|
current user: public |
|
Query: gi|15675979|ref|NP_273105.1|(removed signalp:1-21) hypothetical protein (NMB0039) [Neisseria meningitidis MC58], from N.meningitidis |
. 10 . 20 . 30 . 40 . 50 . 60 . | |||||||
# | Score | Template | Links and tools | %id | First | TYQDGNGKTAVRQKYPAGTPVYYQDGSYSKNMNYNQYRPERHAVLPNQTGNNADEEHRQHWQKPKFQNR | Last |
1 | -6.130 | PF09489.10; S6BBE6_PSERE/11-61; Probable cobalt transporter subunit (CbtB) | ali follow.. | 22 | 20 | .................GLALVYFAGFSHIEAVHNAAHDTRHSA......................... | 46 |
2 | -6.050 | PF12686.7; K9XG69_9CHRO/9-227; Protein of unknown function (DUF3800 topsan) | ali follow.. | 12 | 3 | .YLDDSGSPKPNPK--DQCPFFGMGGVLINRGHEQIIEALVLEFKQRWNIAVDIPLHGSEIRSKK.... | 64 |
3 | -5.900 | PF03319.13; B7JVW1_CYAP8/1-83; Ethanolamine utilisation protein EutN/carboxysome | ali follow.. | 21 | 52 | .................DEWVLVSRGSAARIEDGQENRPLDAMVV........................ | 79 |
4 | -5.770 | PF08316.11; R8BJP7_TOGMI/139-271; Pal1 cell morphology protein | ali follow.. | 30 | 13 | .................GTGLFHHDGPFHRNKNGRRNAPM............................. | 40 |
5 | -5.680 | PF14124.6; C0NMC5_AJECG/12-190; Domain of unknown function (DUF4291 topsan) | ali follow.. | 28 | 2 | ..........IRAQYTPTTITVYQ--AYSPA--------IANAAVAAGKFVPPFRRGRMTWIKPSF... | 47 |
6 | -5.610 | PF02405.16; K9WIJ8_9CYAN/42-253; Permease MlaE | ali follow.. | 17 | 61 | ........TASIVAGQVGSAYAAEIGAMQISEQIDALYPINYLVIPR...................... | 104 |
7 | -5.430 | PF04544.12; UL20_PSHV1/59-243; Herpesvirus egress protein UL20 | ali follow.. | 14 | 44 | .AKSCTGHGAMVTGLTACTGAYAIASLLCSFVVYYNVRTDNMPFGTYTK.................... | 91 |
8 | -5.320 | PF09296.11; Q9FCK2_STRCO/46-141; NADH pyrophosphatase-like rudimentary NUDIX domain | ali follow.. | 15 | 59 | .......................LPGRMDQSARPAGLREAGLLLSPRDAGLMAHAVALENW........ | 96 |
9 | -5.300 | PF02744.17; GAL7_KLULA/195-363; Galactose-1-phosphate uridyl transferase, C-terminal domain | ali follow.. | 14 | 7 | KYEHQHGAH-VNLELREKERIVCENDSFLVVVPYWAVWPFETMVLSKRRIPSLNQ.............. | 65 |
10 | -5.140 | PF11992.8; Q1LH80_CUPMC/17-345; Domain of unknown function (DUF3488 topsan) | ali follow.. | 7 | 186 | ..SEPIGRTGISDTMKPGSGKLIRSPDVAFRVDFVGEAPSPASLY---RAFVLWDYDGETWRPARSRSV | 251 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Grynberg M, Jaroszewski L, Godzik A. Domain analysis of the tubulin cofactor system: a model for tubulin folding and dimerization. BMC Bioinformatics. 2003 Oct 10;4(1):46. |