current user: public

If you have questions about the server, please let us know.

Query: gi|77358703|ref|YP_338288.1| pilS cassette (NMB0023) [Neisseria meningitidis MC58], from N.meningitidis

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst MAEGQKSAVTEYYLNHGEWPGNNTSAGVASSSTIKGKYVKEVTVANGVITATMLSSGVNKEIQGKKLSLWAKRQDGSVKWFCGQPVTRTDAKADTVAAAAKTADNINTKHLPSTCRDASSVVCIETPPTAFYKNTLast
1 -42.500d1qvea1 d.24.1.1 (A:29-150) Pilin P1 {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  31  11LASGLKTKVSDIFSQDGSCPANTAATAGEKDTDINGKYVAKVTTGGTAIVATMKASDVATPLRGKTLTLTLGNAKGSYTWACT--------------------SNADNKYLPKTCQTATTTT............. 121
2 -34.300d1x6za2 d.24.1.1 (A:29-144) automated matches {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  16  11SVNPLKTTVEEALSRGWSVKSGTGTEDATKKEVPLGVAADANKLGTADITLTFTMGGAGPKNKGKIITLTRTAADGL--WKCT--------------------SDQDEQFIPKGCSR.................. 116
3 -28.200d1ay2a_ d.24.1.1 (A:) Pilin Gc {Neisseria gonorrhoeae [TaxId: 485]}  ali model 3D-neighbors follow..  76  39LAEGQKSAVTEYYLNHGKWPENNTSAGVASPSDIKGKYVKEVEVKNGVVTATMLSSGVNNEIKGKKLSLWARRENGSVKWFCGQPVTRTDDDTV---ADAKDGKEIDTKHLPSTCRDNFDA.............. 157
4 -11.600d3soka_ d.24.1.0 (A:) automated matches {Dichelobacter nodosus [TaxId: 870]}  ali model 3D-neighbors follow..  11  39LADGLKVRISDHLESGECKGDANPASG-SLGNDDKGKYALATIDGDYNKDAKTADEKNGCKV---VITYGQGTAGEKISKLIVGKKLVLDQFVNGSYKYNEGETDLELKFIPNAVKN.................. 151
5 -7.210d2rj2a1 b.18.1.21 (A:117-297) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  111LLSENEDVLAEFATGQVAVPEDGSWMEISHTFIDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP................................................................ 181
6 -7.110d1vcaa1 b.1.1.3 (A:91-199) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13LEAGKPITVK---SVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSL-----------EVTFTPVIEDIGKVLVCRAKLHIDEMDSVPTVR--QAVKELQVYISP....................... 109
7 -6.030d1jbja1 b.1.1.4 (A:101-186) CD3 gamma chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  11  21..............................................................GDGSVLLTCGLTDKTIKWLKDGSIISPLNATKNTWNLGNNAKDPRGTY---QCQGAKETSNP........... 79
8 -5.920d1xiwb_ b.1.1.4 (B:) CD3 delta chain ectodomain fragment {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  10  10.......................................DRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIY-----------KDKESTVQVHY--RMCQS.................. 74
9 -5.770d3idaa1 c.69.1.21 (A:4-351) automated matches {Rhodococcus sp. [TaxId: 51612]}  ali model 3D-neighbors follow..  10  13MRDGVRLAVDLYRDADGPVPVVRNPYDKFDVFAWSTQSTNWLEFVRDGYAVVIQDTRGLFASEGEFVPHVDDEADATLSWILEQAWCDGNVGMFGVSYLGVTQWQAAVSGVGG------KAIAPSMASADLYRAP 147
10 -5.760d1zvfa1 b.82.1.20 (A:1-175) 3-hydroxyanthranilate-3,4-dioxygenase {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 4932]}  ali model 3D-neighbors follow..  57...........FYQKKGSMLLKVVDETDAEPK------FIDIIINEGDSYLLPGNVPHSPVRFADTVGIVPGGENDKIRWYCSHCRQVVHESELQMLDLGTQVKEAILDFENDVEKRTCFHCKTLNYARP..... 174

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.