................................................................................................................................................GSMIDKSAFVHPTAIVEEGASIGANAHIGPFCIVPHVEIGEGTVLKSHVVVNGTKIGRDNEIYQFASIPTRVEIGDRNRIRESVTIHRGTVQGGGL----TKVGSAHIAHDCTVGNRCILANNATLAGH-VSVDDFAIIGGMTAVHQFCIIGAHVMVGGCSGVAQDVPPYVIAQGNHAT.............. 195
59 -21.4003r8y_A mol:protein length:240 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase  ali model follow..  19  94........................................................................................................................................................................................................................................................................................................................IEPGAIIRDHVEIGDNAVIMMNATINIGAVIG-----EGSMIDMNAVLGG-----RATVGKNCHVGAGALAGVIEPPSAKPVIVEDDVVIGANVVVLEGVTVGKGAVVAAGAVVTEDVPPYTVVAGTPARVIKEIDEKTKAKTE 228
60 -21.3001vgt_A mol:protein length:238 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase  ali model follow..  16  6.THLDVCAVVPAAGFGRRMQTECPKQYLSIGNQTILEHSVHALLAHPRVKRVVIAISPGDSAQLPLANHPQITVVDGGDERADSVLAGLKAAGDAQWVLVHDAARPCLHQDDLARLLALTSRTGGILAAPVRDT----KRAEPGKNAIAHTVDRNGLWHALTP--------QFFPRELLHDCLTRALNEG----ATITDEASALEYCGFHPQLV--EGRADNIKVTRPEDLALAEFYLTRTIHQE................................................................................................................................................................................................................... 236
61 -21.1003hsq_A mol:protein length:259 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase  ali model follow..  12  6.................................................................................................................................................................................................................................................................TAIIDPKAELHESVEVGPYSIIEGNVSIQEGTIIEGHVKICASEIGKFNRFHQGAVITKTVIGDHNIFREYSNIHKGTKEDSPTVIGN-----KNYFMGNSHVGH-----DCILGNNNILTHGAVLAGH-------VTLGNFAFISGLVAVHQFCFVGDYSMVAGLAKVVQDVPPYSTVDGNPST.............. 188
62 -21.0005f42_A mol:protein length:280 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase  ali model follow..  15  4................................................................................................................................................................................................................................................................SLAVVHESAKIADSAIIGPFCVIGKNVVIGENTELKSHVTIGDAVIGKNNRIFQYASIGDDPIDYTYKKGDFSQV----VIGDNNIIRECATIHGGTAKEIGV----TSVGNVHIGHDCKIGSYINLVNGVGLAGH-VHIDDYAILSSNVGVHQFCRVGKHAFIAHAALVGKDVPPYLMVTAVNAGSTPCG......... 193
63 -20.9003vbi_A mol:protein length:205 Galactoside O-acetyltransferase  ali model follow..  17  27..........................................................................................................................................................................................................................................................................................LSVGKNVLISKKASIYNP--------------GVISIGNNVRIDDFCILSGKVTIGSYSHIAAYTALYGGE-------------VGIEMYDFANISSRTIPNQYKNVKTGKVILKKHVIIGAHSIIFPNVVIGEGVAVGAMSMVKESLDDWYIYVGVPVRKIKARKRKIVELEN 191
64 -20.9006amy_A mol:protein length:281 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase  ali model follow..  18  103................................................................................................................................................................................................................................................................................................................................AGVRVVPPAVARRGSFQAKNVVLMPSYVNIGAYVDEGTMVDTWATVGCAQIGKNVHLSGGVIGGVLEPLQANPTIIEDNCFIGARSEIVEGVIVEEGSVISMGVYIGQSTRIYDRETGEIHYGRVP.......... 230
65 -20.9003d5n_A mol:protein length:197 Q97W15_SULSO  ali model follow..  18  2....NIGVIILAAGEGKRFGG--DKLLAKIDNTPIIMRTIRIYGDL---EKIIIVGKYVNEMLPLLMDQIVIYNPFWNEGISTSLKLGLRFFKDYDAVLVALGDMPFVTKEDVNKIINTFKPNCKAVIPTHKGERGNPVLI----------------------------------SKSLFNEIEKLRGDVGARV--------ILNKIKIEELCFIECSEGVLIDIDKKEDLMRLRDFHPLE....................................................................................................................................................................................................................... 191
66 -20.8004eqy_A mol:protein length:283 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase  ali model follow..  22  4.................................................................................................................................................................................................................................................................GTLEAQTQGPGSMSRIHPTAIIEPGAQLHETVEVGPYAIVSNVTIGARTTIGSHSVIEGTTIGEDNRIGHYASVPTRLVIGDRNTIREFTTIHTGTVQDAGV----TTLGDVHIGHDCRVGSHVVLSSNAQMAGH-VEIGDWAIVGGMSGVHQYVRIGAHSMLGGASALVQDIPPFVIAAGNKAE.............. 204
67 -20.7002waw_A mol:protein length:199 MOBA RELATE PROTEIN  ali model follow..  22  1MLRSRVTGVVLAAGYSRRLGT--PKQLLPLGDTTLLGATLAMARRCPFDQLIVTLGGAADEVLEKVELGLDIVLVDDGLGCSSSLKSALTWVDPTEGIVLMLGDQPGITASAVASLIAGGRGATIAVCAELHGDKGVWRLIESGRHGVRRI................................................................................................................................................................................................................................................................................................................. 172
68 -20.6002we9_A mol:protein length:197 MOBA-RELATED PROTEIN  ali model follow..  17  1MTATQITGVVLAAGRSNRLGT--PKQLLPYRDTTVLGATLDVARQAGFDQLILTLGGAASAVRAAMALGTDVVVVEDERGCAASLRVALARVHPRTGIVLMLGDQPQVAPATLRRIIDVGPATEIMVCARLHGDKGVWKLVHSGRHPVREL................................................................................................................................................................................................................................................................................................................. 172
69 -20.3004r36_A mol:protein length:275 Putative acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase  ali model follow..  22  6......................................................................................................................................................................................................................................................................SGLVPRGSHMISPLAYIHPEAKIGENVEIAPFVYIRNVVIGDNNKIMANANILY-----GSRIGNGNTIFPGAVIGAIAEIGDNNLIREVTINRGTAAKGRTIVGNVHVAHDALIGNGCIVGNSTKMAGE-IIIDDNAIISANVLMHQFCRVGGYVMIQGGCRFSKDIPPYIIAGREPIA.............. 200
70 -20.2003cj8_A mol:protein length:236 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-acetyltransferase  ali model follow..  24  97...........................................................................................................................................................................................................................................................................................................................GALIREKVEIGDQAVIMMGAILNIGAVVGA-----GTMIDMGAVLGG-----RATVGKHCHIGAGTLAGVIEPPSAAPVVIENEVVIGANAVVLEGVRVGEGAVVAAGAVVVEDVPAHTVVAGVPAKVIKQ.......... 218
71 -19.9003r0s_A mol:protein length:266 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase  ali model follow..  17  10.................................................................................................................................................................................................................................................................SAVIEEGAQLGDDVVIEAYAYVSKDAKIGNNVVIKQGARILSTTIGDHSRVFSYAIVGDIPQDISYKEEQKSGV----VIGKNATIREFATINSGTAKGDGF----TRIGDCHIAHDCLLGNNIILANNATLAGH-VELGDFTVVGGLTPIHQFVKVGEGCMIAGASALSQDIVPFCLAEGNRAS.............. 193
72 -19.8005jxx_A mol:protein length:257 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase  ali model follow..  20  1..............................................................................................................................................................................................................................................................................MTIHPTAIIDKSAMIADSAIIGPYCIVKNSQIGAHTVLRSHVIIGETKIGVHNDIYQFASIQTYLEIGDHNRIREACTIHRGTVQDRGI----TRIGNVHIAHDCVVGDDNVLANNVGVAGH-AHIGNHVIIGGQSGVHQFCRIDDYSMVGGASLIVKDVAAYVMASGNPAK.............. 188
73 -19.6001j2z_A mol:protein length:270 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase  ali model follow..  17  6................................................................................................................................................................................................................................................................KTAIISPKAEINKGVEIGEFCVIGDGVKLDEGVKLHNNVTLQGTFVGKNTEIFPFAVLGTQPQDSELIIGEDNLIREFCMINPGTEGGI----KKTLIGDKNLLMAYVHVADCVIGSHCILANGVTLAGH-------IEIGDYVNIGGLTAIHQFVRIAKGCMIAGKSALGKDVPPYCTVEGNRAFI............. 190
74 -19.3005dem_A mol:protein length:258 Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase  ali model follow..  18  7.................................................................................................................................................................................................................................................................RAIIDPSARLAADVQVGPWSIVGAEVEIGEGTVIGPHVVLKGTKIGKHNRIYQFSSVGEDTPDTRLVIGDHNVIREGVTIHRGTVQDR----AETTIGDHNLIMAYAHIGDSVIGNHCILVNNTALAGH-------VHVDDWAILSGYTLVHQYCRIGAHSFSGMGSAIGKDVPAYVTVFGNPAE.............. 189
75 -19.3002iu8_A mol:protein length:374 UDP-3-O-[3-HYDROXYMYRISTOYL] GLUCOSAMINE N-ACYLTRANSFERASE  ali model follow..  15  31.........................................................................................................................................VEFQGNGATLLSGVEEIEEAKTAH---------------------ITFLDNEKYAKHLKSSEAGAIIISRTQFQKYRDLNKNFLITSESPSLVFQKCLELFITPVDS--GFPGIH----PTAVIHPTAIIEDHVCIEPYAVVCQHAHVGSACHIGSGSVIAYSTVGEHSYIHP-----RVVIRERVSIGKRVIIQPGAVIGSCVIIEDDVEIKHSVVREGSKIDNL-----VQIAHQVEVGQHSMIVAQAGIA--STKIGNHVIIGGQAGITGHICIADHVIMMAQTGVTKSITSPGIYGGAPARPYQEIHRQVAKVRN 343

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24