current user: public

If you have questions about the server, please let us know.

Query: gi|77358703|ref|YP_338288.1| pilS cassette (NMB0023) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MAEGQKSAVTEYYLNHGEWPGNNTSAGVASSSTIKGKYVKEVTVANGVITATMLSSGVNKEIQGKKLSLWAKRQDGSVKWFCGQPVTRTDAKADTVAAAAKTADNINTKHLPSTCRDASSVVCIETPPTAFYKNTLast
1 -28.300PF00114.19; Q60163_MORBO/35-157; Pilin (bacterial filament)  ali follow..  15  11ELAAGKTAVDAALFEGKEPVLQANNADTSKEDMSNVELGGFSATSSAGTITGTLGTRANKDITGAKIMQNRAADGV---WSCTIDG--------------SAATGWKDKFIPTGC.................... 122
2 -6.930PF08224.11; Q8LHX1_ORYSJ/99-327; Domain of unknown function (DUF1719 topsan)  ali follow..  8VAHATKSLISSIFHGNIDEPIRSAVRRFEWFADGANDFLRSVEFGGTPRRYLFFDPLIGRLLAGETLEYKLVQGNNQHLFWIRPNNTAERGVEAKLIFVYNDESVPVNNFLGMMLQLSECTNIVGTA-APHFKST 149
3 -6.440PF10875.8; Y269_RICPR/1-141; Protein of unknown function (DUF2670 topsan)  ali follow..  14  27LIIAVASLITLYYTVLGL------------------KKIGFIDYFGRETEDILSQSKAVAQNCIPKLKLVNGKLPLNEFWDCLSDPGEYKHEEVTGARVLEDE----NKFMQKQTDSIADTAHPIIHPYEKLENQ 140
4 -6.230PF16541.5; L2GD02_COLGN/38-169; Alternaria alternata allergen 1  ali follow..  13  84..............................................................................SWTCNDDPKYPARYTAKGGAV-----------ADLSCEETSWQNLNWTIGQVYSRRE 129
5 -6.210PF08204.11; Q9Q8V0_RFVKA/10-120; CD47 immunoglobulin-like domain  ali follow..  13  1....................................AHVGLLLVVFVHLTVGNKVTVMPYTVCNTTITLYKDINSIHVKWLFYTMDDTISNITNGSFIKFDFAKNLSGNY---TCEAYSDLNSVKN......... 95
6 -6.020PF03896.16; B0XFI4_CULQU/3-291; Translocon-associated protein (TRAP), alpha subunit  ali follow..  14  140IKPGHEATVSYSFLPSESFAGRPFGLNIALNYRDASGNQFSEAVFNETVSIIEVDEGLDGETFFLYVFLAAVVVLLLVFLGSYGKRKRSPAVRKTVETGTTNTKDVDYEWIPAE-PKGGKVSPKQSPRQRKAKRA 285
7 -6.010PF14430.6; H5X666_9PSEU/12-139; Immunity protein Imm1  ali follow..  23  103.WPTVRQAVHDYVASGGARPDG................................................................................................................. 123
8 -5.960PF10583.9; F1MX64_BOVIN/1-68; Involucrin of squamous epithelia N-terminus  ali follow..  32  40..............................................................................................................LPAPCQKVHSELPGEVPLELGEKHT 64
9 -5.920PF03364.20; Q82RS2_STRAW/11-133; Polyketide cyclase / dehydrase and lipid transport  ali follow..  1.IEAPVAVTWALWSDVSRWPS---------------SHVRLVEPLDER--RFAWQLSLPGADKNFVAELTEVIPGDRIAWQTTEGVHHAGVVTFHRLSDTSSRVTLQIEYDPKGFVEHIGALTNLNYDLGEFQK. 123
10 -5.810PF06197.13; D0L9X9_GORB4/20-220; Protein of unknown function (DUF998 topsan)  ali follow..  19  12........VLEFLWPSPLDPFRSFLSELDAQHCPHREVYVAGDVTTSVCALI----------------------AGAVALIPRPLVRGRLAVAAVVLLAAFGASTMADALLPIECLAGIDPGCRAEP........ 108

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.