|
current user: public |
|
Query: gi|15675968|ref|NP_273094.1|(removed signalp:1-17) hypothetical protein (NMB0028) [Neisseria meningitidis MC58], from N.meningitidis |
. 10 . 20 . 30 . 40 . 50 . | |||||||
# | Score | Template | Links and tools | %id | First | VTYVLTGSIGVSGAVALVEPLINTVVFYFHEKAWNLYEKNKTVKQTQPFQLHRCS | Last |
1 | -28.800 | PF09834.9; E1SP40_FERBD/1-52; Predicted membrane protein (DUF2061 topsan) | ali follow.. | 42 | 18 | LAYLITGSIVIGGLLAVLEPMVNTVGYAIHERVWK.................... | 52 |
2 | -7.990 | PF11970.8; Q7SAB9_NEUCR/459-533; G protein-coupled glucose receptor regulating Gpa2 C-term | ali follow.. | 19 | 50 | ..........VSMVSLGIQGTVDCMLFTLREQPWKH................... | 75 |
3 | -7.230 | PF04341.12; Q47KX8_THEFY/22-109; Protein of unknown function, DUF485 topsan | ali follow.. | 15 | 42 | MAIKLVGNINVGLVFGLLQFVSTFIITGLYVR....................... | 73 |
4 | -7.130 | PF07284.11; Q16DR8_ROSDO/15-153; 2-vinyl bacteriochlorophyllide hydratase (BCHF) | ali follow.. | 14 | 37 | VRYLWNGEGYVIATWSIVLKTMLLYLIMVTGAIWEKIVFGQ.............. | 77 |
5 | -6.470 | PF03139.15; W0IXF1_9BACT/6-116; Vanadium/alternative nitrogenase delta subunit | ali follow.. | 30 | 7 | ................LVDYIMKKCLWQFHSRAWDR................... | 26 |
6 | -6.250 | PF02118.21; A8XR42_CAEBR/21-293; Srg family chemoreceptor | ali follow.. | 5 | 87 | SISYFKAIKPVVHIFVAINRMSCVMFPVTYSQNWSN................... | 122 |
7 | -5.960 | PF16956.5; Q3IIM9_PSEHT/1-267; Putative general bacterial porin | ali follow.. | 6 | 210 | .NYYFSKATSVFANYNKQDAYSFGAQHFINENVGIKVGYGNNADDSG........ | 255 |
8 | -5.930 | PF05987.13; Q1LJK3_CUPMC/21-349; Bacterial protein of unknown function (DUF898 topsan) | ali follow.. | 17 | 2 | LPLSFTGSGSEYFRIWIVNALLSIITLGIY-SAWAKVRTLQ.............. | 41 |
9 | -5.840 | PF04834.12; E3RDB_ADE02/31-130; Early E3 14.5 kDa protein | ali follow.. | 6 | 26 | ........YAIISVMVFCSTIFALAIYPYLDIGWNAID................. | 55 |
10 | -5.800 | PF09651.10; A8ZV94_DESOH/49-188; CRISPR-associated protein (Cas_APE2256) | ali follow.. | 21 | 98 | VLINATGGYKQISFAGMIGQALEIPVCYLFEK....................... | 130 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46. |