|
current user: public |
|
Query: gi|15675964|ref|NP_273082.1| hypothetical protein (NMB0016) [Neisseria meningitidis MC58], from N.meningitidis |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . | |||||||
# | Score | Template | Links and tools | %id | First | MKNSFCGQFACCANGILLFFTEWLPMSLRTGILWRFERKVCLELVEMVRCRHECLISAYRQSAHPNLCISGGKNEICG | Last |
1 | -7.250 | PF16239.5; Q97WR8_SULSO/16-95; Domain of unknown function (DUF4898 topsan) | ali follow.. | 21 | 29 | ..................FFSTFLPYSVKYFVVISSDLPVKIIKESLIRAKDTLEVSCYITSKLPQKSM......... | 79 |
2 | -6.830 | PF00945.18; NCAP_EBLV2/11-428; Rhabdovirus nucleocapsid protein | ali follow.. | 19 | 226 | ..........CSGLVSFTGFIRQINLTAKEAILYFFHKNFEEEIKRMFEPGQET--SPYSSNAVGHV........... | 298 |
3 | -6.590 | PF16991.5; I2H7J6_TETBL/1522-1677; Sir4 SID domain | ali follow.. | 17 | 88 | ..................................TFLASTLIDLLDTGLIPYSSLEESYYVSGTNDVC.......... | 121 |
4 | -6.440 | PF15744.5; G1SII7_RABIT/10-368; Uncharacterized protein family UPF0492 topsan | ali follow.. | 16 | 1 | .....CGNFAVLVDLHIS--TSWFSEQKKEEVCLLLKETIDSRVKEYLEVRKQHKPSSPEFTRSNPLSLKGYGFQI.. | 76 |
5 | -6.080 | PF04020.13; R4PXK2_9BACT/2-110; Mycobacterial 4 TMS phage holin, superfamily IV | ali follow.. | 23 | 68 | ......GLFTIIVNGFMVWISLKLAPGLQMTFWHSVLTGLVLSLVNYV.............................. | 109 |
6 | -6.020 | PF16923.5; A5DNH9_PICGU/50-285; Glycosyl hydrolase family 63 N-terminal domain | ali follow.. | 15 | 1 | ..SLLWGPY---RSALYFGVRPRIPRSLLSGLMWYNID----GYGGVGSIRHFY-MGKANWIRYDPR--FGGTQVI.. | 69 |
7 | -5.970 | PF08401.11; Q89U10_BRADU/16-139; Domain of unknown function (DUF1738 topsan) | ali follow.. | 12 | 11 | ........IVELEAGRVPWVQPWIPKNASTDRSYSGINVLLLWGSTIEHGYSGQSWLTFRQALSLGGYVRKGER.... | 86 |
8 | -5.950 | PF15724.5; L5JX75_PTEAL/24-275; TMEM119 family | ali follow.. | 28 | 61 | .............DGIVDFFRQYVMLIAVVGSL--------VFLLMFIVCRQKHKASAYYPSSFPK............ | 110 |
9 | -5.870 | PF12409.8; G1XUG4_ARTOA/163-285; P5-type ATPase cation transporter | ali follow.. | 11 | 15 | MGSTILTVLSVLTLGLFYLLLRWMP---------RWRVRLIGKPCPLRDCEWVVIENEWNE................. | 66 |
10 | -5.830 | PF11702.8; R8BWH1_TOGMI/90-591; Protein of unknown function (DUF3295 topsan) | ali follow.. | 26 | 424 | .................MLSTE-LTESLRRHLVW--ERSQKSSTANAVLKRRHTSHDVANLKQYPE............ | 469 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Li W, Jaroszewski L, Godzik A. Tolerating some redundancy significantly speeds up clustering of large protein databases. Bioinformatics. 2002 Jan;18(1):77-82. |