current user: public

If you have questions about the server, please let us know.

Query: gi|77358701|ref|YP_338286.1| pilS cassette (NMB0021) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst MVEGQKSAVTEYYLNHGEWPGDNSSAGVATSSEIKGKYVKSVEVKNGVVTAQMASSNVNNEIKGKKLSLWAKRQNGSVKWFCGQPVTRDKAKDDAVTAATGKGTANINTKHLPSTAPTRKSTPNLast
1 -29.200PF00114.19; Q60163_MORBO/35-157; Pilin (bacterial filament)  ali follow..  12  11ELAAGKTAVDAALFEGKEPVLQANNADTSKEDMSNVELGGFSATSSAGTITGTLGTRANKDITGAKIMQNRAADGV---WSCTID---------------GSAATGWKDKFIPTGC........ 122
2 -7.630PF08224.11; Q8LHX1_ORYSJ/99-327; Domain of unknown function (DUF1719 topsan)  ali follow..  10  8VAHATKSLISSIFHGNIDEPIRSAVRRFEWFADGANDFLRSVEFGGTPRRYLFFDPLIGRLLAGETLEYKLVQGNNQHLFWIRPNNTAERGVEAKLIFVYNDESVPVNNFFLGMMLQLSECTN. 130
3 -6.480PF14430.6; H5X666_9PSEU/12-139; Immunity protein Imm1  ali follow..  23  103.WPTVRQAVHDYVASGGARPDG...................................................................................................... 123
4 -6.350PF18038.1; H2T8R1_TAKRU/36-133; FERM N-terminal domain  ali follow..  1.......KILKVCFSTNNSLGKNFKLVKCDSSWQVRAIIRSI--------LNCGRLGPDIKHVGCYGLLLKHLKSDELHWLHPDLTVEEVEQRYESHHVEAEWRYDLRIRYVP........... 98
5 -6.100PF16750.5; Q4KDB2_PSEF5/38-148; Sensor domain of 2-component histidine kinase  ali follow..  2LDPADRQYLASYAQQAEHAWRQGGVAAV-------DEFQRQLATREDTWVAVI--GDRLQSLGSTPLEASHLTFMRKLDWPMSQDELPYVSIEFPEHPEQGRLVLQLPERLLP........... 111
6 -6.060PF02019.18; W5KAT6_ASTMX/58-185; WIF domain  ali follow..  18  2.....................................FMSEEEVKKDAELYYVRDDVVNNYALSFILPVPSETNSLHFTWHSKSKVDYKLGFHVENPAAMDQPQSNISTQEVPRTCSGKVDGE. 101
7 -5.940PF08334.11; Q0K5X7_CUPNH/46-154; Type II secretion system (T2SS), protein G  ali follow..  16  17.ISSVMQALKLYRLDNSRYPTTEQGL.................................................................................................. 41
8 -5.880PF02010.15; Q6IVD6_STRPU/655-1134; REJ domain  ali follow..  10  43.TDLTTLYVPAFTLEYGTY--HVTINLRDGSVGVNKNDQTYIRVVESPLYAVINGGSSRAIGWYRDIYMDGSLSKDLFSWFCRRSNET.................................... 141
9 -5.810PF16541.5; L2GD02_COLGN/38-169; Alternaria alternata allergen 1  ali follow..  84..............................................................................SWTCNDDPKYPARYTAKGGAV------------ADLSCEETSWQNL 117
10 -5.790PF11486.8; Q65MK1_BACLD/1-121; Protein of unknown function (DUF3212 topsan)  ali follow..  15  15....ISDLVKQIFSREGHQEADTHRFESFAARRINIDYVFSIIMNIGDPEERRTASSTEDLLSSYLLSLLSFITKDMFQ----------YSRENANQYLLNERNADVFHLFLPDSV........ 118

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.