current user: public

If you have questions about the server, please let us know.

Query: gi|77358703|ref|YP_338288.1| pilS cassette (NMB0023) [Neisseria meningitidis MC58], from N.meningitidis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# E-value Template Links and tools%idFirst MAEGQKSAVTEYYLNHGEWPGNNTSAGVASSSTIKGKYVKEVTVANGVITATMLSSGVNKEIQGKKLSLWAKRQDGSVKWFCGQPVTRTDAKADTVAAAAKTADNINTKHLPSTCRDASSVVCIETPPTAFYKNTLast
1 2.000e-37UniRef50_E3D503 PilS cassette n=166 Tax=Neisseria TaxID=482 RepID=E3D503_NEIM7  ali  77  1MAEGQKSAVTEYYLNHGEWPANNSSAGVATSADIKGKYVKSVEVKNGVVTAQMASSNVNNEIKGKKLSLWAKRQNGSVKWFCGLPVARADTATATEVTAASGNDKIDTKHLPSTCRDASSAVCIETPPTAFYKNT 135
2 6.000e-37UniRef50_A0A0Y5NFV2 Fimbrial protein n=98 Tax=Neisseria TaxID=482 RepID=A0A0Y5NFV2_NEIME  ali  78  1MAEGQKSAVTEYYLNHGEWPANNSSAGVATSADIKGKYVKSVEVKNGVVTAQMASSNVNNEIKGKKLSLWAKRQAGSVKWFCGQPVARNANNADAVAAAKTGTNKIDTKHLPSTCRDAASVVCIETPPTAFYKNT 135
3 6.000e-36UniRef50_A0A0Y6UBG1 Class I pilin PilE n=168 Tax=Proteobacteria TaxID=1224 RepID=A0A0Y6UBG1_NEIME  ali  79  46LAEGQKSAVTEYYLNHGIWPGDNSSAGVASSSTIKGKYVKSVEVKNGVVTATMLSTGVNNEIKGKKLSLWAKRQDGSVKWFCGQPVTRANTATATEVT-ADGKDNINTKHLPSTCRDAASAVCTKTPPTAFYKNT 179
4 6.000e-35UniRef50_A9M1C6 PilS cassette n=21 Tax=Neisseria meningitidis TaxID=487 RepID=A9M1C6_NEIM0  ali  80  1MAEGQKSAVTEYYLNHGKWPGDNSSAGVATSTDIKGKYVQSVEVKNGVITATMLSSGVNNEIKGKKLSLWAKRQNGSVKWFCGQPVTRADANGANXXXXXXXXXXIDTKHLPSTCRDAASVVCIETPPTAFYKNT 144
5 1.000e-30UniRef50_A0A1D3HFP1 Pilin PilE n=162 Tax=Proteobacteria TaxID=1224 RepID=A0A1D3HFP1_NEIGO  ali  72  1MAEGQKSAVTEYYLNHGEWPANNGDAGVASPGEIKGKYVKEVKVENGVVTAQMNPSGVNKEIKDKKLSLWAKRENGSVKWFCGQPVTRDNKAND-TVADAADKDKIETKHLPSTCRDKASDA............. 121
6 2.000e-30UniRef50_A0A1D3F6D2 Pilin n=281 Tax=Neisseria TaxID=482 RepID=A0A1D3F6D2_NEIGO  ali  74  1MAEGQKSAVTEYYLNHGKWPENNTSAGVASPSNIKGKYVESVTVENGVVTAKMLSSGVNKEIQGKKLSLWAKREAGSVKWFCGRPVKRDAKGTDDVAKDGKDNEKIDTKHLPSTCRDESSLPGIA.......... 127
7 1.000e-29UniRef50_A0A1D3ERN8 Large pilS cassette n=17 Tax=Neisseria TaxID=482 RepID=A0A1D3ERN8_NEIGO  ali  73  1MAEGQKSAVTEYYLNNGIWPENNTSAGVASSDKIKGKYVESVTVAKGVVTAQMASSNVNNEIKGKKLSLWAKRQAGSVKWFCGQPVKRADNAANDDVAKDDAADKIDTKHLPSTCRDKSSAVCTKH......... 126
8 9.000e-29UniRef50_P02974 Fimbrial protein n=264 Tax=Proteobacteria TaxID=1224 RepID=FMM1_NEIGO  ali  77  46LAEGQKSAVTEYYLNHGKWPENNTSAGVASPSDIKGKYVKEVEVKNGVVTATMLSSGVNNEIKGKKLSLWARRENGSVKWFCGQPVTRTD---DDTVADAKDGKEIDTKHLPSTCRDNFDA.............. 164
9 1.000e-28UniRef50_P57039 Fimbrial protein n=165 Tax=Neisseria TaxID=482 RepID=FMM1_NEIMA  ali  75  46LAEGQKSAVTEYYLNHGEWPSNNTSAGVASSTDIKGKYVQSVEVKNGVVTATMASSNVNNEIKGKKLSLWAKRQDGSVKWFCGQPVKRNDTATTNDDVKADTAANIDTKHLPSTCRDAASAG............. 170
10 1.000e-28UniRef50_A0A1D3HAL6 Pilin n=369 Tax=Neisseriaceae TaxID=481 RepID=A0A1D3HAL6_NEIGO  ali  66  1MAEGQKSAVTEYYLNHGEWPKDNASAGVASPTDIKGKYVQKVEVNNGVVTAQMNPSGVNKEIQGKRLSLWGRRENGSVKWFCGQPVKRDDTAAKAGTDNG-GKGKIETKHLPSTCRDKASDAT............ 123
11 3.000e-28UniRef50_Q59607 Pilin n=137 Tax=Neisseria TaxID=482 RepID=Q59607_NEIGO  ali  71  46LAEGQKSAVTEYYLNHGIWPENNGAAGVASPSDIKGKYVQSVTVANGVVTAQMKSDGVNKEIKNKKLSLWARREAGSVKWFCGQPVTRDNAGTDAVTADTTGKDKIDTKHLPSTCRDNFDA.............. 168
12 6.000e-28UniRef50_P05431 Fimbrial protein n=206 Tax=Neisseria TaxID=482 RepID=FMM1_NEIMB  ali  77  46LAEGQKSAVTEYYLNHGEWPGNNTSAGVATSSEIKGKYVKSVEVKNGVVTAQMASSNVNNEIKGKKLSLWAKRQNGSVKWFCGQPVTRDKAKAANTAAAAANGKKIDTKHLPSTCRDASDAS............. 170
13 1.000e-27UniRef50_A0A125WG42 Fimbrial protein n=136 Tax=Neisseriaceae TaxID=481 RepID=A0A125WG42_NEIME  ali  74  1MAEGQKSAVTEYYLNHGIWPGGNSSAGVATSSEIKGKYVEKVEVANGVITAEMKSSGVNKEIQGKKLSLWAKRQAGSVKWFCGQPVTRTANNTANDEVTAANGTDIDTKHLPSTCRDLHSAS............. 123
14 1.000e-26UniRef50_A0A1D3HKF3 Large pilS cassette n=16 Tax=Neisseria TaxID=482 RepID=A0A1D3HKF3_NEIGO  ali  72  1MAEGQKSAVTEYYLNNGIWPENNTSAGVASAADIKGKYVESVTVAKGVVTAQMASSNVNNEIKGKKLSLWAKRQDGSVKWFCGQPVTRAANNNDDVAKDDADK--IETKHLPSTCRDKSTAVCTKH......... 125
15 5.000e-25UniRef50_A0A1D3GG03 Pilin n=159 Tax=Neisseria TaxID=482 RepID=A0A1D3GG03_NEIGO  ali  71  18LAEGQKSAVTGYCLNHGIWPANNTSAGVASASEIKGKYVQKVEVAKGVVTAQMASTGVNKEIKNKKLSLWAKRQDGSVKWFCGQPVQRGAANDPKDAVTADTNGNINTKHLPSTCRDNFDAS............. 141
16 1.000e-23UniRef50_A0A0G4BXF5 Pilin n=54 Tax=Neisseria TaxID=482 RepID=A0A0G4BXF5_NEIME  ali  73  18LAEGQKSAVTEYYLNHGEWPGNNSDAGVASSTDIKGKYVQSVEVKNGVVTATMASSNVNNEIKGKKLSLWAKRQDGSVKWFCGQPVKRADT---DEVTADSGNDKIDTKL......................... 124
17 1.000e-23UniRef50_A0A1D3HF80 Large pilS cassette n=7 Tax=Neisseria gonorrhoeae TaxID=485 RepID=A0A1D3HF80_NEIGO  ali  71  267..........EYYLNHGKWPEDNDKAGVASASDIKGKYVESVTVEKGVVTAKMLSSGVNKEIKGKRLSLWGKRENGSVKWFCGQPVKRTDAKADTVTDVAAANEKIDTKHLPSTCRDESSLPGIA.......... 381
18 2.000e-23UniRef50_A0A1D3HFZ7 PilS cassette n=9 Tax=Neisseria TaxID=482 RepID=A0A1D3HFZ7_NEIGO  ali  75  1...........................MAASSKIIGKYVKQVEVKNGVVTATMNSSGVNKEIQGKKLSLWAKRQDGSVKWFCGQPVKRNAKDADDVTDDAGGKGKIDTKHLPSTCRDKSTAVCIETPPTAFYKNT 112
19 3.000e-23UniRef50_A0A1D3IPH5 Large pilS cassette n=42 Tax=Neisseria TaxID=482 RepID=A0A1D3IPH5_NEIGO  ali  64  119......SAVAGYCPNHGTWPENNGDAGVASSDKIKGKYVEKVEVANGVVTAQMNPSGVNNEIKGKKLSLWAKRENGSVKWFCGQPVKRESNNADADDVTDDTNGTIDTKHLPSTCRDKSTAVCTKH......... 239
20 1.000e-22UniRef50_H8ZZU2 PilS2 cassette n=72 Tax=Proteobacteria TaxID=1224 RepID=H8ZZU2_NEIME  ali  73  5......................NDAAGVASPSDIKGKYVQSVTVANGVITAQMASSNVNKEIKDKKLSLWAKRQDGSVKWFCGQPVQRANANGANTAATGKGTDKIDTKHLPSTCRDASSAVCIETPRADF.... 118
21 1.000e-22UniRef50_A0A2K8EYX9 Large pilS cassette n=1 Tax=Neisseria gonorrhoeae NG-k51.05 TaxID=1247414 RepID=A0A2K8EYX9_NEIGO  ali  69  295.....KSAVAGYCPNHGEWPENNDSAGVASASKIKGKYVKEVKVENGVVTATMASSNVNKEIQGKKLSLWAKREDGSVKWFCGQPVKRDAGATDDAGTDNGGKGKIETKHLPSTCRDKSTA.............. 413
22 2.000e-22UniRef50_A0A1D3JAQ0 Pilin n=28 Tax=Neisseria TaxID=482 RepID=A0A1D3JAQ0_NEIGO  ali  64  1...........................MASASKIIGKYVKQVEVKNGVVTAQMASSNVNKEIQGKRLSLWAKRENGSVKWFCGQPVKRGAADPKDAVTADTDNNKIETKHLPSTCRDESSAGCIETPRADF.... 105
23 6.000e-22UniRef50_A0A2T5LHZ4 Tfp pilus assembly major pilin PilA n=2 Tax=Luteibacter sp. OK325 TaxID=2135670 RepID=A0A2T5LHZ4_9GAMM  ali  36  270LADRAKTAVAEFYTSHGQMPVNNVAAGLALPDDIRGKYTASVTVDN-GTIVVIYANDANRNIHNDSLRLTPWVSGSQVNWRCGSD-------------------DIQKQYLPASCR................... 365
24 1.000e-21UniRef50_A0A2I8DBJ8 Uncharacterized protein n=5 Tax=Alcaligenaceae TaxID=506 RepID=A0A2I8DBJ8_9BURK  ali  27  87LGSGAKPAVIEYYANNGEYPVNNDSVGYSSA---VGNFVDSVNIQD-GNIVVRFNDKANKQLVNKMVVLSPLNPGQEIVIAKSSFILNLLGISDAVASSWNCYANIEQKYLPKSCREFSNNGNGENQPEENF... 218
25 1.000e-21UniRef50_A0A1E4Q257 Uncharacterized protein n=1 Tax=Rhodanobacter sp. SCN 68-63 TaxID=1660134 RepID=A0A1E4Q257_9GAMM  ali  30  33LADAAKTAVAEYRAQRGRWPTSNAATGLPLPPAMHGKYVDSISVGEQGTVTVHFGSEANAQIAGKTLELTPELENNAIRWSCHSDE-------------------IPAKNLPASCRQP................. 135
26 1.000e-21UniRef50_D6HB30 Large pilS cassette n=34 Tax=Neisseria TaxID=482 RepID=D6HB30_NEIGO  ali  68  152.....KSAVAGYCPNHGKWPENNDSAGVASASKIIGKYVKQVEVKNGVVTAQMASSNVNKEIKDKKLSLWARRQDGSVKWFCGQPVTRDNADNDDVKDAGNNG--IETKHLPSTCRDEPNA.............. 265
27 2.000e-20UniRef50_A0A1I0NKP8 Type IV pilus assembly protein PilA n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1I0NKP8_9GAMM  ali  37  46LADGAKTAVAEFYQNTGHFPKNNESAGLAGATSIKGQYVSQIQVGTSNGIITFAGPKSSDRIKGNTLVLSPKTNDGSIQWTCKSA-------------------DLKKNYLPTNCR................... 144
28 2.000e-20UniRef50_Q99274 Pilin (Fragment) n=37 Tax=Neisseria TaxID=482 RepID=Q99274_NEIGO  ali  64  39LAEGQKSAVTEYYLNHGEWPKDNASAGVASASDIKGKYVEKVEVKNGVVTAQMTPSGVNKEIQGKSLSLWARRQDRFVKWFCGQPVTRADDVSKPVPTPSPKTTPTPSTP--STCRQPAA............... 156
29 2.000e-20UniRef50_UPI0009E44720 pilin n=8 Tax=Neisseria gonorrhoeae TaxID=485 RepID=UPI0009E44720  ali  68  266.....KSAVAGYCPNHGEWPENNASAGVASPTDIKGKYVKEVEVKNGVVTAKMLSSGVNKEIQGKRLSLWAKRENGSVKWFCGQPVQRGAGAGADAVTADKDK-EIETKHLPSTCRDEPTA.............. 381
30 2.000e-20UniRef50_A0A1D3IQ95 Large pilS cassette n=28 Tax=Neisseria gonorrhoeae TaxID=485 RepID=A0A1D3IQ95_NEIGO  ali  68  274.....KSAVAGYCPNHGEWPENNASAGVASPTDIKGKYVKEVEVKNGVVTAKMLSSGVNKEIQGKRLSLWAKRENGSVKWFCGQPVQRGAGAGADAVTADKDK-EIETKHLPSTCRDEPTA.............. 389
31 5.000e-20UniRef50_A0A059EQC7 Uncharacterized protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A059EQC7_9MICR  ali  25  87LGSGAKPAVIEYYANNGEYPKNNNSVGYSSA---VGNFVDSVNIQD-GNIVVKFNDKANKQLVNKMVVLSPLNGGQEIVIAKSSFILNLLGISDAVASSWNCYANIEQKYLPKSCEREFNDGNGENQPEENF... 217
32 5.000e-20UniRef50_UPI00098670D1 DUF4339 domain-containing protein n=2 Tax=Rhodanobacter TaxID=75309 RepID=UPI00098670D1  ali  39  409LADGAKTAVAEYYANRQSMPSDNTSAGLAQSTSIAGKYVSSVDVSDGKITIAFDTLPANVMIRNDVLVLYPSPDSGGIHWRCGGPE-----------------TTVPQRYLPIACRG.................. 509
33 7.000e-20UniRef50_UPI000C33C155 pilin n=4 Tax=Proteobacteria TaxID=1224 RepID=UPI000C33C155  ali  86  1MAEGQKSAVTEYYLNHGEWPANNSSAGVASASDIKGKYVQSVEVAKGVITATMLSTGVNKEIQGKKLSLWAKRQAGSVKWFCGQPVTRDA............................................. 91
34 1.000e-19UniRef50_M4NBV0 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=11 Tax=Gammaproteobacteria TaxID=1236 RepID=M4NBV0_9GAMM :_  ali  38  48LADGAKSAVWDFISNTGRFPPNNQSAGLAENRSIEGSYVSSVDVTGGAIKVLYQGTKANTHINGGSIYLSPITHAGSIAWTCS-------------------ASTLDPKYLPSSCR................... 146
35 1.000e-19UniRef50_A0A2A3XG18 Uncharacterized protein n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A3XG18_9GAMM  ali  29  50LMSPVKAAISEYHITHGAFPDDNEQAGLSAPDQLSGRYVASIDVESGVTVITMQDTSVVSDLAGGTLVFDPNGEGGGINWECR----------------VGGDNEIDPKFLPSECR................... 153
36 4.000e-19UniRef50_A0A1D3IPS2 Pilin n=9 Tax=Neisseria TaxID=482 RepID=A0A1D3IPS2_NEIGO  ali  66  1...........................MASPTDIKGKYVKEVKVENGVVTATMKSDGVNKEIQGKKLSLWGRRENGSVKWFCGQPVKHDKAANDDDVTDDKNNNGIDTKHLPSTCRDTS................ 92
37 2.000e-18UniRef50_E4ZAF9 Class II pilin PilE n=61 Tax=Proteobacteria TaxID=1224 RepID=E4ZAF9_NEIL0  ali  49  46LAEGQKAAVVEYYSDNGTFPAQNASAGIATASAITGKYVAKVEVTGDAITSTMKSSGVNNDIKGKTLVLVGKQNSGSFSWECK-------------------KGTVDDKFLPSSCR................... 146
38 3.000e-18UniRef50_A0A1W9WZR2 Uncharacterized protein n=2 Tax=Beggiatoa sp. 4572_84 TaxID=1972449 RepID=A0A1W9WZR2_9GAMM  ali  25  46LASSLITTIVDYYSYHGKLPQSNEAADLPKPENLGGQYVKSMQIENGAIHVTFQEW---QRDIGSKLTLRPYPPTNALTWVCGY-----AKAVKGMTLIGDNKTDIAPKYLPLNCR................... 158
39 3.000e-18UniRef50_UPI0006C34493 pilin n=2 Tax=Alcaligenaceae TaxID=506 RepID=UPI0006C34493  ali  25  48LAEGAKPMITEYHATHGEYPTNSEAVGYSGAT---GNYVAAVEVHSDGNIVATMGNQASLKIQGKRVVLTPSLNGGSEITLSSASTIVEGSAYAADPSGWSCYSDVDSKYLPKTCRTISNGIDDSEP........ 178
40 3.000e-18UniRef50_I4VLY2 Fimbrial protein P9-2 Pilin n=23 Tax=Proteobacteria TaxID=1224 RepID=I4VLY2_9GAMM  ali  38  47LGSGAKAAVWDFVSNTGRFPSNNESAGLASTESISGKYVSSVDVSQGWIKVLYEGPKANRYISGKYLALSPVTHAGSIIWTCAP-------------------STLDRKYLPTSCR................... 145
41 4.000e-18UniRef50_A0A2A5CYR7 Pilus assembly protein PilA n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A5CYR7_9GAMM  ali  26  47LPAEAKSSVNEYYKATGRLPRNNREAGLAPAGAYRGHYVIGIEVENGAVHIELDSRSIGIR-EGRWVTFRPQTNDKDLVWEC---NDNLYAKHEGLTLQGDNRTDLQAKYLPASCR................... 162
42 4.000e-18UniRef50_A0A1G1F935 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A1G1F935_9BACT  ali  31  46MAEVAKKDIQDYYRAKGSLPKNNAQAGLPSADKFVGNFVKSIQVNDGAID-IMFGNRVNKNAESKLLSIRPAVVSGAISWVCGYAS-----VPKGMTVKGKNGSTILPRQLPVDCR................... 159
43 5.000e-18UniRef50_A0A1I3ZTE6 Tfp pilus assembly protein, major pilin PilA n=2 Tax=Rhodanobacter glycinis TaxID=582702 RepID=A0A1I3ZTE6_9GAMM  ali  39  315LAQGARVAVTEYYTSHGEFPADNEAAGLADGDSITARYVSGVHVVNGRIVVTYDTAGTNRTIRDKLLVLTPSPSGATLSWSCGD-------------------STLPDRDLPRGCR................... 411
44 6.000e-18UniRef50_A0A2E2K1H4 Prepilin-type cleavage/methylation domain-containing protein n=2 Tax=Cellvibrionales TaxID=1706369 RepID=A0A2E2K1H4_9GAMM  ali  26  44LVDGYKAAIEAYFRAAGSFPADNEQAGMPAPELLMGNYLQRVDVLD-GAMHLMMGNKFPASLQGSVVSLRPLLVEGSISWVCGYD-----EVPEGMKATADNRTDLEIKYLPLRCR................... 157
45 6.000e-18UniRef50_A0A0F8Z5U0 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F8Z5U0_9ZZZZ  ali  23  54LISLYKDKIAEFYTVNGVFPESNEQAGIPEPEKIIGNYLSAVEI-KKGGFHLLLGNKISSKLQGKTLTIRPVFVPESISWICGYD-----AIPEGMESPTSNNTDIEKQLLPLEC.................... 166
46 7.000e-18UniRef50_G2DP84 Uncharacterized protein n=7 Tax=Proteobacteria TaxID=1224 RepID=G2DP84_9NEIS  ali  48  46LAEGQKSAVTEYYADKGAWPADNAAAGVAAKADINGKYVESVEVSTANITAKMKGSGVNEDIKGKTLTLKAVKAGGSFKWECDTTK--------------DTTNGIPTKFLPSVCRPDAAKAST........... 159
47 1.000e-17UniRef50_A0A1Y6CWK7 Pilin n=1 Tax=Methylomagnum ishizawai TaxID=1760988 RepID=A0A1Y6CWK7_9GAMM  ali  26  108LGAPGKMAVTEVYASLGQFPRDNPAAGLPDPEQLIGNYTTGIAVEDGAIHIA-LGNRADPVINGKTISLRPAQVGDPLSWLCGY-----AEPVRGMVAHGVNRTSVPAAYLPVECR................... 221
48 1.000e-17UniRef50_UPI0009DD6875 hypothetical protein n=2 Tax=Rhodanobacteraceae TaxID=1775411 RepID=UPI0009DD6875  ali  30  170.ADPVKTAVAEHRLTTGKFPASNKAAGLDDGEALGNDYVSSVEVGQGGEITVNLDGKADAKLDGGQLILLPRVEGGQVGWTCSGE-------------------GIDEKYLPASCRDALPG.............. 274
49 2.000e-17UniRef50_A0A1D3IKI0 Pilin n=20 Tax=Neisseria TaxID=482 RepID=A0A1D3IKI0_NEIGO  ali  68  1...........................MASPSDIKGKYVQKVEVAKGVVTAQMNPSGVNNEIKDKKLSLWAKRQDGSVKWFCGQPVTRDDKANDTVADAADNDGKIDTKHLPSTCRDKASDAN............ 96
50 2.000e-17UniRef50_A0A1T5CSC4 Tfp pilus assembly protein, major pilin PilA n=5 Tax=Rhodanobacteraceae TaxID=1775411 RepID=A0A1T5CSC4_9GAMM  ali  30  631.ADPVKTAVAEHRLTTGKFPASNKAAGLGDGESLGNDYVSSVEVGQGGEITVNLDGKADPKLDGGQLILLPRVEGGKVGWTCSGE-------------------GIDEKYLPASCRDALPG.............. 735
51 2.000e-17UniRef50_A0A1V3PSE6 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1V3PSE6_9  ali  42  46LMDGGKTAVAEFYSNYGRLPGTNQSAGLATAASINGSYVKDVTVTSTGILTAEYASGANNAIDTKVLSLSPITTGGSMKWSCTNAL-----------------TTVPTKYLPSSCR................... 148
52 2.000e-17UniRef50_A0A154QWV3 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=11 Tax=Bacteria TaxID=2 RepID=A0A154QWV3_9GAMM  ali  36  48LGSGAKAAVWDFVSNTGRFPPNNQSAGMANNTSITGSYVSSVDVTGGAVKVLYQGPKANTHISGNYLLLSPVTHAGSITWTC-------------------TASTVDPKYLPIACRQ.................. 147
53 3.000e-17UniRef50_T0XUI1 Membrane protein containing RDD domain protein (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T0XUI1_9ZZZZ  ali  31  176MAESAETDVAQFYANTARYPADNASAGLPSAGSISGNYVAAVAVRD-GNILVQYGNRANAQISGKMLMLAPQAEDGSISWSCRGAGSAAALPAEQLPRIACG-----------SCRQ.................. 280
54 3.000e-17UniRef50_A0A0G9HEM8 Fimbrial protein n=17 Tax=Proteobacteria TaxID=1224 RepID=A0A0G9HEM8_9GAMM  ali  32  49.AAGAKSAVWEYRHNTGRFPSTNESAGLPVGTSISGKYVSSIDLQTTGAILIAYEPDANAVLQVSTITLSPIDNTGSIGWVCKS--------------------TLDNRYLPTTCRTN................. 146
55 3.000e-17UniRef50_E1VPC7 Type IV fimbrial biogenesis protein n=4 Tax=root TaxID=1 RepID=E1VPC7_9GAMM  ali  38  52LANEAKAGVADFNANRGRLPANNTSAGVALATSITGNYVTNVNVATSGAITITYGNKVNANITNGKLSLRAAKNAGGVVWVCGYATPPT-----GLTAVGANATSIQAKYLPSECRQ.................. 164
56 3.000e-17UniRef50_A0A1Y1R8L3 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y1R8L3_9GAMM  ali  37  50MASGVKAAVTEYYASEGTWPTSNESAGL--DNTLQGNAVTSVSVQNDGSILITYNIKVAS---GAQLLLQPSYSNGAIQWKC----------------ARVTTSTMKAKFLPSNCRNHTATPS............ 151
57 4.000e-17UniRef50_A0A117KIU5 Pilin n=13 Tax=Halomonas TaxID=2745 RepID=A0A117KIU5_9GAMM  ali  39  55LASSAKTAVSEYYVTNGEFPVDNATAGLSDDTDIKGSYVQSVTVGTGGITAKMASADVVGALIDKTLDFTPTASDGSITWKCG----------------PGATGGIPTQYLPASCRG.................. 161
58 4.000e-17UniRef50_A0A0G9H8M6 Uncharacterized protein n=1 Tax=Dyella japonica DSM 16301 TaxID=1440762 RepID=A0A0G9H8M6_9GAMM  ali  32  51LSEGPKLAVAEYYYSTGAFPTTEAEAGLQSSNAYAGKYVGHVDISRPGNVLVHFDNTANAAIAGLQLGFSAVITNGSIQWVCTDR----------------NINGIPLQYLPQTCR................... 155
59 4.000e-17UniRef50_A0A2A5CYF7 Pilus assembly protein PilA n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A5CYF7_9GAMM  ali  28  47MSEQLKDNIEVFYNKHHRMPRNNKEAGLPEPQHLISNYIKSVKVEN-GALHFQLGNKINQKLSDKILSIQPLTVDGSIDWGCGY-----ATAPDGMSKQGSNNTDIDHFYLPINCR................... 160
60 5.000e-17UniRef50_D4P899 PilA1 n=9 Tax=Proteobacteria TaxID=1224 RepID=D4P899_9NEIS  ali  34  46LAGGAKTSVTEYYSSNNAFPKSNTEAGLAAAADIKGNAVTSVGVSDNGVITVTFNEKVN---NNSTVIMTPTAENGSVKWDCK-------------------KGTLDPKWRPSECRGATGA.............. 144
61 5.000e-17UniRef50_A0A0G4BZ90 Pilin n=21 Tax=Neisseria TaxID=482 RepID=A0A0G4BZ90_NEIME  ali  74  133..........EYYLNHGEWPGNNTSAGVASSTDIKGKYVQSVEVKNGVVTATMASSNVNNEIKGKKLSLWAKRQDGSVKWFCGQPVTRANTATGANADDGTDNEKINTKHLPST..................... 240
62 6.000e-17UniRef50_A0A2G6JBY0 Pilus assembly protein PilA n=1 Tax=Neptuniibacter caesariensis TaxID=207954 RepID=A0A2G6JBY0_NEPCE  ali  30  3MASTIRENVTNYYVEKLDFPSNNEEAGVPQPNYLIGNRITGVVVESGAIHITM-GNKASKPLKGKVLSFRPAVVTGSIAWLCGYDDPVT-----GMQAVGDNKTDLDKEYLPAACRG.................. 117
63 8.000e-17UniRef50_G9ZG69 Pilin n=2 Tax=Cardiobacterium TaxID=2717 RepID=G9ZG69_9GAMM  ali  36  175LAGGQKAAVVETYAYRETWPQDNKEAGVADAFDIRGKYVKEVRIGQPGVITATLYNPVARELRGKKLSLEPRKEGNAYRWSCVS--------------------DIDSQYLPLSCRQ.................. 280
64 8.000e-17UniRef50_A0A1Q4FK36 Uncharacterized protein n=1 Tax=Xanthomonadales bacterium 63-13 TaxID=1895867 RepID=A0A1Q4FK36_9GAMM  ali  25  89..GDAKSAINEFHSRWGRMPADNREAGLREPEAVRGNYVRSLSVHDGVMVALMLGKDSDQQPIMRTLTFRPSVSGSPIIWSCAEQDPAAGAAYQAQGSIAAN--PVEAKWLPSICRG.................. 206
65 8.000e-17UniRef50_A0A2N1Z7V8 Pilus assembly protein PilA n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2N1Z7V8_9GAMM  ali  28  45MASGVRSKVNTHYEEHLDFPASNAAAGLPMPSQLIGNRITGVVLEQGAIHVTM-GNKASTALQGKTLSFRPAVVIGSISWLCGYD-----EAVEGMQAIGENRTDLESEFLPAICRQ.................. 159
66 9.000e-17UniRef50_UPI000A06074B DUF4339 domain-containing protein n=1 Tax=Dyella ginsengisoli TaxID=363848 RepID=UPI000A06074B  ali  32  391VARSAESAVAGYYAQHGDLPKDNADAGIGAADSLTGRYVSAVDVDAGKLVIHFDSPQATATLRGRVLVLEPHRDGGQLQWSCNSPE-----------------TTIRPQYLPVRCR................... 490
67 9.000e-17UniRef50_A0A238D070 Fimbrial protein P9-2 n=9 Tax=root TaxID=1 RepID=A0A238D070_THIDL  ali  36  74LATGAKVAVWDFYSQHGAFPGSNQSAGLAQPQSITGNYVKRVDAAN-GLITIVYGGNANTAIQNKTLYLSGKSSADGLLWTCTTAPGGTAP-----------ATAVPRQYLPSSC.................... 176
68 1.000e-16UniRef50_A0A251X8H3 Uncharacterized protein n=1 Tax=Thioflexothrix psekupsii TaxID=1570016 RepID=A0A251X8H3_9GAMM  ali  26  46LAEPLQRHLELIYQQHQRFPADNHQAGLPQPQQLIGNYVTKMWVENGAIHIT-YGHRINAHVAGKTLTLRPATVMESLSWLCGY-----AQAVPGMQAQGHNLTDIPSLYLSPECRS.................. 160
69 1.000e-16UniRef50_A0A2E7ILF4 Prepilin-type cleavage/methylation domain-containing protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E7ILF4_9GAMM  ali  28  55LIERYKGNLEAFYSATGAFPADNEAANMPEPDKIIGSYVQRVDVEN-GAMHLQFGKKFPESLSGKRLSLRPMIVEGSVSWVCGFD-----AVPEGMAATVENQTDLELRFLPLRCR................... 168
70 1.000e-16UniRef50_A0A259R5N7 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Xanthomonadales bacterium 14-68-21 TaxID=1970612 RepID=A0A25  ali  34  48LSAGAKEAVWDFMSNTGRYPSSNESAGLATNTSINGNYVSKVDVTGGKVIVEFKGPGANAKIQNETLVLSPVSHAGSIDWTCKP-------------------STLEGKYLPTLCRK.................. 145
71 2.000e-16UniRef50_A0A1Y0I8D2 Tfp pilus assembly protein, major pilin PilA n=2 Tax=Oleiphilus messinensis TaxID=141451 RepID=A0A1Y0I8D2_9GAMM  ali  26  52.....KLKIAEHYQHNGSMPQNNAALDLLAANTFTGAYTTSVEINQGAVHIT-LGNNVHPKLKNKILSIRPSPNTASMLWICGNS-----PVPSGLTASGSNLTTISSEYLPTICRD.................. 161
72 2.000e-16UniRef50_A0A0W1LH77 Pilus assembly protein PilA n=15 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0W1LH77_9GAMM  ali  29  44MAAAIREDVTVFYLENKRFPNNNEEAGVPASQYLIGNRVTGITIKNGAIHIA-LGNKASRPLQNTTLTFRPAVVEGSISWLCGFDQPVT-----GMKAIGENKTSVPKDLLPSAC.................... 156
73 2.000e-16UniRef50_C8N9J4 Fimbrial protein n=1 Tax=Cardiobacterium hominis (strain ATCC 15826 / DSM 8339 / NCTC 10426 / 6573) TaxID=638300 RepID=C8N9J4_CARH6 :  ali  45  51LVDAQKNAVVETRTNKGDWPSNNTEAGMGDPTKISGKYVEKVEVTSGGITATMKSSGIAATIQHKTLTLTPTETNGSYTWECSS--------------------NVGKMYLPAVCR................... 147
74 2.000e-16UniRef50_A0A2H1SF56 Fimbrial protein EcpC n=14 Tax=Proteobacteria TaxID=1224 RepID=A0A2H1SF56_XANCI  ali  33  44LASGAKVAVEEFHWAQSVSPTSNAQAGLGNADTIKGRYVSSVTVGADGVITVAFATGANESIRGSQLQLVPDSVAGSTVWRCDGA-----------------GTTLQAKYLPKACR................... 144
75 3.000e-16UniRef50_A0A059KLA2 Uncharacterized protein n=2 Tax=Sphaerotilus natans TaxID=34103 RepID=A0A059KLA2_9BURK  ali  29  37LSMEARDMVTEFYGTNSRWPDSNEAVGLVEPEKIAGNSVSSVTVGSAGIITIRFNSRV----QDGSLLLQPEAASGSIRWSCRIPS----------------SGGLSPRHVPAECRGS................. 134
76 3.000e-16UniRef50_A0A290S9I0 Type IV pilus assembly protein PilA n=19 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A290S9I0_9GAMM  ali  30  44MAAAIREDVTVYYLENRRFPASNEQAGVPASKFLIGNRVTGITVDNGAIH-ISLGNKASQLLQNTVLTFRPAVVTGSIAWLCGFDEPVT-----GMQAVGENKTTVPKEILPSAC.................... 156
77 3.000e-16UniRef50_F9U6P8 Uncharacterized protein n=3 Tax=Thiocapsa TaxID=1056 RepID=F9U6P8_9GAMM  ali  29  55.ASAAKVAVVSAY-SHGGLPGSNAEAGLSEAGEIESQYVKSIEIEEGGNIRVTFNATI-PQLEDKSVMLAATERGGAIDWCCYSP-------------------NIEARYMPASCRDSARCGG............ 155
78 3.000e-16UniRef50_A0A160N2P1 Uncharacterized protein n=2 Tax=Dyella thiooxydans TaxID=445710 RepID=A0A160N2P1_9GAMM  ali  31  280VARSAEAAVAGYYAQHGDLPKDNTDAGLGAADSLTGRYVSAVDVDAGKLVIHFDSPQATATLRGRALVLEPHGDGGQLQWSCDSPE-----------------TTIRPQYLPIRCR................... 379
79 3.000e-16UniRef50_K4KGU2 Tfp pilus assembly protein, major pilin PilA n=1 Tax=Simiduia agarivorans (strain DSM 21679 / JCM 13881 / BCRC 17597 / SA1) TaxID=111  ali  31  73LTEDFKSQVEAYYRMSGEWPENNNTLHMPDPERIIGNYVVAVTL-SQGALHIELGNKIGEGLTGRVLSLTPVYVPGSVSWVCGVS-----RIPDGMRAAGENLTDIEPAYLPNSCK................... 186
80 5.000e-16UniRef50_UPI000DD84208 hypothetical protein n=1 Tax=Oleiagrimonas sp. MCCC 1A03011 TaxID=1926883 RepID=UPI000DD84208  ali  28  371LAQMPKAAVARYMREKDRPPQDNAALGLPSPSQLAGRYVAEVKV-DYGDVTVRYNDRASPQVRDRHLLFTPELSHGVVIWRCLSP-------------------DLPHKYLPRSCR................... 466
81 5.000e-16UniRef50_A0A1P8FJP5 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium GR16-43 TaxID=1904640 RepID=A0A1P8FJP5_9PROT  ali  24  46LADVAKKGVNGFYAATGKMPANNEEATIPPADKIISQFVTAVTVKDGAVTLT-LGYNAGDSLKGKLVTVRPAIVPGPISWIC-----NEVPAPPKMELKGENKTDIQMNYLPVECRSESK............... 163
82 6.000e-16UniRef50_A0A1I2IJX8 Type IV pilus assembly protein PilA n=2 Tax=Dyella marensis TaxID=500610 RepID=A0A1I2IJX8_9GAMM  ali  36  48LATGAKTAVWDYVSNTGRFPSNNQSAGLATNTSIVGNYVSNVDVSGGLVKVKFQTAKANSHINTASLALSPVSHAGSITWTC-------------------TRSTVDPKYLPTSCRQ.................. 147
83 6.000e-16UniRef50_A0A1W9X0Y1 Pilus assembly protein PilA n=11 Tax=Bacteria TaxID=2 RepID=A0A1W9X0Y1_9GAMM  ali  29  46LADGVKKAITLYYVANKTFPENNQTAEVPAPEHLIGNFVTEVEVEDGAIHIT-LGNRINAHVENKVLSLRPAIVTDPISWLCGY-----AEPVDGMTAIGDEKTSVPSLYLSPACR................... 159
84 8.000e-16UniRef50_A0A2E5Q6L2 Uncharacterized protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2E5Q6L2_9PROT  ali  23  45LISSAKEAVAESLQESDSFCGTNEECGV--PADIVGSFVSSIAIGKGGVITATFGTNANNQLRDKTLAHTPTNTGGSVLWKCS--------------------GTMAQQYLPQGCEDLVAEEVKAHLPTQTF... 154
85 8.000e-16UniRef50_A0A1F4A4P3 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium RIFCSPLOWO2_02_64_14 TaxID=1797482 RepID=A0A1F4A4P3_9PROT  ali  25  48LAGPAQRAINEYYSRWGRFPHDNAAAGLAAPDLHQGRVVKSISVSDGLIEVLRDGEGGAKGNDWRSLYLRPAVNTGALVWVCPGHKAPDGFDAVGKTGDKA----ILPRYMPGSCR................... 164
86 9.000e-16UniRef50_A0A2E8L269 Prepilin-type cleavage/methylation domain-containing protein n=2 Tax=Candidatus Marinimicrobia bacterium TaxID=2026760 RepID=A0A2  ali  22  47.AAPFKVAISEYYFITGTYPAGNEALGISTGTDFAGSYVSKIRLGNNGTFEIVFGKEASEQLEKRSFWMVPNDEGGSISWRCVPHIAEEDST--------VTNGPIDEKYLPSSC.................... 163
87 1.000e-15UniRef50_A0A0S8C8H5 Oxidoreductase n=9 Tax=Betaproteobacteria TaxID=28216 RepID=A0A0S8C8H5_9PROT  ali  25  46LADIAKKRIEASWSAIQAFPPNNAAAGLPPADKIVSNYISSTTVQDGAIHIT-FGNSVHGAIMGKTLSVRPAIVTDAIAWVCG-----NAAAPDKMAVKGENRTDIPAGYLPFKCRARGTGTPAK.......... 168
88 1.000e-15UniRef50_A0A1D3FWM5 Pilin n=56 Tax=Neisseria TaxID=482 RepID=A0A1D3FWM5_NEIGO  ali  73  1...........................MASASKIIGKYVKQVEVKNGVVTAQMASSNVNKEIQGKKLSLWAKREDGSVKWFCGQPVQRADAKAD-TVADAANANGINTKHLPSTCRDKHSDT............. 94
89 1.000e-15UniRef50_A0A1H3F8V5 Type IV pilus assembly protein PilA/type IV pilus assembly protein PilE n=1 Tax=Delftia lacustris TaxID=558537 RepID=A0A1H3F8V5_9  ali  36  47LMSGAKASVTEYRLSKNVWPSNNQEAGLAQPASIQGTSVKSVQIDGSVIIASIRSISAPG---GGKIVLKGINSGDSVLWRCDSSA----------------GTTLQAKFLPPECR................... 143
90 1.000e-15UniRef50_A0A2A4QBE6 Pilus assembly protein PilA n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A4QBE6_9GAMM  ali  27  46.AGNLRQPITEYYVQNLEFPKNNFEARLPEPDKLISNKIAKVEVVDGAFHIL-LGNKVPKPLRGKYLTFRPAIVDGSISWLCGYSKPIK-----GMTAIGENKTDIDKMFLPSEC.................... 157
91 1.000e-15UniRef50_UPI00036F4D20 prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Thioalkalivibrio sp. ALSr1 TaxID=748658 RepID=UPI00036F4D  ali  23  47LVGPIRNATEEFYNQRGSFPDGNSEAGLMNPASYSGSYTEAIEVHDDGTIRALIGNDASNRVAGGYMVFSASTASSSLVWRCS------------------GQGNVPTRLLPSGCRED................. 146
92 1.000e-15UniRef50_UPI0008DBFCAF pilin n=3 Tax=Neisseria TaxID=482 RepID=UPI0008DBFCAF  ali  78  25...GQKSAVAGYCPNHGIWPENNTSAGVASASDIKGKYVKEVKVENGVVTATMASSNVNKEIKGKRLSLWGRREDGSVKWFCGQP.................................................. 106
93 2.000e-15UniRef50_A0A1H3D120 Type IV pilus assembly protein PilE n=1 Tax=Thiocapsa roseopersicina TaxID=1058 RepID=A0A1H3D120_THIRO  ali  32  57.ASAAKVAVVSAYSSGG-LPANNAAAGLSEAGDVQSQYVDSIQIEGGNIRVTF--NDTIPQLYGRSVMLAAKDRGGAIDWCCYSP-------------------DIEGRYMPATCRDDAR--CAETRPA...... 160
94 2.000e-15UniRef50_G9ZEA5 Pilin n=1 Tax=Cardiobacterium valvarum F0432 TaxID=797473 RepID=G9ZEA5_9GAMM  ali  37  33LAGGQKGMIIEAYVNKEKWPDDNTAAGMASADNMQGKYVQEVRVGGVITATLYNEEPVAPELRGKKLSLVPSKKDGAYQWDCVS--------------------NIDSQYLPEHCRH.................. 138
95 2.000e-15UniRef50_A0A238D066 Competence factor involved in DNA binding and uptake n=16 Tax=Proteobacteria TaxID=1224 RepID=A0A238D066_THIDL  ali  43  47LADGAKTAMTEYASNHGTWPASNASAGLAQAASINGNYVTSVDVGTTPGTITITGTKVNTNISGKTLLLVGASSGGSFSWTCK-------------------AGSISTNYLPSSC.................... 144
96 2.000e-15UniRef50_A4JHC4 Fimbrial protein pilin n=1 Tax=Burkholderia vietnamiensis (strain G4 / LMG 22486) TaxID=269482 RepID=A4JHC4_BURVG  ali  26  151LADGIKAIVDEYHSNNGSFPKSGDVVG---AVNTSGKYVGNTSIGDNGAIVTTFGNDVVKGLEGKYVALTPSVESGNLSWECSSNA--------------------PKDYLPKSCQSVGSGGNTGTT........ 255
97 3.000e-15UniRef50_A0A1Q4FK73 Uncharacterized protein n=1 Tax=Xanthomonadales bacterium 63-13 TaxID=1895867 RepID=A0A1Q4FK73_9GAMM  ali  20  50....ARDAVEAFHAKTRRMPVDNAEAGLPAAQQIIGNYIAQVEIEN-GTINVQFGNRANQAIISKWITLRPGVVAAAVSWLCG-----VALPVEGLTYSGSNRTDLEPQVLPIDCR................... 159
98 3.000e-15UniRef50_A0A2N2QEP6 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Betaproteobacteria bacterium HGW-Betaproteobacteria-9 TaxID=  ali  22  56LGMAAQKPVAEFYARWGVMPANNAQAGLPEARRLQGRYVDGIQVLSGGVLVISLGKQAPHDQSPYQLVMRPAVTAAAVAWVCQDGEEPEGTQTADLPATAKNL--MDRRYLPAACRKA................. 181
99 3.000e-15UniRef50_A0A0M1JJ45 Pilus assembly protein PilA n=2 Tax=Achromatium TaxID=44937 RepID=A0A0M1JJ45_9GAMM  ali  27  46LADSIKQSITEAYKEHKSFPANNLTAGVPEPKYLIGNFVTSIQVQEGAIHIT-LGNKINANAANKILTIRPATVTNSISWLCGYSKP-----VPGMQAVSTNKTNLPRMFLSYKCR................... 159
100 3.000e-15UniRef50_UPI0006941FF1 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Algiphilus aromaticivorans TaxID=382454 RepID=  ali  25  56.ASSLKTAVAESLMIDGRYPDSNEAAYLDPPEAIGGRYVRSVAIRPGGVIEVTFGD---PMIDGETLTLTLTPSGDGIRWECSA--------------------TLPANYLPASCRDGANAPPGD.......... 157
101 3.000e-15UniRef50_A0A1D8IRI0 Uncharacterized protein n=44 Tax=root TaxID=1 RepID=A0A1D8IRI0_9GAMM  ali  22  47LAGAAKSAIWDTYGNLGTFPTVGGNASYGLPATIAGTNTSNVTIGSQGLITITYKNNLGGAANGKTLLLQPWTHGGVIEWICYAANKPAQTPLS------TNTATLPGKYAPAICR................... 156
102 5.000e-15UniRef50_A0A0M1JK73 Uncharacterized protein n=2 Tax=Achromatium TaxID=44937 RepID=A0A0M1JK73_9GAMM  ali  25  46LVEVVQKEIADYYAHTGRFPENNASLDLPKPKQLRGQYVSSITIEQGAIHIRFKKIGINRNIKDRVVSYRPYPPTGLVIWSCG-------EVPKGFVAYGKNKTNLAAKFKP....................... 155
103 5.000e-15UniRef50_UPI000C34AD71 pilin n=2 Tax=Neisseria meningitidis TaxID=487 RepID=UPI000C34AD71  ali  70  3................................................ITAQMASSGVNNEIKGKKLSLWAKRQDGSVKWFCGQPVARDKADSATEVTADGN-DNINTKHLPSTCRDDSSAGCTGTPRADF.... 84
104 5.000e-15UniRef50_UPI00037B9D73 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Dasania marina TaxID=471499 RepID=UPI00037B9D7  ali  27  48LIAPFKKTIADYYLATATFPSNNSTAGLPDADKIMGNYLASVTVIDGALQLT-LGNKALPQINGKQVSIRPISPASPVSWVCGFD-----EVPAAMQVSGDNQTNVELLQLPISCR................... 161
105 5.000e-15UniRef50_A0A072TDY1 Pilin, putative n=4 Tax=cellular organisms TaxID=131567 RepID=A0A072TDY1_MEDTR  ali  26  33LAEGAKPMVAEYQAQHGSYPTSNADVGYTGAT---GKYVTDVQIHNDGNIVASFGGSANPKLAGKVVILTVTQASGSDITLSQATTMIDGSAVAQSTPGWYCYSSVEQKYLPSTC.................... 149
106 6.000e-15UniRef50_UPI0009C1740D prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Burkholderia vietnamiensis TaxID=60552 RepID=U  ali  25  48LVASLKAAVLDYQSNHGVYPSSNADIGFDGAT---GKYVQSVNVMSDGNVVATISNKANSPIVGKYIVLTPNASGGTDI-TLSFLDKILGVNSAVAGQEWACFSNADQQYLPSSC.................... 158
107 6.000e-15UniRef50_D6CKJ4 Fimbrial protein (Pilin) n=25 Tax=root TaxID=1 RepID=D6CKJ4_THIA3  ali  29  47LAGGAKNAMWDYYAQHGVFPNSNASAGLTNPATISGNYVSSIAVSGNGLVTITYGNHANANLSGKTLYLAGTGSQGALSWVCTTAPGGT-----------PNANGVPRVYLPTSC.................... 153
108 7.000e-15UniRef50_A0A259R616 Uncharacterized protein n=1 Tax=Xanthomonadales bacterium 14-68-21 TaxID=1970612 RepID=A0A259R616_9GAMM  ali  34  404IARDAEAAVAGYYARHGEMPNGNTDAGIGEASSLTGRYVSSVDVEAGRLVIAFDSPRAAPALRNRVLVLEPHRDGGPWRWTCDNPE-----------------TTIQARHLPMTCRS.................. 504
109 8.000e-15UniRef50_B6SE74 PilA2 n=118 Tax=Proteobacteria TaxID=1224 RepID=B6SE74_9NEIS  ali  31  46LAGGAKTSVAEYYASHNQFPANNVTAGLATANQIKGSSVHSLTVTD-GVITVVFNNKVAAAGKN-SLVLTPSVAEGSITWDCH-------------------GGTLDGRLRPSECRN.................. 142
110 8.000e-15UniRef50_UPI0009C1A590 hypothetical protein n=1 Tax=Metallibacterium scheffleri TaxID=993689 RepID=UPI0009C1A590  ali  30  84.....RIDVVQFYAKTRRYPADNASAGLPAASSISGRYVAAVAVRD-GNILVQYGNAANTRISGKMLMLAPQAADGTLRWSCQGL-------------------DLPRRYLPNSCR................... 174
111 9.000e-15UniRef50_UPI0009866EEF hypothetical protein n=1 Tax=Marinicella sediminis TaxID=1792834 RepID=UPI0009866EEF  ali  21  161.ASMIKTMVAEFYLTEGRFPRSNTILGLQQPTAYANEQVKSITVGKGGRITIVYT--ALSGKDNGAINLTPKIKNGQLEWRCSSWDFEDIRDTMPSCFYG................................... 257
112 9.000e-15UniRef50_E3D507 PilS cassette n=16 Tax=Neisseria TaxID=482 RepID=E3D507_NEIM7  ali  71  3......................................................SSNVNNEIKDKKLSLWAKRQDGSVKWFCGQPVTRAAKAAADGVTADSGNEKIDTKHLPSTCRDDSSVVCTKTPPTAFYKNT 85
113 1.000e-14UniRef50_UPI00035E7082 prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Rudaea cellulosilytica TaxID=540746 RepID=UPI00035E7082 :  ali  26  61..GDAKVAVNEFHARWGRMPADNREAGLRAPEALRGKYLRRLDVAGGVLVATELGHDLAAGARERTLTLRPWVNAGSILWSCGEYDPK--APPGYRVVGDLAENPVEAKFVPGVCRK.................. 178
114 1.000e-14UniRef50_A0A257CV80 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Burkholderiales bacterium PBB3 TaxID=2015565 RepID=A0A257CV8  ali  24  46LAKIAKAPIATMWQGLQQMPKDNAAVGLPAAEKVVSTMVTSLTVEDGAIHIT-FGNQANAAIKGKVLTLRPAVVEDAVSWLCG-----HAPVPDKMTAKGQDKTDIPAPLLPLNCR................... 159
115 2.000e-14UniRef50_UPI0009EE491F hypothetical protein n=1 Tax=Luteibacter rhizovicinus TaxID=242606 RepID=UPI0009EE491F  ali  29  683.AYPVKLAVAERRLSTSKFPANNAAAGLGKPETLGNDYAGSVEVGQGGEIVVTLDATTDQKLDSGQLILTPKVDGKVITWTCS-------------------GDGIDPKYLPQSCRDE................. 784
116 2.000e-14UniRef50_UPI000DBE1049 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Salinisphaera halophila TaxID=1304158 RepID=UP  ali  26  49..GSIRPQIAEFYASTGHFPTSNESAGIQAPTSITGKYVTSVDVGSTNKKAVTFGNAANEVLSGHTIVYSMIATGSSIELQCT------------------DAGDVPTQYLPSDCRNN................. 149
117 2.000e-14UniRef50_A0A258MS28 Pilin n=2 Tax=Polynucleobacter TaxID=44013 RepID=A0A258MS28_9BURK  ali  20  50LSSGAKLAVTEAFASRGTVPMD--EATQGSFTFVPTRSVKLIEITPSGSIAIDFQNNVAPDNKN-TLHLIPTNDPDANVPKAIDLSKPEGSTWAGGWSCRSTETNLLPQLLPSECR................... 162
118 2.000e-14UniRef50_A0A1D3EQ69 Pilin n=27 Tax=Neisseria TaxID=482 RepID=A0A1D3EQ69_NEIGO  ali  70  1...........................MASSSSIKGKYVKSVTVAKGVVTAQMASTGVNKEIKGKKLSLWARREAGSVKWFCGQPVKRGDDA-------VTDANKIETKHLPSTCRDPFSAS............. 88
119 2.000e-14UniRef50_UPI00098D3FD3 DUF805 domain-containing protein n=1 Tax=Wohlfahrtiimonas populi TaxID=1940240 RepID=UPI00098D3FD3  ali  23  225LASSAQSAVIDYYREHNQYPTSNQQTGLPEARNIQNHAVSAIEVNRNGNITIQF----NDKLQYDTIIVTPHISADSVQWRC-------------------NQGTLSQRYRPLKCRK.................. 318
120 3.000e-14UniRef50_UPI0005C15523 pilin n=1 Tax=Algiphilus aromaticivorans TaxID=382454 RepID=UPI0005C15523  ali  28  48LLGPVKMAVSEYHAQHGRMPQSSNELGLPASTATSGEYVERIWWNNSEREIRIRYGFF--PIKGKLLVLRAEVSNGTLRWRCTTPA---------------GGDAIPSIYLPASCRDGAS............... 160
121 3.000e-14UniRef50_A0A084IRG6 Class II pilin PilE n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A084IRG6_9GAMM  ali  25  58LAQPLKQAVAEYYSTHGHLPKSNSWNGVGNDGAASGRYVQRIWWHNDPDAPGIYIKYSGGSIQDRVVYLNADFGSGAIRWDCTAPAEDDSTNPG-----------VPADDLPASCR................... 170
122 4.000e-14UniRef50_A0A2M9E8U7 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Xanthomonadaceae bacterium NML91-0213 TaxID=2032582 RepID=A0  ali  27  77VAGGVKTALAEFHADHGSWPTGHAALPLASPASISGRYVSATSVGSVGRITIAYATAASSAIRGHALVLVPQISDNSLHWTCER--------------------TMASLYRPALCR................... 173
123 4.000e-14UniRef50_UPI00082511FE hypothetical protein n=1 Tax=Hydrogenophaga flava TaxID=65657 RepID=UPI00082511FE  ali  23  42LGQAAQKPVVEFYARWGVMPANNAQAGLPEARRLQGRFVDGIEVLPGGVLVISLNARAMAGKSGFHLVLRPATKPGPLAWVCQFGDGLEGLQVADMPAAATN--PMAGRYLPAACRKAA................ 167
124 4.000e-14UniRef50_A0A251X8H7 Uncharacterized protein n=1 Tax=Thioflexothrix psekupsii TaxID=1570016 RepID=A0A251X8H7_9GAMM  ali  29  57........ITEYYAFYGTFPQDNAEAGLRESDHFYGHYVKNITVENGAIHLELIDSKFSEEEGNAMLTLRPTLTQEGLSWTCGYLNPL-----PHETVYGVNKTNANPNFLPLECR................... 169
125 4.000e-14UniRef50_A0A2D6CL64 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Acidiferrobacteraceae bacterium TaxID=2024893 RepID=A0A2D6CL  ali  29  44LFGTIKTAIGVYYNTEGKFPTSNVKAG--APENVSGKYVDSIETGAKGVVAITLKEGVHDAIAGTSFKMTPSASGGSINWTC-------------------NPTTIDIKYLPGTC.................... 140
126 4.000e-14UniRef50_X5ENS5 PilS cassette n=85 Tax=Neisseriaceae TaxID=481 RepID=X5ENS5_NEIME  ali  80  3......................................................SSNVNNEIKDKKLSLWAKRQDGSVKWFCGQPVTRTAADSDDVAAAGKTADNINTKHLPSTCRDASSAVCTKTPRADF.... 80
127 5.000e-14UniRef50_A0A2A2T542 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Comamonadaceae bacterium NML91-0035 TaxID=2029113 RepID=A0A2  ali  39  46LASSARSAMHEFHDRAGAWPSSNMSAGLASPGSISGKYVASVTISGPNIVAQMRSSNVTAGLAGKTLTLTTSVPNGSYVWACSS--------------------TADKVYLPSSC.................... 141
128 5.000e-14UniRef50_A0A1H2FH86 Type IV pilus assembly protein PilA n=8 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1H2FH86_9PSED  ali  30  45MAGSIRENVDNYYVEMLEFPQDNEVAGVPAPGYLIGNRITGVVVEAGAIHVTM-GNKASQPLQGKVLTFRPAVVKGSVAWLCGYDEPVT-----GMEASGSNLTDIGKEFLPAACRG.................. 159
129 7.000e-14UniRef50_A0A1H2FGX8 Type IV pilus assembly protein PilA n=1 Tax=Pseudomonas salegens TaxID=1434072 RepID=A0A1H2FGX8_9PSED  ali  22  33MAGTLREDVTSYYVQRQAFPEDNEMAGIPEFDFSSYYRISALIVESGAIHVT-LGNSAYESLHGKVLTFRPAVVAGPIAWLCGYDEPVA-----GMTVFGSNKTDLDRGFLPAVCRG.................. 147
130 7.000e-14UniRef50_A0A1W9LAD2 Uncharacterized protein n=1 Tax=Beggiatoa sp. IS2 TaxID=1934247 RepID=A0A1W9LAD2_9GAMM  ali  25  44LTQNVTRMITEYYAYYGKFPLNNQDLVLPAPEALYGHYVKSIQVKNGTIYVTFSDPTLAGILTLRPAILTADLPVYSLIWVCG-----HAQAPAGTHFMDEDNTTIPYKSLPLLC.................... 153
131 8.000e-14UniRef50_A0A1Z8TZT7 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z8TZT7_9PROT  ali  26  46LVTVAKTAISDYYSEHGVVPPATEALGLPRWDTISGKYVFWILEHKHAKRAAVRTDDVHSAIRDKNFYLIPDESAGSLVWRC-----RCNWVADLTAPCGEGTAFVDEKCLPAVC.................... 165
132 1.000e-13UniRef50_A0A1V5FSK8 Fimbrial protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1V5FSK8_9PROT  ali  23  114.ATFAEDAVQLFHTKTHRMPSNNVEAGLPPAEQILGNYVARLEVEQGAIH-IRFGNRASRALADKWLTLRPGTSPNAISWLCG-----VAHPVSGLDYSGVNRTDIEARQLPLDCR................... 226
133 1.000e-13UniRef50_A0A1T2L0L9 Uncharacterized protein n=1 Tax=Solemya velesiana gill symbiont TaxID=1918948 RepID=A0A1T2L0L9_9GAMM  ali  26  73LVEPVRVGMTEFYTTYGRWPANNQEAGVSDVSGIEGDYVQSVDIYQQSYILIFYSTAEMPELRSATFKPTAVADGGSIEWDC---------RPSVSVGKFWNQYEVKQKYRPSRCRD.................. 197
134 1.000e-13UniRef50_UPI000694834E hypothetical protein n=1 Tax=Oleiagrimonas soli TaxID=1543381 RepID=UPI000694834E  ali  25  368LAFAPREAVARFMRDKDRPPEDNATLGLPAPTSITGRYVAEVKV-DYGDVTVRYGEHAASVVRDRHLLYTPELSHGVVVWKCLSP-------------------DLPRKYLPRSCR................... 463
135 2.000e-13UniRef50_UPI00098D7460 hypothetical protein n=1 Tax=Wohlfahrtiimonas larvae TaxID=1157986 RepID=UPI00098D7460  ali  36  635LATTAKLASTEYYATMGQWPSDNEEAGLADPQFITGQAVNGIAVTGGGQVYISYNYKV---QDEGYLILQADPTGGSVNWYCYQ-------------------TNLDAKVLPTVCRND................. 731
136 2.000e-13UniRef50_A0A1D3G3P3 Pilin n=3 Tax=Neisseria gonorrhoeae TaxID=485 RepID=A0A1D3G3P3_NEIGO  ali  78  1MAEGQKSAVTEYYLNHGIWPKDNTSAGVASPSNIIGKYVQSVTVAKGVVTAKMKSDGVNKEIKGKRLSLWA................................................................ 72
137 2.000e-13UniRef50_UPI0009E4C9E5 pilin n=12 Tax=Neisseria TaxID=482 RepID=UPI0009E4C9E5  ali  73  46LAEGQKSAVTEYYLNNGKWPANNGDAGVASASKIIGKYVKEVKVEKGVVTAEMKSDGVNNEIQGK...................................................................... 110
138 2.000e-13UniRef50_A0A2E0J1T9 Pilus assembly protein n=3 Tax=Salinisphaera TaxID=180541 RepID=A0A2E0J1T9_9GAMM  ali  27  55LAGPVKTAVTEYYSVHGRLPVVENNNWLSDTGAASGNYVKRIWWNNNATTPSIRIRYAGFPIDDALLFLEATXGDGAISWNCTAP----------------GSGGVPERYLPASCR................... 165
139 2.000e-13UniRef50_L0GWB0 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Thioflavicoccus mobilis 8321 TaxID=765912 RepID=L0GWB  ali  33  53LASRAKVAVVDSYQDSRSLPADNAAANLPAPEAIQGKYVGSVAVEDGNILVTF--NDAVSQLEGRSLILQASANEGAVNWCCYSP-------------------DIAPRLLPSNCRDSAGCLSGATTP....... 159
140 4.000e-13UniRef50_A0A1Y1SD93 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Oceanococcus atlanticus TaxID=1317117 RepID=A0A1Y  ali  25  77IVGPVRRAVDEHWAQTGQLPASNAAVALDAPGQYAGRYVSGIEVIENGVIQVSLDD---PGLQFGQLLFTPSTAADSLRWRCSSP-------------------NIAPQHLPKDCR................... 172
141 5.000e-13UniRef50_UPI000D3CA506 prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Luteibacter sp. OK325 TaxID=2135670 RepID=UPI000D3CA506 :  ali  29  37.AYPVKLAVAERRLATGKFPANNAAAGLGKPETLGNDYAGSVEVGQGGEIVVSLDATTDPKLDSGQLILTPRVDGKAITWTCS-------------------GDGIEPKNLPQSCRDE................. 138
142 5.000e-13UniRef50_B3PGP1 P(-)rp(+) fimbrial protein n=10 Tax=Gammaproteobacteria TaxID=1236 RepID=B3PGP1_CELJU  ali  23  59LIEDYKGLVAFYHKTTLKFLSDNQEAGIPEADKLLGNYVDRIELEKGAFH-LHFGNKAHPNLKEKWLSVRPVVVKDSMSWICGNS-----AVPEGMQAIGDNKTNIDIKDLPLSCR................... 172
143 6.000e-13UniRef50_A0A2E7WP84 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Acidiferrobacteraceae bacterium TaxID=2024893 RepID=A0A2E7WP  ali  32  33LVETAKSAVAEYHAINGKFPDSNTKAGIANHNDIKGAYVTQVKIGKYSGIRVRLTXNXKTWGRXAXIFLMPSAQGGSISWNC..................................................... 119
144 6.000e-13UniRef50_UPI000C330BCE pilin n=3 Tax=Neisseria TaxID=482 RepID=UPI000C330BCE  ali  77  1.............MNHGEWPGDNSSAGVATSSEIKGKYVKSVEVKNGVVTAQMASSNVNNEIKGKKLSLWAKRQNGSVKWFCGQPVTRDKAKDDAV....................................... 83
145 7.000e-13UniRef50_Q07564 Fimbrial protein EcpC n=36 Tax=Proteobacteria TaxID=1224 RepID=ECPC_EIKCO  ali  44  47LAGGQKGAVSEYYSDKGVWPADNAAA--GIAATVNGKYVNSVVVSAAGITATMKSTGVAKGVQGKTLALKGTANDGSFSWECSSNA--------------------DAKYLPSSCRNAATPTPT........... 152
146 8.000e-13UniRef50_A0A2M8VQ35 Type IV pilus assembly protein PilA n=11 Tax=Burkholderiaceae TaxID=119060 RepID=A0A2M8VQ35_9BURK  ali  22  66LSSSAKLAVTEAFASRGT--VSMSEATDGSFTFVTTRSVKLIEITPSGAIAIDYQSNVAPEGKN-TLHLIPTNDPDSNIPRAIDLSKPEGATWAGGWSCRSTETNLLPQLLPSECRITGS............... 182
147 8.000e-13UniRef50_A0A1I4XZG3 Pilin n=2 Tax=Dokdonella immobilis TaxID=578942 RepID=A0A1I4XZG3_9GAMM  ali  20  74...SARMAVTEFYMNSGRMPASNAEAGLPEPGSYKGQSLRSLEVDEGGELILTFD--AESGVDGGTIEWLPDLTGMGLQWRCRTRDFPQIVRALPDCD-----------YVPAS----ATDVATKRP........ 183
148 1.000e-12UniRef50_A0A1M3P3R4 Uncharacterized protein n=1 Tax=Rhodanobacter sp. 68-29 TaxID=1895823 RepID=A0A1M3P3R4_9GAMM  ali  31  193.ATPEKTAVETYLQDHGALPQDNMAMGLSPSVDMRDRHVSEVKIFKGSIM-LKFDESVGAPLRGRLVMLIAVRRSSAVSWHCASP-------------------DIDDRFLPVACRKYS................ 290
149 1.000e-12UniRef50_A0A1W1YL15 Type IV pilus assembly protein PilA n=2 Tax=Polynucleobacter sp. VK13 TaxID=1938817 RepID=A0A1W1YL15_9BURK  ali  18  54LASSAKMIVSEAYAANG--PSSMVEATKNSFKFKPTTGVNDITIEDTGAILIEFSDAVAPA-EHNLLILYPSNNPKLDSSAIDLANKKLAEAWAGGWSCKGNGATISKKLLPAECR................... 166
150 1.000e-12UniRef50_A0A1E4KAH8 Uncharacterized protein n=2 Tax=Xanthomonadales TaxID=135614 RepID=A0A1E4KAH8_9GAMM  ali  25  41.AEAYKTAIAEYYRTTGKLPADDDLDDGEAQKYLNGYYV------DAGAVVLQFGDEAKKSLADTTLVLKPYALNGSLVWQCGDGAVDADAEALSETGE---TTTTPAKLLPQSCR................... 149
151 1.000e-12UniRef50_A0A080NIA8 Fimbrial protein n=18 Tax=Proteobacteria TaxID=1224 RepID=A0A080NIA8_DELAC  ali  36  47LAASAKTAVSEHRLSQGTWPATSAAAGYTSPN---TKYVSGITIQDGLITITYKTSGSGVASGNDKLVLSALSVVGAVDWKCKRPA----------------ANPVDAKYLPANCRQS................. 147
152 1.000e-12UniRef50_A0A2D7VMZ6 Prepilin-type cleavage/methylation domain-containing protein n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A2D7VMZ6_9GAMM  ali  31  57LAGAVKTAVAEYHQTNSAWPESNEEAG--ANADYVGKYVASVEVTDPSVITVTMGPDVSTDIRSKTLTITAAASAGSVTWTC----------------DGAGADPIADSYLPAACK................... 161
153 2.000e-12UniRef50_A0A238DWT0 Fimbrial protein EcpC n=10 Tax=Proteobacteria TaxID=1224 RepID=A0A238DWT0_9BURK  ali  38  48LADGAKTAITEFASNSGKWPTTNSAAGLALAAAITGNYVASVDVGTTTITVTFNTTKANTNIQGKTVLLVGSSSAGAFGWTCK-------------------AGTISNTYLPSSCK................... 146
154 2.000e-12UniRef50_A0A1E4NP64 Uncharacterized protein n=2 Tax=Xanthomonadales TaxID=135614 RepID=A0A1E4NP64_9GAMM  ali  25  244.....RALIAQYIGERGALPRSNADLGLPRPETIQARYVSSIRVAD-GKVVVTYGNEAARAIHGGHVVISPVGNAAMLRWLCSSP-------------------DIRETLLPSNCRD.................. 335
155 2.000e-12UniRef50_A0A0Q6M8I0 Oxidoreductase n=17 Tax=Betaproteobacteria TaxID=28216 RepID=A0A0Q6M8I0_9BURK  ali  28  64..............TTKTLPVDNAAAGLPASDKIVSTLVSAVAVESGAIQIT-FGNQANGAIRGKTLTLRPAVVEDAVSWVCGNS-----AVPAQMTAKGLNKTDVPANFLPVNCR................... 163
156 2.000e-12UniRef50_A4SZX7 Fimbrial protein pilin n=27 Tax=Betaproteobacteria TaxID=28216 RepID=A4SZX7_POLAQ  ali  21  55LSSSAKLAVTEAFASRGTVPMDDATNG--SFTFAPTRSVKLIEITPSGAIAIDYQISVAPEGKN-TLHLIPTNEPDANTPKPVDLSKPEGATWAGGWSCRSTETNLLSQLLPSECR................... 167
157 3.000e-12UniRef50_A0A2T3DZW3 Prepilin-type cleavage/methylation domain-containing protein n=4 Tax=Acinetobacter TaxID=469 RepID=A0A2T3DZW3_9GAMM  ali  29  45LSSGLKTAVGDFYSTKGVWPVDNAEAVCAAATDNRGNYVSQVAVDNGNIVVSYSKTKANADVDGKFLTLRPGVDNANITWVCGTATAPSNLT---MATAPSNATNVESRYLPASCK................... 173
158 3.000e-12UniRef50_UPI000B5A8522 hypothetical protein n=1 Tax=Granulosicoccus antarcticus TaxID=437505 RepID=UPI000B5A8522  ali  20  39LTSPVKLRVSDHYIKRGIMPNDNTAAGLPPPKSIYGTSVKRVGINRGGVLIVDFEDKIGSKAMTFTPSINPV--SGLLSWNCTSDSINPSVLERLKPNCT---------YLPAS..................... 141
159 3.000e-12UniRef50_A0A1T4X5C7 Type IV pilus assembly protein PilA n=1 Tax=Thiothrix eikelboomii TaxID=92487 RepID=A0A1T4X5C7_9GAMM  ali  32  44LASNVKFAVYEYRHHKGFWPPDNLSADLPMASSINGNATRSVTINN-GIITIAYRTQVGS---GQSIVFTPTIDNGSILWQC------------------KTGGTVPAKYRPQNCR................... 138
160 4.000e-12UniRef50_A0A193LI28 Uncharacterized protein n=1 Tax=Woeseia oceani TaxID=1548547 RepID=A0A193LI28_9GAMM  ali  23  49.AASVKVPIVDTFTTEGRPPSGRQDVGLAAATDSQGNYVSAMNIVN-GRIDITFGNNAHPAIFGESLSVTPYATPGAISWRCGYASANGGPLTGGGITAAYQAGSIEERYLPSNCRG.................. 167
161 4.000e-12UniRef50_UPI000BBDE061 prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Wohlfahrtiimonas populi TaxID=1940240 RepID=UPI000BBDE061  ali  34  37LSTAAKIASTEYFAAQGEWPTDNEEAGLADPELITGQAVNGIAVTGGGQVYISYNYNV--QDEGYLILQGEPTESGSVNWYCYQ-------------------TNLPEKVLPATCRNE................. 133
162 4.000e-12UniRef50_A0A2W5MM30 Uncharacterized protein n=1 Tax=Rhodanobacter denitrificans TaxID=666685 RepID=A0A2W5MM30_9GAMM  ali  19  75.IAGVKTAVTEYYQVHGRMPAGNAEAGLLDAQAYRGRSLRALSVREGGRIELSFD--ALSGRDGGVIAFVPDPGAAAVVWRCTTTDYPRILRTIPSCEYRAVDSTAP............................ 181
163 5.000e-12UniRef50_UPI00040DE006 NINE protein n=1 Tax=Zooshikella ganghwensis TaxID=202772 RepID=UPI00040DE006  ali  27  270....AKEQLALYIQANNSFPESNTQAGL--PETMGNEIVSSIQVSKGGVLTVKFHKEVTHQ-PGQTIKLRPSLVNGQVEWDCL-------------------GGNLAPKYRPSTCRSSSDA.............. 364
164 5.000e-12UniRef50_A0A2G6EQK9 Pilus assembly protein PilA n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2G6EQK9_9GAMM  ali  23  34.SEQLQGNINQFYKETQGFPADNKAAGLPAPKQLISPEIAKVDVENGALQIT-FRSTTHQALADKQLSLRPVYVKDSVSWICG-----HTAVPEGMSVAGINRTDLPVAFLPVACRDTTKSVALADAPVQT.... 161
165 5.000e-12UniRef50_A0A1W6LFC7 Uncharacterized protein n=5 Tax=Rhizobacter TaxID=212743 RepID=A0A1W6LFC7_9BURK  ali  18  53....ARGAIDARYVATKTFPADNVEAGLPPPDKIVSNHLSSVAVAD-GALVLVFGNAADAALKGKRLSWRPAFVEGPLVWLC-----AAAPVPGNMTAQGDDVTDVPARYLPLRCQNTAPKP............. 168
166 5.000e-12UniRef50_A0A2G6EHS7 Uncharacterized protein n=2 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2G6EHS7_9GAMM  ali  18  39ITSPVKLRVADHYVTQGVMPHDNADADLPRPDSIFGTSVKRVAINRGGVIMVDFDEEIGAQAMAFTPTI--STVSGLLSWRCTSDSIDEAVLKKLKPDCD---------YLPAT..................... 141
167 6.000e-12UniRef50_J0KNL6 Tfp pilus assembly protein PilE n=6 Tax=Acidovorax TaxID=12916 RepID=J0KNL6_9BURK  ali  30  37MVEFVKQAVAVHYALKKTMPADNAAAGLPPEDRIVSTNVAKVTVAGGAVNIV-YGNKANKAIAGKVLTLRPAIVPDPIAWVCG-----KAKVPDKMTAQGPDATNIPAIATPLDC.................... 149
168 6.000e-12UniRef50_A0A1Y0I8N3 Tfp pilus assembly protein, major pilin PilA n=1 Tax=Oleiphilus messinensis TaxID=141451 RepID=A0A1Y0I8N3_9GAMM  ali  25  38....LRGKVYSFYKVNGTFPKDNEEAGIPVANKLIGNYVTRTDLIDGAFHVT-LGNRANKKLVGKTISYRPAVVKDSISWLCGQ-----AEAVEGMVAVGTNETTIKPPLLPYGC.................... 146
169 6.000e-12UniRef50_H8ZZT4 PilS3 cassette n=89 Tax=Neisseria TaxID=482 RepID=H8ZZT4_NEIME  ali  66  3......................................................SSGVNNEIKDKKLSLWAKRQDGSVKWFCGQPVTRADTDTDTAVTAASDK-QIDPKHLPSTCRDESTAGCTNHPSIA..... 77
170 6.000e-12UniRef50_UPI0009BE30A4 prepilin-type N-terminal cleavage/methylation domain-containing protein n=2 Tax=Burkholderia cepacia complex TaxID=87882 RepID  ali  31  67LAEGFKSGVSEFYANNGIFPK-LSDLGMSGA---LGKWVADTSIESNGVIVATFNSDVVKGLSGKTLSLTPSISAGNLSWACSSNA--------------------PQDYLPKSC.................... 158
171 7.000e-12UniRef50_A0A1C6M7Q0 Type IV pilus assembly protein PilA n=2 Tax=Chromobacteriaceae TaxID=1499392 RepID=A0A1C6M7Q0_9NEIS  ali  31  46LAGGVKTSVEEYYGTFNQWPNTNASAGLQSPNSYWGESVTELRLVASGSVAMIRMQLNDKVVSGAYVWLIPDPVSGSFRWQCQGDNNLTS-------------------LLPSNCRG.................. 144
172 8.000e-12UniRef50_W0TQS1 Uncharacterized protein n=1 Tax=Thiolapillus brandeum TaxID=1076588 RepID=W0TQS1_9GAMM  ali  23  595LAAVVKNAVAEYQVSTGHLPVDAAQAGVDTAQLLAAKIIASLKVTN-GRIVITFGED-DPGLSRKTLILTPYEDQGSVRWRCGNSPEPAGRATQGGKTPVHVQSSLPARLLPKSCR................... 717
173 8.000e-12UniRef50_A0A2E7WQ60 Prepilin-type cleavage/methylation domain-containing protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2E7WQ60_9GAMM  ali  35  46LASSAKTGIVEFQDNNGTWPTNNSDAGIEEPADITGTYVSSVTVNSNEIAIVFN----SGVHSGNTITLTAADQGGSISWVCE-------------------ATVIPGSQLPSNC.................... 137
174 8.000e-12UniRef50_A0A2N6CK56 Uncharacterized protein n=1 Tax=Chromatiales bacterium TaxID=2026725 RepID=A0A2N6CK56_9GAMM  ali  18  47.VAPVQRQIEHRYQQDRMLPVDRVAAGLSAPADTVIEEVASIEVE-RGRIVLVFGREALERIVMDRLSLTPETRNGSFVWRCGDGPVPDGAKPLSETENGTDLATIPDRYLPPQCRSP................. 167
175 9.000e-12UniRef50_A0A1H6F954 Fimbrial protein n=1 Tax=Thiotrichales bacterium HS_08 TaxID=1899563 RepID=A0A1H6F954_9GAMM  ali  28  48LAKPVTKSITEYYAWHGYLPANNLAAGLAKAEHIAGNYVQRIEVEQGAVHIVYRDELMSGWLEEGQLSLRPVTESFAISWVCGNATLTKTAMQDKNAG..................................... 158
176 1.000e-11UniRef50_A0A1W9WZK1 Uncharacterized protein n=1 Tax=Beggiatoa sp. 4572_84 TaxID=1972449 RepID=A0A1W9WZK1_9GAMM  ali  26  126LMSGVKSDIAEYYSIYGRLPTKAEQL---PSIKTSGQYTSNITLDNGVLTASMRHND-------FSLSFRPALANNEITYVCGYATPPNHFIVQAE-----NKTNIPPHYLSLTCR................... 230
177 1.000e-11UniRef50_A0A2E9D0X5 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Chromatiales bacterium TaxID=2026725 RepID=A0A2E9D0X5_9GAMM  ali  24  33LAGNAKAPIVDSFLTSGEAPADRAEAGLPNADDTSGKYVTSVAVVD-GRLDVTFGNDANALIEDAVLTLTPYTPTGAVVWRCAAEDAPTDPGGSSLSTMGTSGGDVDARFLPPVCR................... 158
178 1.000e-11UniRef50_A0A1Y6CZS1 Type IV pilus assembly protein PilA n=22 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y6CZS1_9GAMM  ali  25  49LAGGLESTISDIWSAQGTLAADNSLGLPAAATDTSGKYVLSVGVAG-GGLTITYGNSANAAINGQTLGLTPWVNNGGLIWQCGNATAPAATTAPAGQ--GVPTTNILDRYLPSSCRTGA................ 167
179 2.000e-11UniRef50_A0A2U0ZX51 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=2 Tax=Paraburkholderia silvatlantica TaxID=321895 RepID  ali  27  147LADGAKPFVSEYHANNGSFPAD-----LMGGIKVAGKWVEGTALGSNGQIVATFGSDAIKGLKGKKVMLTPKIETGNLSWDCSSDA--------------------PKEYLPNTCNYAESGGSTQ.......... 247
180 2.000e-11UniRef50_UPI000C1576EE hypothetical protein n=1 Tax=Stenotrophomonas maltophilia TaxID=40324 RepID=UPI000C1576EE  ali  30  14...........YYSDHGQFPADNRAAGMAAPGSVSGRFVRSVTVDGTGSISVAFASSASAKVAGQTLVLTASDTNGAVNWSC---------------------GGLDARYVPTSCR................... 97
181 3.000e-11UniRef50_A0A2A5HYL1 Uncharacterized protein (Fragment) n=1 Tax=Alteromonadaceae bacterium TaxID=1916082 RepID=A0A2A5HYL1_9ALTE  ali  25  45..APLKLKVEEYYLTQGRLPMENSELGLDDPHTIAEGNT--VTITQEGLRIDF--NEQTPGLYSETLTLTPVELQSSIVWECF-------------------GGTLENKYRPPNCRN.................. 136
182 3.000e-11UniRef50_A4JHB8 Fimbrial protein pilin n=8 Tax=Burkholderiaceae TaxID=119060 RepID=A4JHB8_BURVG  ali  25  48LVGGLQSDIQEYYAENGILPPNNWAVPTAMPQGKYS-YVQNIQ---NGLIVVRFNNQANSKLSRATLGIEAVPSNGSIHWKCGNFSM------------------IAPQWLPASCHDT................. 144
183 3.000e-11UniRef50_UPI000D6C7939 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Gammaproteobacteria bacterium ESL0073 TaxID=20  ali  33  46LASGQKGAVAEYYSSNSDCPDNAQNGGIAKKSQISGKYVQEVTVGQGGSTIIMRGTNVAEGIKNKTLTLGMVPTSGAFQWGCTSDA--------------------DNKFLPATC.................... 160
184 3.000e-11UniRef50_A0A2P1PWA6 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Ahniella affigens TaxID=2021234 RepID=A0A2P1PWA6_9GAMM  ali  26  47LAGPVQLGALEYYADQGVFPTSNLQAGLPAGDEYEGAYISRVELTAAGDVACTFSSTANGELDGASMLLTPIDEGGSVNWECSSTTISSYRLATIC....................................... 146
185 4.000e-11UniRef50_A0A2E9AH19 Pilus assembly protein n=2 Tax=Salinisphaera TaxID=180541 RepID=A0A2E9AH19_9GAMM  ali  24  66LASPVKTAVGEYYSVNGELPTVANNNWTSDTGAASGNNVKRIWWHNSADDPSIRIRYSGLPIDDDLLYLEADFNNGSISWNCVAPA----------------SGGVPDRYLPASCR................... 176
186 4.000e-11UniRef50_UPI000407270A prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Desulfobulbus japonicus TaxID=231447 RepID=UPI  ali  27  49LTEPIKKDILEYYAHTGEMPRDNMSCGQPVPNAIKGKYIDSIAV-DHGVIHVHFNDTFSGGCENKTMSIHPELQNGIFSWT...................................................... 132
187 4.000e-11UniRef50_UPI000DDAFCCB prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Pseudomonas sp. MWU14-2217 TaxID=2071626 RepID=UPI000DDAF  ali  26  19LADAAKTAVAEYYASKSAFASSNSAYGLSTASSITGNAVNSVSVLASGVIQLTYNNTVSS---GAQLDLVPSVTSGSVTWVCTYTGTGGGTTAIGTQ--------LQANWVPTNCRQ.................. 127
188 4.000e-11UniRef50_A0A165G1R4 Uncharacterized protein n=2 Tax=Crenobacter luteus TaxID=1452487 RepID=A0A165G1R4_9NEIS  ali  27  47VAGSVKTALEEYHAANGVWPTTASAAGLQAPAAYRGQAVESLTLVASGAVGVIQLTLNGKVQDGAKVWLAPEENSGAYRWRCGGESTL-------------------QRLMPSNCRD.................. 145
189 5.000e-11UniRef50_A0A2I7N9S1 Uncharacterized protein n=1 Tax=Neisseriaceae bacterium DSM 100970 TaxID=2052837 RepID=A0A2I7N9S1_9NEIS  ali  24  44MAGPAQLAVAEYHSFNSVFPSTKADAGLDPADSYIGKYVTKVEVGANGVISSWL---ILPSGELGVINYTP-AESGMITWVCT.................................................... 122
190 5.000e-11UniRef50_D3A3V4 Pilin (Bacterial filament) n=16 Tax=Bacteria TaxID=2 RepID=D3A3V4_NEISU  ali  19  49LAGSMKSYVEEAYADKGSLPLDLNIKQLASDDNKVGNYVKIVRIEDNGTIVAAIGNQAAVPVKNTEIHLTPS---------------FAQTGNTKGTTVWSCGGTMDTYFLPVSCKQS................. 151
191 5.000e-11UniRef50_A0A0W1RU54 Uncharacterized protein n=2 Tax=Halothiobacillus TaxID=109262 RepID=A0A0W1RU54_9GAMM  ali  31  50LATSAQRALAEFYMQSGRLPSSNASAGLPQPTSIVGNYVVRVEVQNAGGVAVRYGNNANAAIAGQPLFSPITSASGAIRWDCGFPDK................................................ 141
192 5.000e-11UniRef50_UPI000B9EB6ED NINE protein n=1 Tax=Zooshikella ganghwensis TaxID=202772 RepID=UPI000B9EB6ED  ali  22  267.SEQAKEQLSLFIQANNIFPESNAQAGL--PETMSNEIVSSVRVSKGGLLTIQFHKEVTHQ-PGQTITFRPTLVNGRVEWDCS-------------------GGSLLAKYRPIACRSSSESVGG........... 367
193 5.000e-11UniRef50_UPI0008885B06 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Acinetobacter kookii TaxID=1226327 RepID=UPI00  ali  30  46LAGGAKAGVAEFYSSNGKMPPSAASAGISA--TITGNAVTGVALTANTGLITITFND--KVTNGATLLLSPTPSTSGILWKCK-------------------GGSVDSKYVPSNCR................... 138
194 6.000e-11UniRef50_A0A158HT01 Fimbrial protein pilin n=1 Tax=Caballeronia peredens TaxID=1777132 RepID=A0A158HT01_9BURK  ali  27  55LMEGFKTKVTEYFAVNGHFPYSISNLG--ETTFPSGKYVSSNATNDTIYLTATYSTKANAKIAGKQLSLIGTSNNGPIQWTCTSQGQ-----------------SIPKRYLPTSC.................... 159
195 7.000e-11UniRef50_D8IYL9 Type IV pilin A protein n=14 Tax=Herbaspirillum TaxID=963 RepID=D8IYL9_HERSS  ali  20  51LAEPYKLAVTEQISSNN---GVFTVAQLGLPAFTPTANVTGISVSPMGVGGVITITYSAQVGEGGTLTLTPTIASGTIQWQCAAAGVTQAPTPQGTANTGFVAGTLPAKYAPANCRG.................. 168
196 8.000e-11UniRef50_A0A1Q4FJ69 Uncharacterized protein n=1 Tax=Xanthomonadales bacterium 63-13 TaxID=1895867 RepID=A0A1Q4FJ69_9GAMM  ali  19  72.VSGVRVAIAEVYMSSGRMPASNADAGLPEPATYKGQSLVSLQVVEGGTILLTFD--ATSGVEGGVIEWQPDLGGMGMQWHCLTHDYPLIVRALPTCTYA................................... 171
197 9.000e-11UniRef50_UPI00098093CF prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Burkholderia cenocepacia TaxID=95486 RepID=UPI  ali  26  49LSEQFKTAISEYYANNGKLPATQADVNVGSP---AGKYSTMTMIGGSNSSTVYFGNEANQQIQNKQLTLMAQVVPGNLQWTCKGNS-------------GISSNPVPNKFLPISC.................... 153
198 1.000e-10UniRef50_A0A0Q9EPI0 Uncharacterized protein n=6 Tax=Lysobacter TaxID=68 RepID=A0A0Q9EPI0_9GAMM  ali  19  147.VNPIKTAVAEHMLSSGGDCPSNGDDGFGAPEDYATRTTAQIKIGTMHCAIELELRGIGERVDGKTIWFEAVPSGGGVQWDCS-------------------GGDLPAIYRPSACRPGTSISNG........... 254
199 1.000e-10UniRef50_D6CUP1 Putative Pili subunit, PilE n=7 Tax=root TaxID=1 RepID=D6CUP1_THIA3  ali  27  56LASGIKTAVAEYWATHGSWPSTDPVCTGATADPPSGTYSISVLVGYGGTIIIAYNQLLNPQATGYTLVLQPAPGEGSLRWVCFSGGQTTKGGVTTYATP-----TLPSKYAPPPCR................... 179
200 1.000e-10UniRef50_A0A091B0G9 Uncharacterized protein n=1 Tax=Arenimonas oryziterrae DSM 21050 = YC6267 TaxID=1121015 RepID=A0A091B0G9_9GAMM  ali  24  91.AQMFRVALTEYYQTNGEWPANAQQAGLESASAYAGGAVTGIEVGAHGVVIIKINNAFTPA---SQIVFEPKTATGMVDWRCSVQGSDELRRYLLAC...................................... 184
201 1.000e-10UniRef50_A0A251X8A9 Uncharacterized protein n=1 Tax=Thioflexothrix psekupsii TaxID=1570016 RepID=A0A251X8A9_9GAMM  ali  26  46ISQPVQQHIAEYYAWHGRWPENNAVLGLPEPTQWQGRYLRQLTVNQGKIEL-----QVALTSTELVLFFTPSSNTRIVHWNCHPTEGLHEEVNP---------------FLPSSCRN.................. 145
202 1.000e-10UniRef50_A0A1D3ERI6 Large pilS cassette n=52 Tax=Neisseria TaxID=482 RepID=A0A1D3ERI6_NEIGO  ali  65  71................................................VTATMNSSNVNKEIQGKKLSLWAKRQDGSVKWFCGQPVKRDAGNAGDDVTKDDADKKIDTKHLPSTCRDKSTAVCTKH......... 150
203 2.000e-10UniRef50_A0A1S1XAY7 Uncharacterized protein n=2 Tax=Chromobacterium amazonense TaxID=1382803 RepID=A0A1S1XAY7_9NEIS  ali  33  33LATSAKSAVTTYYSVNGKHAVGNDALGLAEAEKIKGNAVTSITVENQGLITVAYNDKVE---NGKKLQLKPDANSGSFVWDCQIPKIDG----------------INPKHAPSNCKPEEA............... 141
204 2.000e-10UniRef50_A0A220S1Z7 Prepilin-type cleavage/methylation domain-containing protein n=9 Tax=Neisseriaceae TaxID=481 RepID=A0A220S1Z7_9NEIS  ali  26  48.ASSVKADISTAYFGQGWTTMVN----YSGSNSPHGRYLKSIEVSNTGIIKMTMNNQANEVIRNKTLTLVPKVNANGIEWECDSSAADA----------------IPKNFLPSPCR................... 147
205 2.000e-10UniRef50_A0A2N5QSB8 Type IV pilus assembly protein PilA n=15 Tax=Proteobacteria TaxID=1224 RepID=A0A2N5QSB8_CHRVL  ali  26  48LADAAKTAVAEYYASKSAFASSNSAYGLSTASSITGNAVNSVSVLASGVIQLTYNNTVSS---GAQLDLVPSVTSGSVTWVCTYTGTGGGTTAIGTQ--------LQANWVPTNCRQ.................. 156
206 2.000e-10UniRef50_A0A2U2AQ16 Uncharacterized protein n=1 Tax=Ignatzschineria sp. UAE-HKU57 TaxID=2182793 RepID=A0A2U2AQ16_9GAMM  ali  29  98LAKGIQLEAELYYALNGDWPRENAALGLDKASDYRGNSVESIALEGNEITIT-YNDEVGAEGGPARLILRAEAPGGTIRWRCSGE-------------------NIAEDHLPKEC.................... 194
207 2.000e-10UniRef50_A0A1I1ML04 Type IV pilus assembly protein PilA n=4 Tax=Burkholderiales TaxID=80840 RepID=A0A1I1ML04_9BURK  ali  30  61LASGLKTSLVEAYVSSGSCPDNANNSGLPLSSTINGRYVASVEVGDSGGCVIRFRSDVSQALAGKHVELELKGSEGSFTWDCFS--------------------NVDHKLMPKSCRGSSSTSA............ 175
208 2.000e-10UniRef50_UPI00098D6B6D hypothetical protein n=1 Tax=Wohlfahrtiimonas populi TaxID=1940240 RepID=UPI00098D6B6D  ali  20  55IASKVKIAIAEFYEKEKHFPNNNQEAGLPEANQIVGQSVKAVEILPKGKIKITYNNKLA---DNAFIILEAVLDDDKITWQCRESDLLEIRIIPALCRGQIDDFNSQNKYL........................ 165
209 2.000e-10UniRef50_A0A1M7MIF7 Type IV pilus assembly protein PilA n=2 Tax=Burkholderiales Genera incertae sedis TaxID=224471 RepID=A0A1M7MIF7_9BURK  ali  25  51LARVVEKSIAEYRDRWGRLPVDNAAAGLPPPAALRGAWVSEIQVIEGSITVRYLPETGKELKGRPALLLRPVSDTGALSWICQSAATPAGRVAPPVPKELVL---LPRQYLPGTCR................... 167
210 2.000e-10UniRef50_UPI0005F833D4 prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Alteromonadaceae bacterium Bs12 TaxID=1304902 RepID=UPI00  ali  26  46LLSGLKIDVSGYYTDKGSLPTLALLTGYAGPKVIEGKFTTGIVGGTAGLFVATMRSAVGANINAKTVQLSFTDSNGLLKHVC----------------EPGGTDPIPAKYLPAECR................... 146
211 3.000e-10UniRef50_A0A0Q8DNL9 Uncharacterized protein n=5 Tax=Rhodanobacter TaxID=75309 RepID=A0A0Q8DNL9_9GAMM  ali  24  309.SAPYRDAVARYGASHQQWPASMEE--MNMPPFVGNQSTATITLGENGVLAVGF---AKPPLQGHVLQLTPYVTEGALHWSC--------------------AGDVPAKLLPLECRD.................. 399
212 3.000e-10UniRef50_A0A0S2TBF5 Uncharacterized protein n=1 Tax=Candidatus Tenderia electrophaga TaxID=1748243 RepID=A0A0S2TBF5_9GAMM  ali  29  47LVEPVKQRVTEEYFLTGDWPVDNESAMVGPFDRYKGNYLKAIIVENKAVKLIYDSSKLPALGDNNTIVFYPRTEGGSVSWKC-------------------DEGNMVDDYRPRQCR................... 149
213 3.000e-10UniRef50_A0A2N7QZ15 Fimbrial protein n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2N7QZ15_9GAMM  ali  30  45LADGMKTDVADYYTQTGGCPTPGAN-GLPAAASYSGHYVASINITAGGITALMRNQTVAPRLQGKQVKLTMTSADGAINWQCTSDA--------------------DLIYLPQTC.................... 143
214 3.000e-10UniRef50_A0A257SYH6 Uncharacterized protein n=1 Tax=Chromatiales bacterium 21-64-14 TaxID=1970504 RepID=A0A257SYH6_9GAMM  ali  26  46LIAPAKTAIDEQFLATGSLPAGNTKYYLPKPASIQGSYTRQVDVNGGIIKITYRT--VGGSASNTVLVLTPTTAAGGIHWDCGGA-----------------GSTLPVMYRPAVCR................... 143
215 4.000e-10UniRef50_U5T0B7 Uncharacterized protein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=U5T0B7_9GAMM  ali  23  45.AGAAKTSVADYYYANGELPANNDEAGLGPNTDYETDVISAVSVGTETGAGFALGTDTKGIEPASVLSFVPDTSNNSLAWNCEIP----------------DTDGLPAQYAPANCRSTTSATN............ 156
216 4.000e-10UniRef50_A0A2N5QS80 Type IV pilus assembly protein PilA n=8 Tax=Betaproteobacteria TaxID=28216 RepID=A0A2N5QS80_CHRVL  ali  28  48LADSAKTAVTEYYASNNAFVASGTATSYGLATTITGSSVGSLSVLASGVIQVAYNSTVSS---GALLDLVPTVTSGSVSWVCTYTGTGGGTTAIAA------ANQLSANWVPSTCRQ.................. 158
217 4.000e-10UniRef50_A0A1H6FB96 Fimbrial protein n=1 Tax=Thiotrichales bacterium HS_08 TaxID=1899563 RepID=A0A1H6FB96_9GAMM  ali  15  49LMSTFRQAVTEHYAVYGTLPQRESTL-IDMGLKTQGQYTQNIEMDEQGAVTASFQT---ATLENARLTMRPAIHADVLLWVCG-----NHQAPFPFVVQGNNQTRISPDLVPFSCRSRSK............... 161
218 5.000e-10UniRef50_UPI00066FF574 hypothetical protein n=1 Tax=Dyella-like sp. DHo TaxID=1664276 RepID=UPI00066FF574  ali  25  1MADSARTAVEQFGASHQRWPDSLTQLGMAPFAGDAS--VAGITLGGDGALLVSF---ANPALRGHLFKLTPYVRNGAIHWSCG--------------------GDVPEKLLPPACRAT................. 95
219 5.000e-10UniRef50_B7RSR0 Uncharacterized protein n=1 Tax=marine gamma proteobacterium HTCC2148 TaxID=247634 RepID=B7RSR0_9GAMM  ali  27  34.VSEAKTTIAEYYHTNREFPLDNETAGLTQASSY-GRYIRGLSVGPGDGIITVTFKLQGTQGDDKDLQLIADTSGVEVVWECKAPDTPRG---------------IGSNFVPPSCRG.................. 135
220 5.000e-10UniRef50_A0A2U2AG99 Uncharacterized protein n=2 Tax=Ignatzschineria TaxID=112008 RepID=A0A2U2AG99_9GAMM  ali  25  101LASAMQLDAEVYYTLNGKWPDNNKVLGLPDAESYRGNSVDSIQLEGETITVTFNDDISGEKDGAVQLILTGNVDSGLIRWKCEGI-------------------NIKESDLPSSCKS.................. 199
221 6.000e-10UniRef50_A0A2V8PLR3 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8PLR3_9BACT  ali  26  80LMAGPRTTMMEYRAVTGVWPTSNSQTGFPDAMFRTGYRVNAVQIREAGAVDFGFSRGA---LKGKVLTIRAWERPGPVEWLCG------HALSLPGTTAAVDQTTLSEEDLPSPCR................... 193
222 6.000e-10UniRef50_A0A256CMZ7 Uncharacterized protein n=2 Tax=Ignatzschineria TaxID=112008 RepID=A0A256CMZ7_9GAMM  ali  28  91LAKGIQLEAELYYALNGDWPKENAHLGLDKAESYRGNSVESIALDGNQITITYNDEIRREGGDSAKLLLTAESRGGSIYWQCQSD-------------------NIAKDHLPKEC.................... 188
223 7.000e-10UniRef50_A0A2D8RFL0 Uncharacterized protein n=1 Tax=Hahellaceae bacterium TaxID=2048971 RepID=A0A2D8RFL0_9GAMM  ali  16  78..SAVRYAVQDYVIEHGRLPASNQDLGLPEPQAYARGALSSVAVGERGRITLTFNERSG--VDDGTIQLVPIASDPGVQWDCKTPSFEDIQSWAPACRFAPGQ................................ 178
224 7.000e-10UniRef50_UPI00098D15A1 DUF805 domain-containing protein n=1 Tax=Wohlfahrtiimonas populi TaxID=1940240 RepID=UPI00098D15A1  ali  32  198LLDVGKQSMIEYYGIHKAWPSSNEEASLPPASYIRGIIVDGVEVKNNAITITY-----NKKLDYKTIIFVPKIIDGQYLWDCK-------------------GGTLPYTLRPKDCR................... 289
225 8.000e-10UniRef50_A0A0Y6JLA0 Fimbrial protein n=3 Tax=Neisseria meningitidis TaxID=487 RepID=A0A0Y6JLA0_NEIME  ali  76  1MVEGQKSAVTEYYLNHGIWPSDNSAAGVASSADIKGKYVQKVEVNNGVITA.................................................................................... 51
226 9.000e-10UniRef50_A0A1G0X235 Uncharacterized protein n=1 Tax=Legionellales bacterium RIFCSPHIGHO2_12_FULL_37_14 TaxID=1798568 RepID=A0A1G0X235_9GAMM  ali  18  49VMSDAKTTIAEGYIADGVQGIKNAALAFNEQGNHSSKYVSSIKVMTEAPYSIQRGNGLPLTLDGKKILITPNVAHGEIDWACTSSTNITAAERALGSRP---LGTMPANYVPAECR................... 175
227 1.000e-09UniRef50_A0A0K1XF01 Uncharacterized protein n=4 Tax=Oblitimonas alkaliphila TaxID=1697053 RepID=A0A0K1XF01_9GAMM  ali  25  47LTSFAKLAVTEYFQTEGKLPENNQEVGLNQEGTNQSRYVKSLIIGNPGQISITITGTSISSLDDKKVMLIPYRNDATTK--IMDTSSESNYSGPIVWICTLESPDMNT-FFPSNCRHTNS............... 168
228 1.000e-09UniRef50_A0A1V2VTK2 Uncharacterized protein n=1 Tax=Burkholderia cenocepacia TaxID=95486 RepID=A0A1V2VTK2_9BURK  ali  25  50LSEQFKPAITDFYANNGKLPQTQSDLNVGIP---AGKYSTMTLVGGSNSSTVYFGNEANQLIQGKQLTFMAQVVPGNLQWSCKGNA-------------GISSSPVPDKFLPISCK................... 155
229 1.000e-09UniRef50_UPI00098D25AF hypothetical protein n=1 Tax=Wohlfahrtiimonas populi TaxID=1940240 RepID=UPI00098D25AF  ali  22  12LSSGVKAAITEYYSVNGVWPVTNAEAGLTRGDHITGSSVSAIWIADVTNIVIYYNQKVIGDARQNTIVLAPNVTNSSIS----------SKPTIQWVCRAVDINRIKMRWLPASCRAT................. 146
230 1.000e-09UniRef50_UPI000B81100F pilin n=1 Tax=Oryzisolibacter propanilivorax TaxID=1527607 RepID=UPI000B81100F  ali  14  49..SSCRTTITEKYQTGTEAPGAGGWGCESKTDAKLSKYVKSIKTNADGVVEVIVQGIDKDNLDDKAIYLEPRDADGKAIAVADTLSKPAVNIQVNQWACGYSVTSV-AKFLPGSCNTKFATAPTGFKDADN.... 177
231 1.000e-09UniRef50_A0A2M7CVG4 Uncharacterized protein n=1 Tax=Xanthomonadales bacterium CG02_land_8_20_14_3_00_62_12 TaxID=1974108 RepID=A0A2M7CVG4_9GAMM  ali  16  120LGASAKVAITEMYQSNGITAGSNADVGMPVATDWHGQSLRETHIRPGGVVELIFDKRSG--VAGGVIRFVPDLEGGPMDWRCETFDYPEIEAITPSC...................................... 218
232 1.000e-09UniRef50_A0A1V2VTX7 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=4 Tax=Burkholderiaceae TaxID=119060 RepID=A0A1V2VTX7_9B  ali  38  47LAEGAKTAVSEYFANAGSLPADNTAANYGGA---VGKYTTGVAVANGAITAT-YGGAANSKIVGGTVTLTPTADAGTLIWACSY-----------------DGSKVVQKYVPSSCK................... 142
233 2.000e-09UniRef50_UPI00098D6F70 prepilin-type N-terminal cleavage/methylation domain-containing protein n=2 Tax=Wohlfahrtiimonas TaxID=582472 RepID=UPI00098D6  ali  22  46LAGIAKLAIVETFSATGEWPLSNEEAGLPAPTELTGQAVDAVDVRNFGGIVIRYNEKVSSQDFRNAVVIVPTLTGDSYRWECFTYDQH----------------SIQLQWLPSACRKEIKSV............. 173
234 2.000e-09UniRef50_A0A1V2VTV2 Uncharacterized protein n=2 Tax=Burkholderia cenocepacia TaxID=95486 RepID=A0A1V2VTV2_9BURK  ali  21  48LAGGIQTAISQYYVRGWSMPADMNALKLPQA---SGQYVSSIT-QEKGVITITYGNNAMSKLTGGKVTLKGTDNNGNVLWTCT-----------------PDGTIITKEYVPISC.................... 142
235 2.000e-09UniRef50_A0A290S9G8 Type IV pilus assembly protein PilA n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A290S9G8_9GAMM  ali  26  49LTAAAKTGIAEYYQSEGAYPVKDGTPDVTAFGVTGTYSVVTVETATGVISAKMNKTGVSKDLQDRTFTFTPSVKDGAFKWTCTHDLVNKAIAPKGCKAKA................................... 148
236 2.000e-09UniRef50_A0A1F4CLU5 Pilin n=2 Tax=unclassified Betaproteobacteria (miscellaneous) TaxID=33809 RepID=A0A1F4CLU5_9PROT  ali  15  47.VSACRTPIAEVYQSIPTGPGAGQW--GCEVSGPASAYVQSIATDPDGKIIVTARGFSDDAINGKLLTMVPLIDGIPAV----SATDMGKGITSWRCGSADDGTTIPAQYLPGSCRGN................. 157
237 2.000e-09UniRef50_A0A1H9LAR9 Type IV pilus assembly protein PilA n=1 Tax=Solimonas aquatica TaxID=489703 RepID=A0A1H9LAR9_9GAMM  ali  23  47..DQAKTAVSEYVATQGNLPLTAGDAGIVAPGNA--QYVDTLSWDGEQKVIAVKLKNLSGKLNGKSLYFAADNDSNEVFYVCGSDVDSQYFS-----------------YLPVECRKTLSAALTE.......... 151
238 2.000e-09UniRef50_J2LZD1 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=10 Tax=Proteobacteria TaxID=1224 RepID=J2LZD1_9BURK  ali  20  52LAAPAKMAVAEAINAKGGTNFTAAETGYTFPT--ATSHVDSITIGSGGGVITIKFGQIGGDGNGTTLILTPQVTPGAINWVCRAAPANASATNPAPANAAT----LPANYAPENCRG.................. 167
239 2.000e-09UniRef50_UPI0009C1561C hypothetical protein n=1 Tax=Metallibacterium scheffleri TaxID=993689 RepID=UPI0009C1561C  ali  20  61LLAATKMAIEDAI-KRGKAPDSNAAAHVGEPDYLTSNEISSITVHKGGVLQVHFTSAVSPDLTG--VWLTPTRAGDSVKWSCISHDIPQITDVESYCSY.................................... 156
240 2.000e-09UniRef50_A0A1I2BYD1 Tfp pilus assembly protein, major pilin PilA n=4 Tax=Rhodanobacteraceae TaxID=1775411 RepID=A0A1I2BYD1_9GAMM  ali  22  635.....KVAVLEFRQSKNRWPKSGKEAGLDEDEAGP-------RVLPDGSIQLSLAGTGSAKLTDGTVLLTPQPAGRSWTWHCHAE-------------------GVADKYLPVSCRQGASQAADATP........ 730
241 2.000e-09UniRef50_A0A223PE41 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Herbaspirillum sp. meg3 TaxID=2025949 RepID=A0A223PE41_9BURK  ali  21  52LAAPAKMAVSETIVAKGGTAFNQAATGYKFTPSNEIKNVKDITIADGGAITITFG-EIGGDGSNKTLKLVPSATNSAITWLCQAATTPATPAGTPAVAPATSVATLPPQYAPENCRS.................. 174
242 2.000e-09UniRef50_A0A0Q9YGT7 Fimbrial protein n=21 Tax=Proteobacteria TaxID=1224 RepID=A0A0Q9YGT7_9COXI  ali  29  50..SNAKTAVAEYRIAKGTMPTTNTQAGV---TSVVSQYVSGLAVGAGGAITITGNQTNLGSGGAFAIVLTPTFANGSVRWTCTSTGA--------------------TQFAPSSCR................... 140
243 2.000e-09UniRef50_A0A1K1M5B3 Tfp pilus assembly protein PilE n=8 Tax=Xanthomonadales TaxID=135614 RepID=A0A1K1M5B3_9GAMM  ali  27  636.......AVAERRQTSGKFPATNRAAGLGAPETLGNDYAGAVEVGPGGEIVVTMDATTDAKLDGATLVLTPRVEGNGVAWSCSGE-------------------GVEPKYLPATCRDE................. 731
244 3.000e-09UniRef50_A0A259R4D2 Uncharacterized protein n=1 Tax=Xanthomonadales bacterium 14-68-21 TaxID=1970612 RepID=A0A259R4D2_9GAMM  ali  29  326LFNGVQQAVAYYWPEHGELPSDNAAAHLPDAGLIKGKYVAGVELSRGVATATLRDSAGGGHVL---LVAMPDAEHKTMRWRCESPDIPEIARLHDGCA-----------YIPAGARGDASGSAAFT......... 438
245 3.000e-09UniRef50_UPI0003B4B67B prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Leucothrix mucor TaxID=45248 RepID=UPI0003B4B67B  ali  31  53....VKFAVYEFYTNNGNWPIDNAAAELLDPNEYQSQEIKSISVDAGTITITYNSKVIN----DSTITLMPTFNNG-YSWDC-------------------TGGTIPNNIRPPSCR................... 140
246 3.000e-09UniRef50_UPI000A05ED40 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Dyella thiooxydans TaxID=445710 RepID=UPI000A0  ali  31  45VVDGLKVDVSGYYEQTGTCPTLGAD-GLAAAVSYSGNYVASVSIAGCAITALMRSHTVAPRLQSKQVTLTMASVDGAISWQCSS--------------------DVDPVYLPKTC.................... 143
247 3.000e-09UniRef50_Q5P985 Class II pilin protein PilE n=12 Tax=Proteobacteria TaxID=1224 RepID=Q5P985_AROAE  ali  27  46LTDGAKVAVAETFQSTGALPASDAA---AGYGGAVGKYTASVAIGPSGVITSTGGVDANDAIAAETITLTPKADTGVLVWAC--------------------AGSVDAKYRPSTCRAAAA............... 143
248 3.000e-09UniRef50_A0A1Y6D1L8 Pilin n=2 Tax=Methylomagnum ishizawai TaxID=1760988 RepID=A0A1Y6D1L8_9GAMM  ali  25  454LARKLQATVEKIYKTQGMLANANTNLGLPYPSDISGNYVQGIAVAA-GALTITYGWGANVNLTARTLGLTPYVSDGKLTWVCGNANIPTGFFSPIGG--GLAATTVANEYLPINCR................... 568
249 4.000e-09UniRef50_UPI00036DBE9E prepilin-type N-terminal cleavage/methylation domain-containing protein n=4 Tax=Ectothiorhodospiraceae TaxID=72276 RepID=UPI00  ali  31  48LSGGLRTAMVEDFTSTGSWPADDDYATGGDDGEAAGRYVSTVTHSGAVVTVTMIDDPVNNAIRGGQMLLTAQTTDAGDRWTCSS------------------GDDMEDKYLPSSCRDD................. 153
250 4.000e-09UniRef50_UPI00039A06A7 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Lamprocystis purpurea TaxID=61598 RepID=UPI000  ali  20  49.ATRYKAELTDYITANAALPTADSDYLTNGNGM-----VNRVKWSERGAIEVWFGAKAGGELNGTILWLMPTIAADSIQWTCRGHS-----------GDGDIKWRIDPIYLPSSCR................... 148
251 4.000e-09UniRef50_D2UBN3 Probable fimbrial protein (Pilin) n=29 Tax=Proteobacteria TaxID=1224 RepID=D2UBN3_XANAP  ali  28  45LTDGLKTQVAEYYANQGACPA-NGANGFEANTGYAGNYTAKIDLGACTITATFNAAGVNANLQNKTVKLTANNVGGALNWVCTTTALQKYVPNTCTGA..................................... 145
252 4.000e-09UniRef50_A0A1I3ZRZ9 Tfp pilus assembly protein, major pilin PilA n=2 Tax=Rhodanobacter glycinis TaxID=582702 RepID=A0A1I3ZRZ9_9GAMM  ali  27  217.AEPLKQQIIDAIGLHRAWPQSNTQAGLKEAEAYAGNNLSGFAVDDGTALVTRFDEHALVPLRGKQLAWVAGAQGGAIVWHCESP-------------------DIEAIYLPESC.................... 314
253 4.000e-09UniRef50_A0A2T1AQ39 Type IV pilus assembly protein PilA n=1 Tax=Paraburkholderia insulsa TaxID=1441714 RepID=A0A2T1AQ39_9BURK  ali  29  53.AGGLQTEVVEYYSVNGTIPKNMTDLGYQAGTYFSGKY-STVQVQNGNVQVGFDTPSANQKLHSTYLYLSPTVVNGSIHWAC--------------------LGTMNAAYIPSSC.................... 151
254 5.000e-09UniRef50_A0A1G1F7Y0 Uncharacterized protein n=1 Tax=Nitrospirae bacterium GWC2_57_13 TaxID=1801697 RepID=A0A1G1F7Y0_9BACT  ali  18  46LGGDIRKDIQEFYDHTGRFPKDNAEAGLPSAVHLRGKFVESISVKDGAFDITFSENMGRYKVLTARPALPKVDPGAPIIWLWGSDKTPDGYAPAG........................................ 140
255 5.000e-09UniRef50_A0A2E5Q987 Prepilin-type cleavage/methylation domain-containing protein (Fragment) n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2  ali  30  1....AKTGVAEFQNMNNAWPSNNSDAGIAEAANHSGEYVSQVSVASNVVTITF----GSGVHNGNTITLTATDQGGSISWACASLSISDNQLPTICTG..................................... 90
256 5.000e-09UniRef50_UPI000D6C61AA prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Gammaproteobacteria bacterium ESL0073 TaxID=20  ali  33  46IAGGLKSPVVEYYTSYGACPKNTSTNGFGTTTSYSGKYVEAARVGYCSIWVKMRSTGVAKGIAGKILNLELRKDNGSFAWGCISNA--------------------SQKYLPSSCEGGKSLNNAN.......... 160
257 5.000e-09UniRef50_Q2Y657 N-terminal methylation site n=13 Tax=Nitrosomonadaceae TaxID=206379 RepID=Q2Y657_NITMU  ali  24  60LLGRVKSPVAAFYSDKGRWPTSEEFDNLVPA--RTGKYVASLTPESFEVIAKFRNTGVSPALSGRTLVL---ATANGKEWFCNDNTDPVSGIPDLVP------GNVLPQHRPSSCK................... 172
258 5.000e-09UniRef50_A0A1D3IV00 Pilin n=55 Tax=Neisseria TaxID=482 RepID=A0A1D3IV00_NEIGO  ali  66  1....................................................MKSDGVNKEIKGKKLSLWGRRENGSVKWFCGQPVKRADNAADDVTVADAAGKEIDTKHLPSTCRDTSSA.............. 71
259 6.000e-09UniRef50_A0A0W0RD83 Fimbrial protein, type IV pilin, PilE n=2 Tax=Legionella TaxID=445 RepID=A0A0W0RD83_9GAMM  ali  24  44LASAAKQTVSETTQVNGVLPADNNAAGYSPPAATPS--VSSINIQNGQITIAYT-----PLAGNGTIILTPTVSGGEMIWDCR-------------------AGTLPDKYRPSTCRGGNATQGTNS......... 145
260 6.000e-09UniRef50_T1BN96 Fimbrial protein n=2 Tax=mine drainage metagenome TaxID=410659 RepID=T1BN96_9ZZZZ  ali  29  45IAGGLKPAIAELWWSNGSFAGTSGQNGIPQAASLAGHHVAEVTVKSGSIQAVFKSHGVSPGLAGKTLTFAPTAAGGSINWTCSSATIAQALLP.......................................... 140
261 7.000e-09UniRef50_A0A1H0MTE1 Type IV pilus assembly protein PilA n=5 Tax=Burkholderiaceae TaxID=119060 RepID=A0A1H0MTE1_9RALS  ali  32  65LASGQKAPVTEAFSNTGSCPTSGAASGIPASTSISGSYIASVQVGGCTITANFKDSGIAKGLTGKYVTLTMGNADGSVTWKCESSA--------------------DKKYLPQACTQLSKSTA............ 177
262 7.000e-09UniRef50_A0A1B2LVY1 Uncharacterized protein n=1 Tax=Acinetobacter larvae TaxID=1789224 RepID=A0A1B2LVY1_9GAMM  ali  27  46LASSLKASVVEAFIQDGQCLDNTQATGVAAAQDITGRYVESISLAACTITAKMKSQGVASDIQAKSLVLTMSNSTAVNNWRCSS-------------------SDIAPQFLPKACQVDANAAGG........... 161
263 8.000e-09UniRef50_A0A2C9WXC4 Prepilin-type cleavage/methylation domain-containing protein n=2 Tax=Acinetobacter TaxID=469 RepID=A0A2C9WXC4_9GAMM  ali  29  43LSSQYKIAISQTYSQSSSCPT-LAELGLSSPTAASGKYVGSVDIATCAVELTFKSSGISQGLQGKHLAIALISQTGSANWRCSS-------------------TDIKQKYLPKSC.................... 145
264 9.000e-09UniRef50_A0A1M7EH05 Type IV pilus assembly protein PilA n=1 Tax=Halomonas subglaciescola TaxID=29571 RepID=A0A1M7EH05_9GAMM  ali  22  46LTVPLKAALAEFVALKGRMPTDAEEEFKDLTDGMSGKYIAGVEPHGVFFRLYFKNEGVNPDLQGKAMIMFGRNSSGSIEWLCQSASASDA--------------SIPDKYFPSSCRTA................. 169
265 1.000e-08UniRef50_A0A099CU70 Uncharacterized protein n=1 Tax=Oleiagrimonas soli TaxID=1543381 RepID=A0A099CU70_9GAMM  ali  29  46.IDGLKADVADYQHQTGACP-SAGVGGILSPASYGGRYVAGATVTSGSITALMRSNTVAQKLRGKTVTFTMTPNGGNAEWACSSNA--------------------PVTYLPQVCR................... 143
266 1.000e-08UniRef50_UPI0005855D0C prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Chromobacterium sp. C-61 TaxID=238241 RepID=UP  ali  28  49....AKTTVSESYLANNIWPANNASAGM--PSSLSGNNVSDVQISLSNGVSIITATFQASAVPGLAVVFTPSAASGAVQWVCSGQGQNI-------------------QYLPSSCR................... 140
267 1.000e-08UniRef50_A0A0F7JYY9 Pilin n=10 Tax=Bacteria TaxID=2 RepID=A0A0F7JYY9_9GAMM  ali  13  47.TSQCRTTISEVYQTGTAANAPAADDWGCGEGTTTTQYVSSISTSANGAITVTLQN-IDAAVDGETIVLTPITAPGVA----AAAANIPLQVYGFECAGDTGSGSVPTKYLPGSCKGS................. 158
268 1.000e-08UniRef50_A0A1V2VUA8 Uncharacterized protein n=7 Tax=Burkholderiales TaxID=80840 RepID=A0A1V2VUA8_9BURK  ali  32  52ISGGLQSDIQEYYAENGVLPSNGTVLPTTMP---VGKYTKVNNVQN-GLIVISFTPGANTNLRISSIGLEAVPDAGVIHWKCG-------------------AYNIPSKWLPTSCHDT................. 147
269 1.000e-08UniRef50_A0A1D3GA00 Pilin n=90 Tax=Neisseria TaxID=482 RepID=A0A1D3GA00_NEIGO  ali  74  1....................................................MKSDGVNKEIQGKKLSLWAKRQAGSVKWFCGQPVTRDKADADNDDVKDAAADNINTKHLPSTCRDKHSDT............. 71
270 1.000e-08UniRef50_A0A2H6G0Y6 Fimbrial protein n=1 Tax=bacterium BMS3Abin11 TaxID=2005719 RepID=A0A2H6G0Y6_9BACT  ali  21  54.VSPFTTAIGTYYWSESSFPTSRGDAGQ---SNIVTKYIDEITITSNGYISVDINDT-TVGVANMFLILKPILATGVIKWDCSVSDNATGTVDSLTLI----------RYVPTNCR................... 154
271 1.000e-08UniRef50_L8Y0V4 Fimbrial protein n=8 Tax=Wohlfahrtiimonas TaxID=582472 RepID=L8Y0V4_9GAMM  ali  27  44LASGAKMQVTEAFASTGVWPTENSEAGLGDANTITGQSVTGIEVLEATGYIVHYNARVTGDKATDTLVLAPVDEQGSVKWVCQKQDV------------GAAGNKIESKWLPSACRTEVAG.............. 188
272 1.000e-08UniRef50_UPI00034C9482 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Halomonas jeotgali TaxID=553386 RepID=UPI00034  ali  24  46LTAPLKSALSEFVALTGDMPKDTDELEEDLTSGMSGKYVDEVTPHGVFFRLTFKDSGINPDLQEKSMIMRFADDGKTIEWFCESASNDDA--------------SIPDKYFPGSCRTA................. 167
273 1.000e-08UniRef50_UPI000DC60447 prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Oleiagrimonas sp. MCCC 1A03011 TaxID=1926883 RepID=UPI000  ali  25  55IADGLKTPVVDHFNQSGTCPDNTAAGGISPPGSFIGKYVASVTTGGNKTTGCTIRGSVATQLAGKTVILTGKNNGGNFSWIC----------------DMNNASGIPIKYKPRACNGN................. 166
274 1.000e-08UniRef50_A0A1Z8TSV9 Uncharacterized protein n=1 Tax=Proteobacteria bacterium TMED51 TaxID=1986847 RepID=A0A1Z8TSV9_9PROT  ali  26  46LIAPVKIGLAEHFESTGDFPADG-STSVIGPSGISGEYVSSVEWVNMGFIKITFSSDAHALLRDREAWIVNQSGNNPIQWRCGSPACAGDAGSGLLALSAMTSDPVDSEYLPSTC.................... 175
275 1.000e-08UniRef50_A0A2N6CR55 Prepilin-type cleavage/methylation domain-containing protein (Fragment) n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2N6CR55_9  ali  27  47LAGAVKAAVAERYSQTGVWPTTLTELGIVDATPPTGKYVTSVDMVGPGTIQITYGNQANAAIAAETLALQAFLSPNQLVWR...................................................... 132
276 1.000e-08UniRef50_A0A1Y3DEF7 Prepilin-type cleavage/methylation domain-containing protein n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y3DEF7_9GAMM  ali  20  46.ASPAKILVSEAFMTNGSVVAAATEYNARAATEKKTQYVSDMQIGNDGVITVTLTTNGSVGLPGKTLVLTPNIGGAKLTTTIGSIDWACASASANNAAAVADLGTLAAQYAPSECR................... 169
277 2.000e-08UniRef50_C6SH30 Truncated pilin (Fragment) n=2 Tax=Neisseria TaxID=482 RepID=C6SH30_NEIME  ali  81  46LAEGQKSAVTEYYLNHGEWPANNSSAGVASATDIKGKYVQSVTV........................................................................................... 90
278 2.000e-08UniRef50_A0A2A5X217 Prepilin-type cleavage/methylation domain-containing protein n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2A5X217_9GAMM  ali  26  46LASGAKVAVAEFANTNGAYPDCNAEYGLAAANTIIGKYVSEVSVQDTTGAIVTFGTGAHAKLAGGIMNLTPSADGGAISWTCADGGGTVTVTTLLPSSC.................................... 153
279 2.000e-08UniRef50_Q2S726 Uncharacterized protein n=1 Tax=Hahella chejuensis (strain KCTC 2396) TaxID=349521 RepID=Q2S726_HAHCH  ali  18  213LLEGTRLDIAEAYAYSGVWP---DREGLHALSNVEPTYFQHIELDPNGALHFTLSPRAGEAP--RTISFRPVVSNRTLGWTCAS------AHSGPRKVYGDDKSSLPPEQLPYICRG.................. 323
280 2.000e-08UniRef50_A0A1G4AA55 Uncharacterized protein n=1 Tax=Xanthomonadales bacterium RIFOXYA1_FULL_68_6 TaxID=1802655 RepID=A0A1G4AA55_9GAMM  ali  22  147.VQALKADVQMFRLDQGRCPA-NGEGDFGTPESYAGTYVTRATIGEFCGFELEFGNTGNAQIDGRKLWW--DMGSDNAQWHCSSE--------------------VDDKWLPLDCRG.................. 243
281 2.000e-08UniRef50_UPI0001CBFF92 pilin n=2 Tax=Xanthomonas TaxID=338 RepID=UPI0001CBFF92  ali  21  32..AALQPQIAEFLAREGRCPV-NGDAGFKPPEQYASERLSSVRIGSECGIEAVIHAPKSAKIDGKALWLELDADAGS--WHCSSE--------------------IDDSQLPPNCRG.................. 127
282 2.000e-08UniRef50_A0A1V0HBB6 Pilin n=2 Tax=Neisseria TaxID=482 RepID=A0A1V0HBB6_NEISI  ali  18  53LAASMKAEVEEAFADKGSLPIKVT----VSQKDNAGSYVKVVRIEDDGTIVAAIGKEAAVPIKNTEIYLIP------------SFAVSGTGTNPRGNTVWSCSGTMDEYFLPVSCKGAKK............... 156
283 2.000e-08UniRef50_UPI000262CCD8 pilin family protein n=1 Tax=gamma proteobacterium HIMB30 TaxID=751994 RepID=UPI000262CCD8  ali  23  1........MSEAYISNGSLPASNAAAGLPAKTEITSTYVESAKVSSGVITIELQGTEVAA-LDAGSLIFEPSTSNQNLTWTCRASSSALN------------------QYVPADCRVPA................ 92
284 2.000e-08UniRef50_UPI000345CCFA DUF4339 domain-containing protein n=1 Tax=Lysobacter antibioticus TaxID=84531 RepID=UPI000345CCFA  ali  27  167.SSALKIQVAEYVATHDACP-DNDSEGFKPAEAYAGPRVAKIEFGDRCGIQLELRGIGNDQVDGKKLWQEYDRSAGS--WTCSS--------------------DIADRLLPAQCRG.................. 264
285 2.000e-08UniRef50_A0A250KWU0 Fimbrial protein PilE n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A250KWU0_9GAMM  ali  22  50.AGACKTGVMEYAAATSTLPASAAEAGCSID---PTQYVQELAVA--AGKITITLRNVHTDVNGATLVLSPTNDSDP------PATAAANGDSILGWHCGTSADPAHYKYFPANCRKE................. 155
286 2.000e-08UniRef50_UPI0009E3984D fimbrial protein n=21 Tax=Neisseria TaxID=482 RepID=UPI0009E3984D  ali  64  2..............................................................KGKRLSLWGRREAGSVKWFCGQPVQRADAGAANDAVKDAAADKIETKHLPSTCRDTSSA.............. 60
287 2.000e-08UniRef50_A0A1G0IBX2 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium RIFCSPHIGHO2_12_FULL_63_22 TaxID=1798290 RepID=A0A1G0IBX2_9GAMM  ali  22  367LADGMKIAAGEFINNNNRFPESNDEAGLPDPTLIRGRYVASGTISG-ARIIMEFGPGADKSLVSRHVFYEAEMEDGSLTWRCKSEDIAQESCPKSCVCTGS.................................. 471
288 2.000e-08UniRef50_A0A1V5FJT7 Uncharacterized protein n=1 Tax=Alphaproteobacteria bacterium ADurb.BinA280 TaxID=1852793 RepID=A0A1V5FJT7_9PROT  ali  19  1..................MPASNEEAGLRAPEELRGQVLDRFEIIDGTVASMVVGRKRLREPLERTLTFRPWVSGSPIIWSCGIADP--GLTPDYATSGEVAANPLEDKYLPSNCRQ.................. 102
289 2.000e-08UniRef50_A0A1D3JB42 Pilin n=43 Tax=Neisseria TaxID=482 RepID=A0A1D3JB42_NEIGO  ali  64  46................................................VTATMNSSNVNKEIKDKRLSLWAKRQDGSVKWFCGQPVQRDNAADPNDAVKDVTNGKISTKHLPSTCRDKHSDT............. 121
290 3.000e-08UniRef50_A0A2A5D4Q5 Pilus assembly protein PilE n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2A5D4Q5_9GAMM  ali  19  47LAAAAKTTITEFVXSTGGWPADAAQAGINVLAAQSSXLASDVTIVTDGITYTIDGTNAGIGAPGGNI-----AAAGDGTFIFQGNAANANTGIQWTCDVAVTGSTVQSKYLPANCR................... 164
291 3.000e-08UniRef50_A0A2G2I780 Uncharacterized protein n=1 Tax=Methylophaga sp. TaxID=2024840 RepID=A0A2G2I780_9GAMM  ali  18  50....LKQAVAYHYAYEGKLPESNDDVDLGSPDIYANGSLQTAAIIENGI--IELTYDAKSGVDGGVVRLVPTVVPGMLNWQCETHDYQTISKYMPQCLFIDDAKT.............................. 148
292 3.000e-08UniRef50_A0A2N7QYZ8 Fimbrial protein n=3 Tax=Rhodanobacteraceae TaxID=1775411 RepID=A0A2N7QYZ8_9GAMM  ali  27  46IADGLKTPIVEYFNQTGSCPAVGGANGTNGSLSYSGKYVKSATVAPNAAKTFKASPSVSTPLNGATVIIAGTDNGGSFSWLCDQ----------------GNASKIPTKYEPTAC.................... 156
293 3.000e-08UniRef50_UPI000DEA3852 pilin n=1 Tax=Marinobacter hydrocarbonoclasticus TaxID=2743 RepID=UPI000DEA3852  ali  24  46LASALRSEIATVFVHTGTLGVSSGAHGILTPSSYQGNYVDQIAVSD-GVINVRLGNNVNPVVLGEIITLSPSLIDGSIKWNCSFTGSPS--------------------FVPSACR................... 142
294 3.000e-08UniRef50_Q2SBM4 Tfp pilus assembly protein, major pilin PilA n=1 Tax=Hahella chejuensis (strain KCTC 2396) TaxID=349521 RepID=Q2SBM4_HAHCH  ali  32  46LTEGLKVKVVEFVQNNGRPPSTSEVVG-----SSGGKYVSTVTVFSPAIMATMQTSGVSPNVSGKTFAIV--TEDNGHSWNCGVLSPVSSA-----------HTSVSEHYLPASCK................... 148
295 3.000e-08UniRef50_UPI00077BEC34 pilin n=32 Tax=Neisseria TaxID=482 RepID=UPI00077BEC34  ali  73  5......................NDAAGVATSTDIKGKYVQSVEVKNGVVTATMASSNVNNEIKGKKLSLWAKRQNGSVKWFCGQPVTRNAKAA.......................................... 75
296 3.000e-08UniRef50_A0A2S9GXY3 Uncharacterized protein n=1 Tax=Solimicrobium silvestre TaxID=2099400 RepID=A0A2S9GXY3_9BURK  ali  17  73..SRYKVAVTEFFLVNAKFPSSNKQIGMPAAEKFRSDMIDSVNIESEGVIAINFLDF--PTIPHAWIHLVPVTETGQMHWHCVSNIPDIGRTAPDCDYD.................................... 168
297 3.000e-08UniRef50_A0A1F6T0P8 Uncharacterized protein (Fragment) n=1 Tax=Candidatus Muproteobacteria bacterium RBG_16_62_13 TaxID=1817756 RepID=A0A1F6T0P8_9PRO  ali  17  27LSSSVQRAIEAAHARGGQLPANPAELGLNAPETYSGIYVQSVSHNTQGQVTIVLSRPSLGKQAGGTVVLAPLVEGDKLHWKASPD------------------GSVPKRYLPLSYR................... 128
298 4.000e-08UniRef50_A0A1A9NHK5 Uncharacterized protein n=1 Tax=Methylobacillus sp. MM3 TaxID=1848039 RepID=A0A1A9NHK5_9PROT  ali  26  51....AKTSVAEFFSANARFPTNTSSAGFNSAASGYTRSVKWVNTAGSEKIEITLASSISSNNTSYGLILVLGTTNGIVTWKCQAVDTADSAAV------------LPSKYTPGSCR................... 151
299 5.000e-08UniRef50_UPI0004141E03 prepilin-type cleavage/methylation domain-containing protein n=2 Tax=Nevskia ramosa TaxID=64002 RepID=UPI0004141E03  ali  34  48..DGAKTSVAEYVASQGACPATTSASGVSSPTGA--KYVTSVA-TDAACNIGALVQSVNAGIDGKYIILVASKADNSITWNC-----------------ATNATTANFKYLPANCRTTGT............... 146
300 5.000e-08UniRef50_A0A1S2D982 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A1S2D982_9GAMM  ali  17  54.ASGCKIAISEAAMVGMSTPTANGF-GCEDETGPVSQYVKTIETSEAGV-ITVTAQNIGQLESNTKITFVPYTGGDVSSGSEMKSTNFTGAAPISAWKCVSTSNGVEEQYLPSSC.................... 166
301 5.000e-08UniRef50_A0A0F2J3L6 Fimbrial protein n=7 Tax=Bacteria TaxID=2 RepID=A0A0F2J3L6_9BACT  ali  14  54IAQSCKAGIIEFTATTNAWPANASDAGCQSNVAAQSQYARQLLVGANGRIQVTFQANAAGIAANNFIALIPFTGG---------VRHTNALQPVGEWRCVTNVAAEFRRYLPAACRNNN................ 165
302 6.000e-08UniRef50_A0A2D7N0H6 Pilin n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A2D7N0H6_9GAMM  ali  31  46LTSGIKTGVAEFYQSEGGYP-SATTTPALSTFQASGTYSAVALKANGVIEATMKSSGVSSDLQGAVFTFTPSVTGGSFKWSCSHELDNEAIAPKGC....................................... 140
303 6.000e-08UniRef50_Q8PG16 Fimbrial protein n=11 Tax=Xanthomonadaceae TaxID=32033 RepID=Q8PG16_XANAC  ali  22  74..AALKPQITEFLASEGRCPA-NDDTGFKPPEQYASERLSSVRIGSECGIEAVLHAPKSARIDGKAVWLELDADAGS--WRCSSE--------------------IDDTQLPPDCRG.................. 169
304 6.000e-08UniRef50_A0A023NPI8 Fimbrial protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A023NPI8_9GAMM  ali  21  47.ADMARTAVSETFQTTGVVPSKNASAGLPGAASVETKYMSDMQIQN-GGAILVTIQGTNSDADKTTVTMSPQEGN--------TGKALGSTANYSGPVGWKCTATTPTKYLPATCR................... 153
305 6.000e-08UniRef50_A0A2E4ILA8 Prepilin-type cleavage/methylation domain-containing protein n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E4ILA8_9GAMM  ali  23  46VIAPLKATIAEYDSVEGTLPPSGHFSVGAAPSSFSSDLVSRVSWSGMGAIGIVFSSSAHELIKGKGFFLCATKSGGSISWLCAGSCPSGMTLGSNPA--------VDSKLLPSGCK................... 158
306 6.000e-08UniRef50_UPI0009FA7C26 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Herbaspirillum autotrophicum TaxID=180195 RepI  ali  25  58LAGPAKLAFAEAFSVHGRAGQINYAFGDAESGAIRNISFEQGVVGIPFIRIVYVAGTVGYGADGATLLLVPNIQNGAISWDCL-------------------RASIPARYAPSIC.................... 157
307 6.000e-08UniRef50_A0A1Z8VG52 Uncharacterized protein (Fragment) n=1 Tax=Proteobacteria bacterium TMED61 TaxID=1986601 RepID=A0A1Z8VG52_9PROT  ali  23  15VIAPMKSAIAEYDSVEGVLPPAGYFATGAAPSPYSSNLVDQVHWTGMGAIGIQFSSSAHELIKDKGFFLVTKSSGQSLTWLCADTCPSGLT---------WGGTTVDTELLPSGCK................... 126
308 7.000e-08UniRef50_UPI00098D3BB9 pilin n=1 Tax=Wohlfahrtiimonas larvae TaxID=1157986 RepID=UPI00098D3BB9  ali  23  44LILPIKEEILEYYFEFGHFPFRTENLPRIANNPIKSKMVEGAVVNRGGIYIYFFQPRGQGARNFRELPVLPFVNEGSITWHCGWDAIRKAGGNMGQITTRPGVNDINIRYLPSVCR................... 178
309 7.000e-08UniRef50_A0A1H1BG88 Pilin n=1 Tax=Pseudoxanthomonas sp. CF125 TaxID=1855303 RepID=A0A1H1BG88_9GAMM  ali  17  94....YKVALTESFMSNGKWPTKASDAGLQQVNEKVGGAIRNISVGDHGTITVTFDGNFAEGAL-FQLIPQADSDTYQVRWQCRTSGDPDLKRYLPDCS..................................... 186
310 8.000e-08UniRef50_A0A239RWS3 Pilin n=2 Tax=Acinetobacter johnsonii TaxID=40214 RepID=A0A239RWS3_ACIJO  ali  19  47..SHAKTLVNETFIANGILPDIAQEYNSRSITEKQTRYVSNIHLADDGVITITITNQMNVGLPGKTLVMTPNIDGGSIDWACASDSSATAVAKNLVA----DIGTLPSAYVPPEC.................... 168
311 9.000e-08UniRef50_A0A087MIA2 Uncharacterized protein n=5 Tax=Arenimonas TaxID=490567 RepID=A0A087MIA2_9GAMM  ali  22  81.ARPIQEAVDAFYAAQGTWPRNLAQLGLGIPDDHAGGPVASITVQPFGQVAILVKPHVA---RSGVIRLTPTVADGSLEWNCRASNYAAATRLSSC....................................... 173
312 9.000e-08UniRef50_X5F608 Major pilin PilE n=325 Tax=Neisseriaceae TaxID=481 RepID=X5F608_NEIME  ali  70  5......................NDAAGVASPSDIKGKYVQKVEVAKGVITAQMASSNVNNEIKGKKLSLWAKRQNGSVKWFCGQPVQRDKADADADAVTADTAANIDTNH......................... 95
313 9.000e-08UniRef50_A0A0W0R345 Type IV pilus assembly protein PilA n=2 Tax=Legionella adelaidensis TaxID=45056 RepID=A0A0W0R345_9GAMM  ali  23  37LASSPKFAVSEYALANKSLPPDQHATAYVSPQPTPN--VQSITIADDGTAAVVITYTEAAG--GGTIALTPNIASGEISWRCS--------------------GTLPDQYLPTNCR................... 129
314 1.000e-07UniRef50_UPI00067C6E9E pilin n=6 Tax=Neisseria TaxID=482 RepID=UPI00067C6E9E  ali  68  10...........................................................TDIKGKKLSLWAKRQNGSVKWFCGQPVARADKAKDDVKAATANGTDINTKHLPSTCRDDSSTG............. 74
315 1.000e-07UniRef50_A0A1I4ZWG0 Type IV pilus assembly protein PilA n=18 Tax=Proteobacteria TaxID=1224 RepID=A0A1I4ZWG0_9GAMM  ali  23  48.ADACKSSVSEYVASQNTLPANIAEAGC--DGFVTTQYVRSLTYAATGGITVTYRTAVGDGVAGLTYELVPDTTE---------------VANGQITAWSCTGSSVRPELLPAVCR................... 145
316 1.000e-07UniRef50_UPI00046664B6 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Pseudoalteromonas sp. AC163 TaxID=1055790 RepI  ali  29  49...AIREDVTVYYLENRRFPASNEQAGVPASKFLIGNRVTGITVDNGAIH-ISLGNKASQLLKNTVLTFRPA............................................................... 116
317 1.000e-07UniRef50_C0LEX7 Type IV major pilin n=13 Tax=Proteobacteria TaxID=1224 RepID=C0LEX7_ACIAI  ali  18  48.ASSCRTTITEIYQSATASSPPAAGAWGCESASSTSKYVKSIKTTADGKVRVEAQGFNDGNIDGKFVYLEPKTTAGA-----AMTAASNMGQQVGSWDCGAPAGDTILKFLPGSCKATVTNAGTFAP........ 168
318 1.000e-07UniRef50_A0A212BKF1 Pilin n=15 Tax=Proteobacteria TaxID=1224 RepID=A0A212BKF1_9PSED  ali  19  46.ASSCRTAITEVYQSASTAPGAGGWGCESVSGTPVSQYVESISTNADGRITVVARGFNNGDIDGESVILEPRDSTGA------ALDTSAIPVQINQWACGTDSATL-MKFLPGSCKTD................. 157
319 1.000e-07UniRef50_A0A0K0XT92 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A0K0XT92_9GAMM  ali  22  621MAASAKLAIAEFYVSEGRLPNEEEAASFSQVFD--SGPVRRIDYNARLLRLVIQLGPEAGFGDNASLELVPVLQNGMVRWRCAS-------------------TSIEDTALPAQCR................... 716
320 1.000e-07UniRef50_A0A1H1G1P6 Pilin n=1 Tax=Pseudoxanthomonas sp. CF125 TaxID=1855303 RepID=A0A1H1G1P6_9GAMM  ali  24  129VAEPVKAAFAAHVAREQTCP-NNEEAGFGTPESYASGTVASISFGQFCGMELILTVPGKEALDGKAVWLEYDPSDSS--WQCSSE--------------------IDDKLLPIKCRG.................. 226
321 1.000e-07UniRef50_UPI00031D8E7F prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Cupriavidus sp. BIS7 TaxID=1217718 RepID=UPI00031D8E7F :_  ali  30  46LASGQKAIVLEEYLQTGMCPATGPRRGLPVETGITGRHVARVIVGTCVITAWFKDKDVSTPLQNRHISLIIEPGQGAIQWRCETSVWQ-------------------PRHVPATCRAAS................ 161
322 1.000e-07UniRef50_A0A126NHZ5 Uncharacterized protein n=8 Tax=Stenotrophomonas TaxID=40323 RepID=A0A126NHZ5_9GAMM  ali  20  152...GLKHQVAEFAAANARCP-INDDAGFGPPDSYASGDLAQVHIGGHCGLEAFMRVPKHAQLDGKSIWLDYDMQAD--TWECSS--------------------DVEDNFLPTSCRG.................. 246
323 1.000e-07UniRef50_Q8P4F5 Fimbrial protein n=4 Tax=Bacteria TaxID=2 RepID=Q8P4F5_XANCP  ali  22  39..APLKPQIAEFLEREGRCPT-NDDAGFHPPEHYATGTLGIVRIGAQCGVEALLHMPDNAKLDGKPLWL--DLDQDASSWDCSSE--------------------IDDKFLPQDCRG.................. 134
324 2.000e-07UniRef50_A0A1B1YWX2 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1B1YWX2_9GAMM  ali  19  46LASAARTAVDVYFSENGTLPVSHVSLGISQPRSYNAKYVSYVAVGANGATTVGNGQIVLGQARNDRVLYTPIVNAGNLEWVVSS------------------GSTAPPKYLP....................... 150
325 2.000e-07UniRef50_N9SQA9 Uncharacterized protein n=1 Tax=Acinetobacter sp. NIPH 1867 TaxID=1217702 RepID=N9SQA9_9GAMM  ali  22  43LSSSYKTAVSTLYSEKGICPT-LADMGLSSNTDARGKYVDSLSITNQPGKICSFNTGITSFLQNKHL----------------SFSMTSYSSSIGSSEWECTSSDIAQKYLPTAC.................... 145
326 2.000e-07UniRef50_A0A2E5Q7P5 Uncharacterized protein (Fragment) n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2E5Q7P5_9PROT  ali  29  43LVESAKKAMVEHHGINGVFPASNSEAGIPHHNDIKGTYVRRVKIRTFGGWSE----------PGILLRLEPKPDT............................................................ 107
327 2.000e-07UniRef50_A0A009ZY00 Fimbrial protein n=24 Tax=Proteobacteria TaxID=1224 RepID=A0A009ZY00_9GAMM  ali  25  47..STCRTAVSEAYQSASSLPAAGDFGCTGSSSSAASKYVQSVTTQTGGIILVTTTTEGSKDAGGKEILMTPLKADGTTAATANSPVGAWKCGPSSDATK-----KMPVKYLPASCRG.................. 158
328 2.000e-07UniRef50_A0A2X0TBU2 Fimbrial protein pilin n=2 Tax=Acinetobacter haemolyticus TaxID=29430 RepID=A0A2X0TBU2_ACIHA  ali  22  45VASFYKVEMANIYIEKGNCPT-LSDFSLDNAGTIQTRYLKSVVIADCAFTISFNNIRISPFLENKQIQIAMTSKVGGIEWNCIS-------------------TNIQQKFLPKTCQG.................. 146
329 3.000e-07UniRef50_UPI000954FFA8 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Pseudomonas alcaligenes TaxID=43263 RepID=UPI0  ali  19  47.ASALKIGVTEAFADSGMNGVGLYAAEVNADQQNLTTKISAIAIDGGNGRITITLGRIAQLNGQDTLIFTPTINGQGIS----------DANSTGTIQWDCSAGTIIDKYLPATCRN.................. 154
330 3.000e-07UniRef50_A0A0M1JJ80 Uncharacterized protein n=2 Tax=Achromatium TaxID=44937 RepID=A0A0M1JJ80_9GAMM  ali  20  112LGSGARVHLVEHYAQHGNWPTK-----HFRDINANGNY-TSMTLE--HGTITGRRQNSDLHLSMRPAILNPQAMT--VVWVCGYAKP-----PPGFIVEGNNRTNMPPQYLSHVCRQ.................. 213
331 3.000e-07UniRef50_Q5P2X6 Fimbrial protein PilE (MS11 antigen) n=37 Tax=Bacteria TaxID=2 RepID=Q5P2X6_AROAE  ali  28  48..AAAKTSVSEYYISEAVMPADATAAGIN--TGALGSYVNGVTSDTVGVIEVTLTSGITTDLNGKKFKMTGTGSAQGVAWVCAT-------------------TDAPAKYLPASCR................... 144
332 3.000e-07UniRef50_A0A2P1PTB2 Uncharacterized protein n=1 Tax=Ahniella affigens TaxID=2021234 RepID=A0A2P1PTB2_9GAMM  ali  22  83MSQTARIGFGEYLANTGGVPADNAALGLAPPESYAGRHVKSVTVQGDGKIVLAFQPRSGRSDFYLTWTSDYRRDTGMSLWRCETN.................................................. 168
333 3.000e-07UniRef50_A0A0Q8F1Y8 Uncharacterized protein n=7 Tax=Xanthomonadaceae TaxID=32033 RepID=A0A0Q8F1Y8_9GAMM  ali  21  152....LRGEVKAFFDAEGRCP-SNGEGTFGTPESYAGTYVTRAVIGEFCGFELEFANTGNAQIDGRKLWW--DLGSDNSEWHCSSE--------------------IDDKYLPLDCRG.................. 245
334 3.000e-07UniRef50_UPI00048B354A prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Paludibacterium yongneupense TaxID=400061 RepID=UPI00048B  ali  21  44LAVG-RNALAEHVLAEGAFPPD----GYDGMDSAATDYMAGLEVGSGGVLSVRVRNT-GSEADDKYFSLVGEVLAGAIVWRCR-----------PGDAVGGDSRAVPARYLPGPCRRGEKGG............. 151
335 3.000e-07UniRef50_A0A0Q9YBU7 Fimbrial protein n=20 Tax=root TaxID=1 RepID=A0A0Q9YBU7_9COXI  ali  24  48VAANAKTAVSEFRIAQGSFPTSNATAGV---TTISTALVSSLGVGANGVITITGNQTALGTGAAFAITLTPSFANGAVSWDCSATGATQFAPAS......................................... 138
336 3.000e-07UniRef50_F9UDP9 Uncharacterized protein n=4 Tax=Thiocapsa TaxID=1056 RepID=F9UDP9_9GAMM  ali  22  50MASSLKSTVVEQAANGG---LANVKTGIVGDSASFSRYVRALAIEDAGVISVTTQNTGARVDPE--LRLVPSENGGGIVWSCLKTSATLASQ------------------VPPICRDDAGGYRTSTDPKD..... 157
337 3.000e-07UniRef50_Q2SBM3 Tfp pilus assembly protein, major pilin PilA n=7 Tax=Proteobacteria TaxID=1224 RepID=Q2SBM3_HAHCH  ali  27  46LTSAVKGSMAEAFQNTAVRPGLGEVGAVTSGKYVAGMTVVEITTNRWAVVATMKTAGVNANIAGAT--FATATYDGGQHWTCGSVAVENDGATAFTGA--SDNTTVNNQYLPSSCK................... 157
338 3.000e-07UniRef50_A0A1I1QCL4 Type IV pilus assembly protein PilA n=28 Tax=Proteobacteria TaxID=1224 RepID=A0A1I1QCL4_9BURK  ali  20  53.ATAPKTLISEAFQTDGINGLKAAADSYNAPGQIATKYVAGIVINNATGQITVTTAGASAGLQGTTLNFLPNVQAGAIDWACSSLTFATATSRGLT---GMAAGTLPAKYAPAECR................... 181
339 3.000e-07UniRef50_D0W5Z3 Prepilin-type cleavage/methylation N-terminal domain protein n=2 Tax=Neisseria cinerea TaxID=483 RepID=D0W5Z3_NEICI  ali  24  99LAAPAKLAVAETAASLGGLTKVTTDNTGYKFS--ATKYVSSIAIANGGQITITTKDTGADENPVFDLKPTQTKLEDPIEWACTYSKGS-------------------PKHVPANCR................... 193
340 4.000e-07UniRef50_U2FXH2 Pilin protein n=15 Tax=Gammaproteobacteria TaxID=1236 RepID=U2FXH2_9GAMM  ali  26  49LVSGVKTAVADAYQSRDDLDGDNGVGSIPAASAITGTYVENVVVADGIITATFKTDSA---LDGKTMTLIPTINKDALAWQCTTTAPPAKAPSTCNEATPNNIGS.............................. 151
341 4.000e-07UniRef50_UPI00098D53BE pilin n=1 Tax=Wohlfahrtiimonas larvae TaxID=1157986 RepID=UPI00098D53BE  ali  23  35..GPLKSALIDFYNNHGRMPNNFRELGPVVDVNYAGVYETSVQIYKNGVLYLYVTEDIQEKPNARMVPIMPIMGDGSITWICGAEAVRQYPTIATTV---WGTNSIRDKYLPAECR................... 171
342 4.000e-07UniRef50_A0A1X3CHW0 Uncharacterized protein n=2 Tax=Neisseria TaxID=482 RepID=A0A1X3CHW0_9NEIS  ali  18  55MASQLKTTVSAAYTAGGMRRVSSVAKSHNAFPDVQTKYVATTTIDEQTGAISIQTSDSDSDARNKTLAWTPAVKVASIDWACASDSAKTAGDRGFTNVKM---GTLPAKYAPSECR................... 181
343 5.000e-07UniRef50_A0A2P8F2A7 Type IV pilus assembly protein PilA n=1 Tax=Marinobacterium halophilum TaxID=267374 RepID=A0A2P8F2A7_9GAMM  ali  19  45LTDGVRQTVGIYFYEYGRLDVASSASDSNRAAALDGRYVSQVSIGAAGSIGVAFDQGA---LAGMGLRFEPSVSTSQITWRCIADGSVAGASAP-----------VPDKYLPSSCR................... 153
344 5.000e-07UniRef50_UPI000A01A0E1 NINE protein n=1 Tax=Andreprevotia chitinilytica TaxID=396808 RepID=UPI000A01A0E1  ali  25  158......AAVEAYYLKTKQVPESLEQAGFAVPKPLS---VSQISINKNGILTLTLEIVA---LKGQSLLLIPSVDDDKVSWKCASD-------------------DIAEQFLPMECRSKEPAPPAKN......... 253
345 5.000e-07UniRef50_UPI00040BB9DB prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Zooshikella ganghwensis TaxID=202772 RepID=UPI00040BB9DB  ali  25  46.VESVKTKMVEHYAFQGSWPANNAALGSRIAGANTEAGVSSITITNSQISI----GFGPRVQTGGRLVLQARDLNGNLEWDCVTASTTLST............................................ 131
346 5.000e-07UniRef50_A0A091AX12 Uncharacterized protein n=2 Tax=Arenimonas TaxID=490567 RepID=A0A091AX12_9GAMM  ali  21  132LAEDLKPAVEQHYQRVGTCPTN--ESPFQAPETYAGRYVARIELQGGPTAIFRTDESVTSVLRGSRVTMSGVPDGDSFTWTCRSSIP................................................ 221
347 5.000e-07UniRef50_A0A1F4BI58 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1F4BI58_9PROT  ali  27  46LTAGGKTPLAEFFADKGVWPSTAD----IVMGNTAGKYVSNITLGGNAVIASMKSAGVNSSITGSTLILT---SNDGKSWNCTS-------------------GTVSSKYRPAACRS.................. 143
348 5.000e-07UniRef50_Q07565 Fimbrial protein EcpD n=6 Tax=Neisseriaceae TaxID=481 RepID=ECPD_EIKCO  ali  29  46LMDGLKSSVADNYFNSMICADNQTVNGIAQRSRISGNYVESIHTRNCEMLATFKSTDAAAPIRGKTVLLSMKIVDGGTVWNCSS-------------------SDLANEFLPTACRH.................. 152
349 6.000e-07UniRef50_S6AIV9 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=2 Tax=Betaproteobacteria TaxID=28216 RepID=S6AIV9_9PROT  ali  27  47.ASSGRTAVSETFSQKGTMALSQASMGVQTQD---SKYVASVTVGDITVLTKTLTDLGGASNTTMILRGTGTVGTGSVAWQCG-------------------KGTMPAKYLPSSCKD.................. 147
350 6.000e-07UniRef50_Q5H5D5 Fimbrial protein n=135 Tax=Xanthomonas TaxID=338 RepID=Q5H5D5_XANOR  ali  21  146...PLKPQIAEFLASEGRCPV-NGDPGFKPPEQYASERLSSLRIGSECGIEALIHAPRSAKIDGKALWLELDADAGS--WHCSSE--------------------IDDTQLPPNCRG.................. 240
351 7.000e-07UniRef50_A0A0W0XR53 Type IV pilus assembly protein PilA n=27 Tax=Proteobacteria TaxID=1224 RepID=A0A0W0XR53_9GAMM  ali  22  44LAASAKLAVSETAITNNALPATQAATGYVSPA--ATPNVTSITIGAGGVITITYTAAAG----GGTIIMTPTLANGDVTWVC-------------------TGGTLLAKYRPASCR................... 135
352 7.000e-07UniRef50_A0A1V3P845 Uncharacterized protein n=1 Tax=Rhodanobacter sp. C05 TaxID=1945855 RepID=A0A1V3P845_9GAMM  ali  31  327LFEGSKMAVEEYALHHDRMTANNDAAGLADPDLIKGKFVRRVVVTNGVIAAMLRDKPGSMATAGSRVVPHPDSTRKSLVWTCESPDIPAIAQLAVGCVYRPG................................. 431
353 7.000e-07UniRef50_A0A0K1K0J5 Peptidase M48 family protein n=6 Tax=Oxalobacteraceae TaxID=75682 RepID=A0A0K1K0J5_9BURK  ali  24  313....ATAAVERYFYVNGRNPDSLAEAGYALDDPNHS--VVDVKVDGASGTVQVFPADFSY--RGKAIAFMPADENKKLVWRCGSD-------------------GIPAKLLPADCRGSENN.............. 407
354 7.000e-07UniRef50_A0A1V3SQ15 Pilin family protein (Fragment) n=1 Tax=Neisseria meningitidis TaxID=487 RepID=A0A1V3SQ15_NEIME  ali  77  1....................................................MASSNVNNEIKDKKLSLWAKRQDGSVKWFCGQPVERA-AKDDTIKA..................................... 45
355 8.000e-07UniRef50_A0A0A6RMB0 Uncharacterized protein n=1 Tax=Candidatus Thiomargarita nelsonii TaxID=1003181 RepID=A0A0A6RMB0_9GAMM  ali  20  138.MSAIKPLVMEYYSMTGKYPSTFEEIGLKRTDMSSGKYIDDMVIGKKGELIVKPSQELG---DGVIIALVPTMGGMSMEWDCETS.................................................. 220
356 8.000e-07UniRef50_P17838 Fimbrial protein n=46 Tax=Proteobacteria TaxID=1224 RepID=FMP1_PSEAI  ali  34  46LASGLKTKVSDIFSQDGSCPANTAAAGIEKDTDINGKYVAKVTTGGCTIVATMKASDVATPLRGKTLTLTGNADKGSYTWACTSNADN............................................... 142
357 8.000e-07UniRef50_A0A2T6FL92 Uncharacterized protein n=1 Tax=Cellvibrio sp. 79 TaxID=1954207 RepID=A0A2T6FL92_9GAMM  ali  17  181LVDGTRAQVEKVILEKKFFPSENIMAGL--PEDISTPHVRSIRLSAGAKLVVTYNAMSAGKAP--TIIWTPKKSGKNIVWDCK-------------------GGTLQDKHRNPECRGGAKTDTTNAP........ 284
358 8.000e-07UniRef50_C8N946 Uncharacterized protein n=3 Tax=Cardiobacterium hominis TaxID=2718 RepID=C8N946_CARH6  ali  17  72..SVLKTYIAEYHANTGETPADLDALGL-PPDWLPSDLLQEVEVRPGGLVVMHFTPESGLQGE---VRLQMRVDSAAYQWDCSGNIPEIAEASDGC....................................... 161
359 8.000e-07UniRef50_A0A128PKV8 Pilin n=26 Tax=Bacteria TaxID=2 RepID=A0A128PKV8_LEGPN  ali  20  44LADSAKLAVSETAITNNALPPTQAATGYVSPA--ATPNVQSIAIGANGVITITYTAAAG----GGTIIMTPTLANGDVTWTC-------------------TGGTLLAKYRPASCR................... 135
360 8.000e-07UniRef50_C6WWV6 P(-)rp(+) fimbrial protein n=10 Tax=Nitrosomonadales TaxID=32003 RepID=C6WWV6_METML  ali  20  72......APIAAAWATSQVMLADNAAADLPSSDKVVSNFISDTKIEN-GVIHMTFGNKAHPKIKDKVLSLRPAVIEESVAWVCG-----NAKAPDNMVVKGENKTNIPDEYLPRLCR................... 179
361 9.000e-07UniRef50_A0A1F4E502 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_65_14 TaxID=1797501 RepID=A0A1F4E502_9PROT  ali  18  51....CRNTIQEVYMSGGALPGVDE---WGCEGTGVSRFVERISTTAEGIVLVTLSGNVADRLAFHDVSLAPLNSAGQV----MNDLDSGSPVRRWRCGSPADGTDLSANFLPSSCRGS................. 158
362 9.000e-07UniRef50_A0A1A9HS52 Uncharacterized protein n=3 Tax=Mitsuaria TaxID=65047 RepID=A0A1A9HS52_9BURK  ali  31  47.ATQPKAAIQEYYTVKSGWPTTAD----IPTGNIKSQYVKSVAYDDTAHTVTAVATGIDKDIDDKKIVLTGTIAGTSIDWKCTSP-------------------DIDKKYLAASCK................... 141
363 9.000e-07UniRef50_A0A0T6W2V6 Pilin n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0T6W2V6_9ALTE  ali  26  33MSSGAKTAIAEYGQINGIYPGAATD-PKAADLAVGGQYADAAVADDTGIITITFKGDVNANIAGKTVTLTPPALN-----------------TDPTSFDFSCTSTIAQKYLPKSC.................... 131
364 1.000e-06UniRef50_A0A022IJN2 Fimbrial protein n=11 Tax=Moraxellaceae TaxID=468 RepID=A0A022IJN2_9GAMM  ali  29  45MAGAIKAELIAKYGESGTCPSSPIDFGLDSSGTVNAKYVDKVGINTCAFEFTFNTTGMNAGVAGKKLIFAMYAGNGSARWECASSE-------------------ISQMYLPSVCRG.................. 150
365 1.000e-06UniRef50_A0A1A8XSI7 Fimbrial protein EcpC n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1A8XSI7_9RHOO  ali  29  47.ASSGRTAVAETYSQKNTMDLSQASMGVQTQSTKYVHSVSGVSATQGDIIVTTSSDTGLGAAASKTLILRGNTSTGTVGWQCG----------------VGATNPISPKYLPSSCKD.................. 150
366 1.000e-06UniRef50_UPI0009E1CFCC hypothetical protein n=1 Tax=Dyella-like sp. DHo TaxID=1664276 RepID=UPI0009E1CFCC  ali  29  15............YANYGHFPTTPESAGLPSSGDISGKYVSHVATQNPGQILIHFDSDAHAMPAGKQVGLSAITGEGAIHWSCTNANITDRQLL---------------RYMPSSCR................... 109
367 1.000e-06UniRef50_A0A1H6F9K6 Fimbrial protein n=2 Tax=Thiotrichales TaxID=72273 RepID=A0A1H6F9K6_9GAMM  ali  25  45LMAGLKTPVEEYIGSKGVWPTNTAAITGLLGGKVTGKYTSMITPAGGATGPYGFQKGVSADWGGKGLSVHLQYITSDKSWDCKS---------GIVANQVAGTDALDPAYLPTACK................... 156
368 1.000e-06UniRef50_A0A2U9T6J6 PilA-related fimbrial protein n=1 Tax=Lysobacter maris TaxID=1605891 RepID=A0A2U9T6J6_9GAMM  ali  22  124VAEPLKANVAAFAASEGRCPL-NGEGGLGEAEDYAGNGLAAIHAGPFGCALELEFDGTGTSIDGSTLLLEARSGDNDWDWRCGSDSLKHGR-------------------LPRHCRDDDADA............. 232
369 1.000e-06UniRef50_A0A2T1AQ11 Type IV pilus assembly protein PilA n=1 Tax=Paraburkholderia insulsa TaxID=1441714 RepID=A0A2T1AQ11_9BURK  ali  24  55IIGGIQTSMQEYYATTGSFPVDLDQLGINVP---IGKYVESISVYQGSVIQVVFGNSSNANIQQKSLLMTAQDDGGNISWTCTSPDMSQAYLPTGCTSSA................................... 182
370 1.000e-06UniRef50_I4WGG3 Fimbrial protein (Pilin) n=1 Tax=Rhodanobacter sp. 115 TaxID=1162282 RepID=I4WGG3_9GAMM  ali  24  200.....QAAVEAYLRDHGGLPDDNKMVALPSPADLHRYNVSDVEVVKGSLLLKFDAATADEHLAGRQVLLIAVRHERQVRWHCATL-------------------DVDVRYLPIHCSGGS................ 294
371 1.000e-06UniRef50_UPI00082516BA prepilin-type N-terminal cleavage/methylation domain-containing protein n=3 Tax=Halieaceae TaxID=1706372 RepID=UPI00082516BA :  ali  21  50.MSELKTSVTEYYSATGRLPNGDSQAGVGDAPNTDITQTVSYDATNAPVIYANVVGSVFPDGDARYFVLSGITVGAEIRWVCKPSATTAPGGAVSTDFSN------DTNWLPATCRG.................. 161
372 1.000e-06UniRef50_A0A0R0CIE0 Uncharacterized protein n=2 Tax=Pseudoxanthomonas dokdonensis TaxID=344882 RepID=A0A0R0CIE0_9GAMM  ali  27  159VAPALQSRVESYYRQHQRCPG-NESPGFPAADTALG-SVASVQIGGHCGFELRLGEQRSEHLDGKALWF--DLDHASGQWTCSSE--------------------IENRYLPARCRTP................. 256
373 1.000e-06UniRef50_A0A1I6GJJ5 Type IV pilus assembly protein PilA n=2 Tax=Marinobacter gudaonensis TaxID=375760 RepID=A0A1I6GJJ5_9ALTE  ali  23  51LLGGLKTPISEYYLSNGAVPTIAQLGSITDD----GEYVRSITFDGTDDYVATFAGSVSAKLAGQSMTLTFVTTDSSFTWSCSMPT................................................. 134
374 2.000e-06UniRef50_UPI00047744EF prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Thioalkalivibrio sp. ALJ24 TaxID=545276 RepID=UPI00047744  ali  19  47VSADLRSSIAAFYNENQSYPE-GGEISTIYDGTLEGRYVDQVELDAGGIITITFG---SGNLDGETVVLSPKEGTAQISWDCTD-------------------GTVDGQYLPRAC.................... 139
375 2.000e-06UniRef50_T0YN25 Membrane protein containing RDD domain protein (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T0YN25_9ZZZZ  ali  37  416MAESAETDVAQFYANTARYPADNASAGLPSAGSISGNYVAAVAVRDGNILVQY.................................................................................. 468
376 2.000e-06UniRef50_A0A1P8UJE3 Uncharacterized protein n=1 Tax=Acidihalobacter ferrooxidans TaxID=1765967 RepID=A0A1P8UJE3_9GAMM  ali  23  47ISSGVRTAVAEYYARAGTF-ANITTAKLGITTLPVGKYAAVGTIAANGVISVHYTSATNTKLQTGSLVESPYAANGAVQWSCTGSTASIKSYLTSFC...................................... 142
377 2.000e-06UniRef50_UPI0009BFDE37 hypothetical protein n=1 Tax=Metallibacterium scheffleri TaxID=993689 RepID=UPI0009BFDE37  ali  18  29VASGPQINAVIYHAVHGRWPSSRNRD--IVAADSNGNYVEHLALGEGGVITAELRGPALGVLTGRFLSFRPELLGSKDAPSISFLCGYAKPVAGAIETTTANRTTLPKKYLPPFCR................... 153
378 2.000e-06UniRef50_A0A1F4CPY3 Uncharacterized protein (Fragment) n=1 Tax=Betaproteobacteria bacterium RIFCSPLOWO2_12_FULL_68_19 TaxID=1797504 RepID=A0A1F4CPY3_  ali  17  18.....RAAVAEHYAQNKQLPNGVADLAKDLVPQEPASRNGAASLGANG-MLTLTMTPATGAMAGKTILFRPQAEPGGLIWDC-------------------TGGTLEPRYRPATCRAP................. 110
379 2.000e-06UniRef50_UPI000554F9B9 prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Pseudohaliea rubra TaxID=475795 RepID=UPI000554F9B9  ali  26  50VAAEGKTTVAEFVAARGVVPADSAAAGITTVGFGPQSYVSSSTVGVYTITLTTNATDIPNDILSDTFTLTGTVDPASVSWVCAP-------------------GTIPPKYLPSSCRG.................. 156
380 2.000e-06UniRef50_D5CR81 Uncharacterized protein n=4 Tax=root TaxID=1 RepID=D5CR81_SIDLE  ali  27  213........VDAYYSTYRTTPRNLEAADFLSSLPSA---VKSVTIDSQSGTVTITMKGAAA-IEDKTIRFVPAQGGDQLRWACMSD-------------------DIQDRYLPQECRRS................. 299
381 2.000e-06UniRef50_A0A2G2I7H2 Uncharacterized protein n=1 Tax=Methylophaga sp. TaxID=2024840 RepID=A0A2G2I7H2_9GAMM  ali  22  42....LRFASKEYFDGMGELPSSNAQLGMGAPEDYSNLALHSASIIEGGTIELVY--KVNTGIEGGIIRYVPTIVPGMIKWSCETPDYVDIA............................................ 126
382 2.000e-06UniRef50_A0A1A9F5H9 Uncharacterized protein n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A1A9F5H9_9GAMM  ali  33  46ITDGLKVAAQEYYADNGVCPTSAGDAAIDLNTDLDGSYVAQVTVIGDTFTATYKATGVAKKIQGKTLTVAGNMDAGSVDWVCDQSMGPVAAAGMLVQDNPEVA--------PSACR................... 166
383 2.000e-06UniRef50_A0A220SNW4 Pilin n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A220SNW4_9GAMM  ali  16  48..SSCRTTVTEVYQSGSALPAADDWGCETNATGNNTAKVTSVATSDAGITITMNGTEISQLGTNNVITLVPLKDAT------TAASAAGDNIFGWRCGDTADGTTVPSQYLPSSCRG.................. 158
384 2.000e-06UniRef50_UPI0006734D67 DUF4124 domain-containing protein n=1 Tax=Gilvimarinus polysaccharolyticus TaxID=863921 RepID=UPI0006734D67  ali  19  307..SIVKTMVAEYYQMRGVMPASISVLGITSETVQSSAYLSALQMQAPGVIYAELN--AGKFSAGQFIELTPEISKGLIEWHCETSVDVKMSACPS........................................ 399
385 2.000e-06UniRef50_A0A172YN91 Uncharacterized protein n=1 Tax=Acinetobacter sp. NCu2D-2 TaxID=1608473 RepID=A0A172YN91_9GAMM  ali  25  44LLSGYKNEMHEFYSEGGSCAGIQA---YMNNVDTHGHYIDQISIQTVGTEFHFKSTNVVHGISGKQVNFLMK--GNSYNWLCYSP-------------------NISERYLPSNC.................... 138
386 2.000e-06UniRef50_A0A1B6VYS9 Uncharacterized protein n=3 Tax=Neisseriaceae TaxID=481 RepID=A0A1B6VYS9_9NEIS  ali  17  94.ASGLRTDIALFLADHGRMPNSLNEIGW--AGGVTSVNLSAIEMRQGGILVLRF----NPEKLRGTIILTPQTNMEAIGWSCTSPDIDFIAEALPEC...................................... 186
387 2.000e-06UniRef50_A0A2I7N917 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Neisseriaceae bacterium DSM 100970 TaxID=2052837 RepID=A0A2I  ali  26  45.ANNAELAVNEYYMTNHEFPTTNDQAGL--ATNITGQYVTNVEVSNPFIRVTFSIPGLSTSYANDLRFLVTVNSDATLTWKC-------------TALGQSGAYRMDRAYIPTAC.................... 152
388 2.000e-06UniRef50_A0A222FKQ5 Pilin n=2 Tax=Oceanospirillales TaxID=135619 RepID=A0A222FKQ5_9GAMM  ali  27  47LVAGLQSDIAVLVAENGKIVEADYADGTASAGKLTGKYVKDVTVGASGVLTITFDAGA---VAGKGMKLTPTISNGTIEWTCAPA----------------DTDGVEATHLPSGCR................... 147
389 2.000e-06UniRef50_A0A251X4M1 Uncharacterized protein n=1 Tax=Thioflexothrix psekupsii TaxID=1570016 RepID=A0A251X4M1_9GAMM  ali  25  45LMAGLKLPMMDYYTTWGTWPTVEQVGG-----KTQGLYVESVVSGGTNYYVEATMGGADPDLGGHSLRMYYEQNTGS--WLCTPDGA---------------TNPIPVHLLPSSCK................... 140
390 2.000e-06UniRef50_A0A1E4K9B0 Uncharacterized protein n=2 Tax=Xanthomonadales TaxID=135614 RepID=A0A1E4K9B0_9GAMM  ali  24  124VAATQRTAVAEFYLSNGRCPR-NGDEGFEAPESYANPYLATLEFADAGCEIRATPRNLGARLDGARLILHM---DSQQHWTESGE-------------------NIAPRYLPTSMRRNS................ 221
391 2.000e-06UniRef50_A0A1G0XFB8 Pilus assembly protein n=2 Tax=Legionellales TaxID=118969 RepID=A0A1G0XFB8_9GAMM  ali  25  45LSAVAKHDVTEIIANEGRLPNK---MGGNYKSPSATENVKSIEITPGSGDVTIYFTK---KAGGGTMVLHPVSSTGDISWGC-------------------TEGTLDSKYRPSNCRK.................. 138
392 2.000e-06UniRef50_UPI0009FCB19C DUF4124 domain-containing protein n=1 Tax=Gilvimarinus agarilyticus TaxID=679259 RepID=UPI0009FCB19C  ali  17  325..SALKVMVAEYYQVRGVMPLSMAAMGVGAEQAQSSRYFSALHMQAPGVIHAELN--AGTFPAGHFVELIPQVSQGLIEWHCETSLDTQLP............................................ 413
393 3.000e-06UniRef50_A0A2M9EC62 Uncharacterized protein n=3 Tax=unclassified Xanthomonadaceae (miscellaneous) TaxID=57609 RepID=A0A2M9EC62_9GAMM  ali  19  72.AAYLKTMIAEYYAEHQRLPTSLSDLNL-AHDWTPNSRLKAVKIDGNARVTMVIDAAHSKG----TLVYVPGIQDQFVEWRCSTPDIRDIGRHLPTC...................................... 163
394 3.000e-06UniRef50_A0A258ZCS5 Uncharacterized protein n=1 Tax=Gallionellales bacterium 24-53-125 TaxID=1970510 RepID=A0A258ZCS5_9PROT  ali  32  192........VADYYYQHQRVPGSLAEAGFEATVSPGIKGV-GVNSQDGVVTITMGAGPVN----GKSLQFVPSIDSKQIVWQCTSSE-------------------IQDRYLPQQCRQP................. 278
395 3.000e-06UniRef50_UPI0008BF3D74 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Pseudospirillum japonicum TaxID=64971 RepID=UP  ali  24  52..GQVRSEASVFYQSMGHFPNQLSELGVNA---IHTKYIQSVSLGNQSLQIRAYLDPVDAQSNGIMLSSAPSASDGSLQWRCQSTSIQG----------------IKAHILPGHCR................... 155
396 3.000e-06UniRef50_A0A258ZE25 Uncharacterized protein n=1 Tax=Gallionellales bacterium 24-53-125 TaxID=1970510 RepID=A0A258ZE25_9PROT  ali  26  236......LAVARFYHNNGRVPAALSDAGVKI---RRSPHVAGIDINQQGEITVTFSATVRKGISSKHLIFTPTAADQSISWKCHSA-------------------DIEMQYLADTCK................... 325
397 3.000e-06UniRef50_A0A2E4IJU8 Uncharacterized protein n=1 Tax=Acidiferrobacteraceae bacterium TaxID=2024893 RepID=A0A2E4IJU8_9GAMM  ali  25  46LAPVVKTAYEEYYSVYGALPPEDKPSGGQYSDKRPSQYVRHVRARTREFWTFSPGGTISSKIAGKRFWLLADPSTGSLAWECSCKRRQFHNCGDDQE--------ILEKYLPSSC.................... 180
398 3.000e-06UniRef50_A0A0W0R9Q6 Fimbrial protein, type IV pilin, PilE n=3 Tax=Legionella TaxID=445 RepID=A0A0W0R9Q6_9GAMM  ali  25  44LANTAKLAVSDSAQKNGTLPADNNAAGYSPPNATSG--VSSINIQDGLITISYT-----PQAGNGTIILTPTVSGGEITWDCR-------------------AGTLLDKYRPPICRGGSDVA............. 141
399 3.000e-06UniRef50_UPI0003760379 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Arhodomonas aquaeolei TaxID=2369 RepID=UPI0003  ali  28  46VTDGLRKSLTEYYSNKGSFANVASDTGINSADQLSGTYTNSVTVTSSGTMEVAIDSGVH---QGQTFTMVPKTASDGVGWRC---------------------GGLGAQYLPSSCR................... 142
400 3.000e-06UniRef50_T1AHL5 PilA2 (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1AHL5_9ZZZZ  ali  20  46IIGSLETAFEECYANTGTAATTNAAVGIPTTKKIAGTYVKSAQLGNYGQITVTYNTNANADIANGTVVWTPYKSDGDITWLCNDGTATANSIATGLVPVTGGSTPVNGSYLPA...................... 166
401 3.000e-06UniRef50_A0A2A9KHQ4 Tfp pilus assembly major pilin PilA n=1 Tax=Collimonas sp. PA-H2 TaxID=1881062 RepID=A0A2A9KHQ4_9BURK  ali  30  219...GQKATVASYYSEHKQVPSDLAQAGFVETLP---KSVKEIDIDKSNGVVSVVM--AGGIIEGKILNLVPSDAANHIKWRCMSQE-------------------IKDKYLPLECRQ.................. 311
402 4.000e-06UniRef50_A0A1X0N826 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=15 Tax=Proteobacteria TaxID=1224 RepID=A0A1X0N826_9PSED  ali  37  49LTDGAKVAVAESFQTTGALPANPAAANYGGA---SGTYTASVTIANGVITATALNAPVNTAIRGQTFVLTPVLTNNSITWTC-------------------TAGSIIPQYRPANCR................... 144
403 4.000e-06UniRef50_UPI0009F7043F hypothetical protein n=1 Tax=Acidihalobacter prosperus TaxID=160660 RepID=UPI0009F7043F  ali  26  6....................TTNLYFGLAPAASISSKYTQSVSVLSNAITITY--NELGNSTTGDQLQLVAVPAGGSINWVCISGANPTVTTSQGSITSTLTKA-LPGKYAPANCR................... 98
404 4.000e-06UniRef50_A0A161HEN5 Pilin n=3 Tax=Chromatiales TaxID=135613 RepID=A0A161HEN5_9GAMM  ali  21  46.ASAGRTDISEYVSVEGELPPATYTVETQQSTKVAS------STWDGTDVIVTAATGIHDDVDGETINLRPNVTGNTANWTCG--------------------GSIPARFRPASCRD.................. 135
405 4.000e-06UniRef50_A0A1V5JR52 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium ADurb.Bin510 TaxID=1852870 RepID=A0A1V5JR52_9DELT  ali  21  47....LRLLVEQYYAEHGLYPTSNEQAGLKSPGSYSSGALKRATVGRHGQIELVMTKRSGRYDGNLTMVPQFRNEREGIVWLYQTTNLKGL-----------------DKHLPG-CR................... 140
406 4.000e-06UniRef50_A0A2T1A2S0 Type IV pilus assembly protein PilA n=1 Tax=Paraburkholderia insulsa TaxID=1441714 RepID=A0A2T1A2S0_9BURK  ali  27  51LMEGLKPAIADYFMNTGNMPVSNNDIGYTSMP--SGKYTQLAMVSNTTGNSAQFGNSANSNIAGKHLNLVGTSTGGAMQWSCESNWDGDTSSAVPQ....................................... 155
407 4.000e-06UniRef50_C6SH32 Truncated pilin n=3 Tax=Neisseria meningitidis TaxID=487 RepID=C6SH32_NEIME  ali  65  3............................STATDIKGKYVQSVEVKNGVVTATMASSNVNNEIKGKKLS................................................................... 42
408 5.000e-06UniRef50_A0A2G6YCA9 Type IV pilus assembly protein PilA n=1 Tax=Acidovorax sp. 62 TaxID=2035203 RepID=A0A2G6YCA9_9BURK  ali  21  47.VGPVKIAMSEGFASSGALDSVAAALNALPLNEKATKYVKNVSVAGAVEVAATSSNGIPNGLDGLTLVFSPNIAGGAIDWACASTSANQATGRGLANR---TLGTLPARYAPSECR................... 175
409 5.000e-06UniRef50_A0A128T2Y7 Pilin n=32 Tax=Legionella TaxID=445 RepID=A0A128T2Y7_LEGPN  ali  23  44MASAAKLAVVETSLIDNTLPANQADTGYTSPAPTIN--VASIAIGNQGIITITYT--ANAGNGTITMVPTIDATNRILTWDC-------------------TGGTLISKYRPAYCR................... 136
410 5.000e-06UniRef50_UPI0002EBDB95 DUF2628 domain-containing protein n=1 Tax=Methylovorus sp. (strain MP688) TaxID=887061 RepID=UPI0002EBDB95  ali  24  221..SGIEAAVATYYAQHKALPLTIYEAGFSGTLPAE---VSEIRVDQKNGALIVRMAQA--PISGKSFALLPSMEGDTIAWRCISE-------------------DISEEFLPMSCRK.................. 313
411 5.000e-06UniRef50_A4A5H4 Prepilin-type N-terminal cleavage/methylation domain protein n=11 Tax=Gammaproteobacteria TaxID=1236 RepID=A4A5H4_9GAMM  ali  20  51LAE-AKTTIAEFYAANGTMPTAAQS----GINSVETQIVNSIVYDGNSIIEAIVKQSVMPGATGNELVAVTNAATRTIQWTCR---------------PGTVTSPVLNNHLPANCRG.................. 150
412 5.000e-06UniRef50_A0A0A1H549 General secretion pathway protein H n=1 Tax=Burkholderiales bacterium GJ-E10 TaxID=1469502 RepID=A0A0A1H549_9BURK  ali  20  49VAAPAQQTVAESFVADGMTGLSAAAASWNAQEGGAGKYVSSVQIGDHPGTVTITYSALVPQLTGRQLTLTPSINTGTVDWACASSSAVTAAQQGLPVETP--TTPLLNQYAPTNC.................... 178
413 5.000e-06UniRef50_UPI000BFEBF9F hypothetical protein n=1 Tax=Marinicella litoralis TaxID=644220 RepID=UPI000BFEBF9F  ali  23  33MAGQIKATVSEQWFVNQSFAGSQAALGESDLNY-------SID-ETTGVIVIDLADVGSSFEAGDVIYLEPVTDEGYVEWRCSS--------------------NIKSAYLPAFCRDE................. 122
414 6.000e-06UniRef50_S3N7X4 Uncharacterized protein n=1 Tax=Acinetobacter rudis CIP 110305 TaxID=421052 RepID=S3N7X4_9GAMM  ali  24  48LTSGLKVVVSETFAQDGACLDNKLESSIPRPADITGQYIVSVTTSDSGITARFKKEQVAQAIQDKTVTLSMDKVSN--IWSCHSNA--------------------DVKYLPRSC--TAKNVAT........... 153
415 6.000e-06UniRef50_A0A0Q5Z0L1 Pilin n=3 Tax=Betaproteobacteria TaxID=28216 RepID=A0A0Q5Z0L1_9BURK  ali  23  48.ASGCRTAVTEVFMTGDVLPGAGGW--GCESSTAVSRYVAAIGVNGAGAISVTVGTGIDPRADNKVLTWVPFVDATTFRWVCGSPSLTP-------------ATTVDKALLPGSCRG.................. 160
416 6.000e-06UniRef50_UPI000D6D5894 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Gammaproteobacteria bacterium ESL0073 TaxID=20  ali  21  46VASSVKSRVVEYYSFSHQCPVNTGGNSEIAPTDYATAIIQEINVVSSSGVKIKQDAALASEVRGKTISLVPANISGAFAWTCTSDMSSNDIG----------------RYLPKVC.................... 151
417 7.000e-06UniRef50_UPI00058F637B DUF4124 domain-containing protein n=1 Tax=Gilvimarinus chinensis TaxID=396005 RepID=UPI00058F637B  ali  21  312.ISPLRTMIAEYFQVRGVMPLSISALGVRRQT-MKSAVVDNVAIANPG----TLRADLAGANEGVFIELVPELEHGGIKWRCLSNAGQA.............................................. 396
418 7.000e-06UniRef50_A0A1Z8WWK8 Uncharacterized protein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1Z8WWK8_9GAMM  ali  28  45LAAGAKSSSAEIFSSEGAFPADNTGAGLETNTSITGTNVASVTVTRTGGTVVIAFNANNATLNGNSVTLTANSSGGSITWVCTSTLPNASVPAS......................................... 151
419 8.000e-06UniRef50_T1AIB7 Membrane protein containing RDD domain protein (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1AIB7_9ZZZZ  ali  40  135MAESAETDVAQFYANTARYPADNASAGLPSAGSISGNYVAAVAVRDGAI...................................................................................... 183
420 8.000e-06UniRef50_Q2S7F3 Tfp pilus assembly protein, major pilin PilA n=1 Tax=Hahella chejuensis (strain KCTC 2396) TaxID=349521 RepID=Q2S7F3_HAHCH  ali  16  284........VSAFIQRTGFYPNQNLDAGL--PEELRDK-VASIQLQQNARMVVTYD--IKSLRENNTIDWIPAERNGQIEWTCM-------------------EGSMPDQYRPTICRGGSHTSSGD.......... 376
421 8.000e-06UniRef50_A0A1G0DKI3 Uncharacterized protein n=2 Tax=unclassified Nitrosomonadales TaxID=1660158 RepID=A0A1G0DKI3_9PROT  ali  27  47.ASSGRTAVSEVFANNGAMLPSALSMGVQDQSTGVVYGVTWNQAGVNAVVVVLLDDTKLGGARGGALALTGNQTTGAVIWTCGAAPAGVATGAETSLAADSGKAPIPTKYLPGSCKD.................. 176
422 9.000e-06UniRef50_A0A0D0JGQ0 Uncharacterized protein n=4 Tax=Xanthomonadaceae TaxID=32033 RepID=A0A0D0JGQ0_STEMA  ali  26  46.ASAVRTAVSEYAAGNGALPPADW-----KPEAQASQYVSKVAWDGKKISATSIVTGATGDIE----LYATKAANDQVTWICG--------------------GTVDAKYRPGTCQGAAPATGG........... 139
423 9.000e-06UniRef50_A0A261GND6 Pilus assembly protein PilA n=2 Tax=Hahella TaxID=158481 RepID=A0A261GND6_9GAMM  ali  18  293.....RDKVSEFIQTTGFYPNQNLDANLPE---HIGNEVVDIQVIENAVIVATFN--IKTLGSDNTIELEPVENNGQIEWTCY-------------------GGTMLEKYRVAECR................... 379
424 9.000e-06UniRef50_A0A0W1A910 Type IV pilus assembly protein PilA n=54 Tax=Bacteria TaxID=2 RepID=A0A0W1A910_9GAMM  ali  23  44LASAAKLAVSETAITNNALPATEAATGYTSPP--ATPNVQDISIADDGTAQITITYTAAAG--GGTIIMTPALANGDVTWTC-------------------TAGTLLTKYRPASCR................... 137
425 9.000e-06UniRef50_Q5H2I1 Pilin n=53 Tax=Proteobacteria TaxID=1224 RepID=Q5H2I1_XANOR  ali  34  72MSAPAKLAVTETASSLGGV-ANVTLANSGYSFPGATKYVSNVTIADGTGLVTVTSTVPNAA---GTILLTPDVGGGQLKWTCSSA--------------------ILTKYLPAECRSSGT............... 168
426 9.000e-06UniRef50_F9UA31 Fimbrial protein pilin n=1 Tax=Thiocapsa marina 5811 TaxID=768671 RepID=F9UA31_9GAMM  ali  23  49..GPLKMETTLYYTNHGYFPAALNELGLEK-TSIQSRYVEGVNIAYAGPYAAQIGGFVGTAKDSISLIIKLNPTTNMKSWQYNQITAKTGGIYQWYCGPRDAAFGVPSMILPATCRDFS................ 180
427 9.000e-06UniRef50_A0A0U3LLY8 Methylation n=2 Tax=Roseateles TaxID=93681 RepID=A0A0U3LLY8_9BURK  ali  25  49...PPKALVMEHVNTNASFP----AASQLSWSGGSSKYVDSVTYNKVSITAVVRSGSIAPDVDGLQLVLTGKPGSGGLS---------------NGSVEWTCAGTIPARYLAAACRPNA................ 150
428 9.000e-06UniRef50_A0A1M7EI34 Type IV pilus assembly protein PilA n=5 Tax=Halomonas TaxID=2745 RepID=A0A1M7EI34_9GAMM  ali  19  50...GVKARLAEEYAFEGTFDNISEDEKEKIEGLVTTRYVEGIEIFPSGDNIADQDASVAKEVRGTRLRIEMYAAGGAVKWKCMPAKQK----------------PMDKKYLPGSCRAEVND.............. 161
429 1.000e-05UniRef50_F9UDR0 Uncharacterized protein n=1 Tax=Thiocapsa marina 5811 TaxID=768671 RepID=F9UDR0_9GAMM  ali  19  50MGSAAKVAVATNAAVGQIEDISQATSGYDALSD-PGQYVAAIEIEDGGVIVMRTRNTGAAVDP--VLALVPTMAGSAIAWDCEIRQGL-------------------PRHVPSNCRNGT................ 146
430 1.000e-05UniRef50_Q462L6 Pilin n=31 Tax=Neisseriaceae TaxID=481 RepID=Q462L6_NEISI  ali  16  49LADDLKTEISIASAVNNRLP-NAEDVSKQGAIGVTAQRIGGTYIQNGGVTVEADTGKISGQNKGKVLTLTPYRNNNDSTWL----------------LNWQCGGTLDPMMVPAMCRDNSNG.............. 157
431 1.000e-05UniRef50_B8KJ19 Fimbrial protein PilE (MS11 antigen) n=1 Tax=gamma proteobacterium NOR5-3 TaxID=566466 RepID=B8KJ19_9GAMM  ali  21  69LAE-AKTSIAEFYASQGAMPSVAQSGVRTVETLIISSIVYNGTDTIRAAVKQSVMPGSGGVLS-FELVAVTDPNTRSIQWTCRPTS----------------GSPVLPNHLPANCRG.................. 167
432 1.000e-05UniRef50_A0A1W6ST54 Prepilin-type cleavage/methylation domain-containing protein n=19 Tax=Nitrosomonadales TaxID=32003 RepID=A0A1W6ST54_9PROT  ali  25  50LLQSVESPVAGFYSDKGRWPTKPEFDSLVA--TRTGRYVASLTTSGFQVTAAFKNNGVSKGLEGTGRTLVVATKDG-VQWICNDNTNPATGVPGLVP------GNILPQHRPAVCK................... 162
433 1.000e-05UniRef50_D0KVV3 Type IV pilin structural subunit n=9 Tax=Proteobacteria TaxID=1224 RepID=D0KVV3_HALNC  ali  22  51VADAAKTGVAEAWTSDGLTGVTNFATSFNAATAHQSKYVSAIAIDPNTGAITVTSSTAAGDAQGMTIVLQPNVQNGAIDW---ACASTSAATAGSNGLAGITLGTMPAKYVPSQCK................... 178
434 1.000e-05UniRef50_UPI00098D15CA pilin n=1 Tax=Wohlfahrtiimonas populi TaxID=1940240 RepID=UPI00098D15CA  ali  17  50LAGELKQRVATYHAEHGKFPKAFDQSTHIPMVPLNGQSVIAAGIMDGTIYLYFNEKASLVGKSELELPLRPYAPGGQILWKCGLQAWPNAIESGSIPLSQQGNNKVDPNIIPAICR................... 189
435 1.000e-05UniRef50_A0A1H2VCB0 Type IV pilus assembly protein PilA n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1H2VCB0_9PROT  ali  22  46MADSAKLAVSETAITNNALPANQAATGYVGPA--ATPNVASIAIGANGVTTVTYTAAAG----NGSIILTPALANGDVTWNC-------------------TGGTLDAKYRPASCRAAPAPAP............ 144
436 1.000e-05UniRef50_A0A0G3BBS9 Type IV pilus assembly protein PilA n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A0G3BBS9_9BURK  ali  18  53LASALKADMSSMYASDG-MAGVAAYATQVAAAPPESKYVEEIRIDGTTGVITYREENIGTIADARTIVLTPYLNTGSVDWACASDANSSATTRDLLNP---VAGTLPARFAPNECK................... 181
437 1.000e-05UniRef50_UPI000378B6D7 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Thiofilum flexile TaxID=125627 RepID=UPI000378  ali  22  45LISATKADVATYYGTHGSWPIDGDLVKTFETKIVKGVKGEELGGGKKFRINIEFKPDSLVAGASSFIYLEPEALNSSLRWQCSKSP------------------NIVAKHLPSACRCDYGATC............ 154
438 1.000e-05UniRef50_D4DRI5 Prepilin-type cleavage/methylation N-terminal domain protein n=3 Tax=Neisseria elongata subsp. glycolytica TaxID=88719 RepID=D4DRI5_N  ali  23  61.ASHRKTAVTEAYLNNGMAGVTASSTNTAPTADKQSKFIKSSNIDAATGAIVILESTLPDDAKGKTLVFKPYIGNGKMDWACASATNTTATKRGFTNMP---QGTLPSKYAPPECK................... 188
439 1.000e-05UniRef50_R8B1M4 Uncharacterized protein n=8 Tax=root TaxID=1 RepID=R8B1M4_9ALTE  ali  20  310.AQSVQEQVTAYGYENQGWPTTMNELGYAQPTLSDPEVGYEIDIYENGLIGVEVGTDASG--ESQYIILEPEVVEGEISWVCFGQ-------------------NVKAKLLPSAC.................... 402
440 1.000e-05UniRef50_A0A1H6FET7 Fimbrial protein n=1 Tax=Thiotrichales bacterium HS_08 TaxID=1899563 RepID=A0A1H6FET7_9GAMM  ali  25  50LLSGVRIPLQEYLIERGTWPSGAKEQGKYTTSIVSGKYVK--DSKNVYYAEATMRGDSSTSIGGKKVRMIYLP--GARDWDCTVEDIDANEA-------------LDYRYLPSACKD.................. 153
441 2.000e-05UniRef50_A0A1F4BF29 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26 TaxID=1797492 RepID=A0A1F4BF29_9PROT  ali  20  223.......AVDDFHRRNNAMPRDLKEAGISGPTS-RGIRNMSLDPGTGAVRIVL----ATPPLEGNSIIFTPVKSDKRLAWRCGSDDIRQ------------------QKYLPGSCRK.................. 310
442 2.000e-05UniRef50_UPI000BB82CEF prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Halomonas sp. hl-4 TaxID=1761789 RepID=UPI000BB82CEF  ali  19  35..SGVKSELGERYAMEGSFGQDN-SLGDESLVSH-TQYIQSIDYGGEGVDIMRNEAPVSQAIRNTRFRIEVRASEGAITWRCMPAEQQ----------------PMGDQYLPGSCRS.................. 138
443 2.000e-05UniRef50_A0A023NZT5 Uncharacterized protein n=3 Tax=Dyella jiangningensis TaxID=1379159 RepID=A0A023NZT5_9GAMM  ali  18  38.ADAVKLVVMEAATVHGGLAQVRASDLQYNAKASSGDHVANVEVADGGLITLSTRDTGASPDPVIMFIPTAGSAGADITWTCQVVLGDASLAPADCQGHG---------YVPSSASSAAPGPAPET......... 153
444 2.000e-05UniRef50_A0A0S2DBE4 Fimbrial protein n=8 Tax=Lysobacter TaxID=68 RepID=A0A0S2DBE4_LYSEN  ali  24  240.AGSYKLQVAEHYLEHEGCP-NNASPGFRPAADYAGPQLASVEFGGQCAIQLELRGFDNRHLDGRKLWL--SFDPNSHEWTCSTDIDKPVLVPQSC....................................... 336
445 2.000e-05UniRef50_A0A1B3BCH6 Fimbrial protein n=2 Tax=Kangiella sediminilitoris TaxID=1144748 RepID=A0A1B3BCH6_9GAMM  ali  17  49..AACKTSVAETYASNGNNIASIDTANSGCNTD-GSQYTQNLTVGSSGGVISVQATNIATDVNNLTLTLTPQFAGGA----------------GTAISGWTCGGTIPPEYKPANCR................... 146
446 2.000e-05UniRef50_A0A1G5DVS5 Type IV pilus assembly protein PilA n=1 Tax=Nitrosospira sp. Nl5 TaxID=200120 RepID=A0A1G5DVS5_9PROT  ali  26  50LLDAAKPPVAAFYSDKGRWPTREEFDALVPIQ--AGRYVAGLAAAGFQVTATFKKSGVNTGLEGAGRTLVIATKDG-VKWICNDNTDPATGVPGLI------AGNVLAQHRPQACK................... 162
447 2.000e-05UniRef50_UPI0009E31660 hypothetical protein n=1 Tax=Neisseria gonorrhoeae TaxID=485 RepID=UPI0009E31660  ali  69  4..............ENGEWPKDNGAAGVASASTIKGKYVQKVEVAKGVVTATMASTGVNKEIKGKNL.................................................................... 56
448 2.000e-05UniRef50_A0A1V0G5C3 Uncharacterized protein n=33 Tax=Neisseriales TaxID=206351 RepID=A0A1V0G5C3_NEIME  ali  83  1MVEGQKSAVTEYYLNHGKWPGGNSDAGVASSSKIKGK.................................................................................................. 37
449 2.000e-05UniRef50_A0A1H3YMJ0 Type IV pilus assembly protein PilA n=2 Tax=Paraburkholderia sartisoli TaxID=83784 RepID=A0A1H3YMJ0_9BURK  ali  15  91LASSARLSVAENAA-------SGSALGGGYASPPATRNVESIHVDDDNGQITVAFTTRVAPAGSNTIVLVPSVPDGALTWECFAGGKNGSSLPAPGSGPAADAATLPANLAPPECR................... 218
450 2.000e-05UniRef50_A0A246RXE2 Fimbrial protein n=2 Tax=Halomonas TaxID=2745 RepID=A0A246RXE2_9GAMM  ali  19  48..SGVKSELGERYALEGSFGSGN--LLNQSELVNQTQYIDSIDYGGDGVDIMKNAAPVSQAIRNNRFRIEVRAGEGSITWRCMPAQQQ----------------PMDAKYLPGSCRS.................. 151
451 2.000e-05UniRef50_UPI000691801B hypothetical protein n=1 Tax=Nevskia soli TaxID=418856 RepID=UPI000691801B  ali  26  121.ADPIKAAVTRHYASSSE-PVQYADLGMSGPLALKDDQ-GLITVNANGVITIMLG---MKPPIGQSIRLTPTVSSAGTGWSCVSDDVRKI-------------------YLPPSCR................... 211
452 2.000e-05UniRef50_A0A091B241 Uncharacterized protein n=2 Tax=Arenimonas TaxID=490567 RepID=A0A091B241_9GAMM  ali  23  128LAEGLVVAVEEHFQTQGRCPTDFNDLGLSEPTLDGQLSVQLVSLGECVIELALGGLHANGALAGRSLYLTRDENG---RYACSSDLDQ-------------------AKYLPSNC.................... 224
453 2.000e-05UniRef50_A0A1Z4VU19 TfP pilus assembly protein, major pilin PilA n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Z4VU19_9GAMM  ali  27  46IASGAKASVGEYIVTRGSMPTDQTEAGF---EDQSTTIVDSMVWNGSAIVITGNATEV----DGLVLELTPTINAGAVEWDCAATAAQNLAPAS......................................... 133
454 2.000e-05UniRef50_C6S9N7 PilS cassette n=17 Tax=Neisseria TaxID=482 RepID=C6S9N7_NEIML  ali  86  1MAEGQKSAVTEYYLNHGKWPGGNSDAGVASSSKIKGK.................................................................................................. 37
455 2.000e-05UniRef50_A0A2P4EWZ9 Uncharacterized protein n=2 Tax=Pseudomonas TaxID=286 RepID=A0A2P4EWZ9_9PSED  ali  25  155........VEEYVQQHDAWPTSLNQ--LPVADLVTSESVGTVAVNSGVIVVT----PAKGVGLSGSLIYVPSFSGSGISWSC-------------------TESTVESRYLPAKCR................... 237
456 2.000e-05UniRef50_UPI0009AB339D hypothetical protein n=1 Tax=Neisseria meningitidis TaxID=487 RepID=UPI0009AB339D  ali  89  21LAEGQKSAVTEYYLNHGEWPGDNSSAGVA.......................................................................................................... 49
457 2.000e-05UniRef50_W8KJ91 Pilin n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=W8KJ91_HALHR  ali  24  45VTSGVRSDIGE-LVSLGRNGDIAGLVPDANKGDLSGRYVAEVTTANTGITVKFQDSGVSNQIAGESMLLFALGSDGKKITD--LAPDNNAPSSIHGWGCEWTGTGTSANLLPGGCRHTDPT.............. 162
458 3.000e-05UniRef50_A7BZB4 PilE/Pilin n=1 Tax=Beggiatoa sp. PS TaxID=422289 RepID=A7BZB4_9GAMM  ali  20  45LFSGAKTQLMEFRNDIGRFPVAAGWASIPGIIT-KGSYVESSTLNATGSRTTACYKMLGFEVGVETLCYTYYASGNQEGWECTSNAPVAS------------GTNLVDKFLPKKCRSDYAT.............. 156
459 3.000e-05UniRef50_A0A1E7WMS0 Fimbrial protein n=14 Tax=Proteobacteria TaxID=1224 RepID=A0A1E7WMS0_9BURK  ali  24  312....ATAAVERYFYANGRGPATLAQAGYAMDDP--SHVVQDIAVDPGNG--VVRVQPSDPAYRGKAIAFTPRLDNKRVAWQCGSE-------------------DIPAQVLPADCRN.................. 402
460 3.000e-05UniRef50_M5CQT8 Fimbrial protein P9-2 n=115 Tax=Gammaproteobacteria TaxID=1236 RepID=M5CQT8_STEMA  ali  26  157...PLQDQVQHFADEEGRCPGAN-DAGFPAPGDFTRSGLSAVNIGNGHCGIEATLSMPGKSIDGDLLWLEYDRDSG--RWDCSGAS--------------------DDKYLPPACRG.................. 250
461 3.000e-05UniRef50_A0A2I7N5T0 Prepilin-type cleavage/methylation domain-containing protein n=2 Tax=Neisseriaceae bacterium DSM 100970 TaxID=2052837 RepID=A0A2I  ali  29  46.ADMAKVAVSEYYQTNGSFPNGNTDFGLPAAASITGTNVAGVDVDSQGEQXXXXXXXXXXXXXXXXXXXXXSPSASGINWTCIVQPNYQD-------------------YVPSSCRN.................. 148
462 3.000e-05UniRef50_I3CF94 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Beggiatoa alba B18LD TaxID=395493 RepID=I3CF94_9GAMM  ali  23  45LMAGLKTPLVEYQLTWGIWPP-LSSLPGTKNSGVYTSYVETGTIDDNLYYIATMRTSAGPNLAGKQVRNVYNYERRL--WDCTTDGIPAGQE-------------INSVYLPSNCR................... 145
463 3.000e-05UniRef50_UPI000B8507AC pilin n=1 Tax=Burkholderia sp. JS23 TaxID=1770053 RepID=UPI000B8507AC  ali  17  341LASMAQLAVTENASNGTAF-----EAGYEPPA--STRNVESIEIDPASGQIAIAYQARVASPGSNVLVLVPSTADGALVWECFAAGKDRSQLDDDAPLPRV-QPTLPGKLAPAECRG.................. 463
464 3.000e-05UniRef50_UPI000A37E6CE hypothetical protein n=2 Tax=Neisseria meningitidis TaxID=487 RepID=UPI000A37E6CE  ali  100  1MAEGQKSAVTEYYLNHGEWPGN................................................................................................................. 22
465 4.000e-05UniRef50_J2TVD8 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=7 Tax=Proteobacteria TaxID=1224 RepID=J2TVD8_9BURK  ali  27  48.ASSGRTAVSETFSQKSTMALNQASMGVQSQT---SRYVATVVYSGTNIIVTSSTDTGLSAAASKTMILRGQTGTGTVAWTCGTDNS---------------ATAIPKKYLPSSCKD.................. 152
466 4.000e-05UniRef50_A0A1I6KAH5 Tfp pilus assembly protein, major pilin PilA n=5 Tax=Stenotrophomonas TaxID=40323 RepID=A0A1I6KAH5_STEMA  ali  27  152...SLKDQVQHFADEEGRCPGAN-DAGFPAPGDFSAAGLSAVHIGNGHCGIEATLAAPGKTIDGDLLWLEYDRDSG--RWECSGES--------------------NDKYLPQQCRG.................. 245
467 5.000e-05UniRef50_UPI00093211AC prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Suttonella ornithocola TaxID=279832 RepID=UPI0  ali  20  49LAEPAKLEVVGTASSIQNLPNT---ANTFNAQNTHSKYVQNIHINNAMITITYNANSVGVSATQNTLTLTPWVNSGSIDWGCASQTAAVATETSIQPIA---LGTLLPEYAPAQCR................... 176
468 5.000e-05UniRef50_UPI0007D8537C prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Acinetobacter sp. SFA TaxID=1805633 RepID=UPI0  ali  20  43LASSFKNQVSDTFWQTGACPT-LTDLGLTAPTAIQSHFLASINVTTCNLEITFKNSNVSNGLLSKTLNFGMSTNPRVSQWDCMS-------------------NHISQHLLPTTCQG.................. 147
469 5.000e-05UniRef50_I2JGH2 Fimbrial protein PilE n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=I2JGH2_9GAMM  ali  21  47.AASAKATIYESYAATGAMPLADSDIMADIDTNITAMNVSAVTVTRQSADIMDLGGTVNATAGTNRLTFVYTGSSTGLKVDCTSDSGAAKP------------TNVEAKYLPSSCRGT................. 159
470 6.000e-05UniRef50_A0A0B0H7R9 Type IV pilus assembly major pilin protein PilA2 n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0B0H7R9_SOVGS  ali  22  52LASKCKASVEEARQSGVSNDADDWNCGGGSSTSPITDYVDQLATDTSGNITIHFDTDLTGDDNEIVLG-VPATVGG--TWSCGPAA----------------SGGVDTKYLPSTCSD.................. 150
471 6.000e-05UniRef50_UPI000D718FE5 DUF2628 domain-containing protein n=1 Tax=Plasticicumulans acidivorans TaxID=886464 RepID=UPI000D718FE5  ali  22  218...QMQQAIDAYYKEHGALPPSLEHAGFTASPPLGAGSVVYTPLDGS------LRITLAQPAPAGVLDLTPQVAAGGLQWHCRS-------------------TQLSAQLLPENCR................... 305
472 6.000e-05UniRef50_A0A0S2GDP3 Pilin family protein n=9 Tax=Lysobacter TaxID=68 RepID=A0A0S2GDP3_9GAMM  ali  22  169.TGPYKTQVAEHYLAHDGCP-NNASPGFRPAEAYATAQIASIEFGGQCGIQIELRGFNTPQLDGKKVWQSFDPAN--LSWTCGSDIEKQAT-------------------LPANCRGG................. 268
473 6.000e-05UniRef50_W8RAN1 Pilin (Bacterial filament) subfamily n=16 Tax=Gammaproteobacteria TaxID=1236 RepID=W8RAN1_PSEST  ali  16  48.ASALKIGVTDVFADNGIAGVAAYSTEIAADDNLTTDLISAVAVSATTGAISITMAGIPQLGTNNVLAFVPEINDAAI--------ANDNSTGSITWDCSSATTTIDSKFLPANCR................... 155
474 6.000e-05UniRef50_UPI00098D5EFD prepilin-type N-terminal cleavage/methylation domain-containing protein n=2 Tax=Wohlfahrtiimonas populi TaxID=1940240 RepID=UP  ali  21  45LSSTLRNAAVEYYSTTGKWPDSNGMAGLSAAPTYTGQAVIGIGIGKVSNIKIFYTNKVTGVLGDNSLTLAPVTDSGSFQWVCINPQPD---------------GHLKVKWLPANCRSET................ 193
475 7.000e-05UniRef50_V2Q2Y3 Uncharacterized protein n=3 Tax=Acinetobacter TaxID=469 RepID=V2Q2Y3_ACILW  ali  21  47.ASSCRSAVTEA-VDSGTIPATGQKWGCTDKTKAATKYVQQVAVSNSGIRVTLTNDTSLKSAAGLNIYMTPTTDVDGLTTVSGVTTDTATTALIKSWSCGLVSGDADQKYLPATCRKVQTAGT............ 184
476 7.000e-05UniRef50_A0A1G9AC00 Type IV pilus assembly protein PilA n=1 Tax=Methylophilus rhizosphaerae TaxID=492660 RepID=A0A1G9AC00_9PROT  ali  27  47LSNGIKTAIEEHLTENG-----GANLGYNNGSLPSGKYATIKSIQNDSILIEMDGPDVNNKIRHEWVRIRAERADGGLIWLCGAWSPGLD------------------KYLPSAC.................... 150
477 8.000e-05UniRef50_A0A2E3NSY1 Prepilin-type cleavage/methylation domain-containing protein n=1 Tax=Xanthomonadales bacterium TaxID=2006849 RepID=A0A2E3NSY1_9GA  ali  25  45LIGGARTAIEEEVAQTGVFPSDRAALSNLG-VRMGGQYVSTLDVANVAITATFKETGVSAGISTDVLAFQRTANG---EWVCL----------------AGGSTTLDDKYQPKPC.................... 144
478 8.000e-05UniRef50_D4DRI6 N-terminal cleavage protein n=11 Tax=Betaproteobacteria TaxID=28216 RepID=D4DRI6_NEIEG  ali  20  47.ASSPKSALSEAFQTDGITGMTAAAKAFNKXXQHASKYVKSVKVTEASPWDITVANGIPTGLDGNTIRLFPATSTGAIDWACASAAKETADKRFGT-GSGVAVGTLPAKYAPSECK................... 188
479 9.000e-05UniRef50_A0A2T5PBB8 Uncharacterized protein n=1 Tax=Pseudomonas sp. TC-11 TaxID=2161748 RepID=A0A2T5PBB8_9PSED  ali  21  223.ADQASRAVGDYYRQYDRLPASFADTGFEPSPLREVH--SEITLQTDGVIDARI---IERNRDDRAFQLRPTLDAGQIVWTCSS-------------------NEVPDKHLPVACRS.................. 315
480 1.000e-04UniRef50_A0A1V5QPD5 Fimbrial protein n=1 Tax=Betaproteobacteria bacterium ADurb.Bin341 TaxID=1852821 RepID=A0A1V5QPD5_9PROT  ali  24  90...QARDSVERYVLEHGKLPDSLEASGF----SVASQQIQSVSIDRESGVISLVIGF--PPHQGKTLKFVPTSADGKTSWKCGSDE-------------------IPERHWPVACR................... 179
481 1.000e-04UniRef50_A0A246IZ16 Uncharacterized protein n=2 Tax=Burkholderiales Genera incertae sedis TaxID=224471 RepID=A0A246IZ16_9BURK  ali  23  49...PPKALITEHVTTTASFPT----AAQLNWSGASSAYVDSVTYTKVSDTEVSIAARVAADIDGLQLVLTGKPGAGGLS---------------AGAVEWTCAGTIPQQYLVAACRSGA................ 150
482 1.000e-04UniRef50_S6GPS7 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=S6GPS7_9GAMM  ali  18  615.ASKLKQQIADFYFTAGKYPDSKQLESLNIEQYFSEDYSIQLEADSGVILVLFQRADIGKQ---QTIKLTPIASEQQISWDCAS--------------------NLPLSIRPAMCRKN................. 708
483 1.000e-04UniRef50_UPI0008241D05 pilin n=1 Tax=Endozoicomonas atrinae TaxID=1333660 RepID=UPI0008241D05  ali  32  45LLGGLKTPVIEYYSMNGTYPDVAS-----VNATGSGEFVSSITRSGDTYVATFSASGVNERLQGAKLALVFSSSTGPNCTTTGQSPA------------------VPPEFLPNTCK................... 137
484 1.000e-04UniRef50_B4WYB6 Uncharacterized protein n=10 Tax=Alcanivoracaceae TaxID=224372 RepID=B4WYB6_9GAMM  ali  28  167.VSALRMHMTEYYLSGGTWPDSLTDMGVAQ-EQVTGKRIKRAYLLDGGMLKLEL----AGRLDGHQLTTWPVEGGMQIEWECSTTVN................................................ 248
485 1.000e-04UniRef50_A0A104HSD6 General secretion pathway protein GspH n=39 Tax=Burkholderiaceae TaxID=119060 RepID=A0A104HSD6_9BURK  ali  15  65LASSARLAVADNAAS-------GAGLAGGYSPPAATRNVESVRIDDETGQISVVFTARVAAGDANTLVLVPSAQAGAIAWECFAAGKQASSLPAPGAGPPAEAATLPAKYAPAECR................... 192
486 1.000e-04UniRef50_UPI0009E34290 large pilS cassette protein n=6 Tax=Neisseria TaxID=482 RepID=UPI0009E34290  ali  67  11...........................................................................GSVKWFCGQPVTRDNAGTDAVTADTTGKDKIDTKHLPSTCRDKSSA.............. 57
487 1.000e-04UniRef50_A0A1W9X5R6 Uncharacterized protein n=1 Tax=Beggiatoa sp. 4572_84 TaxID=1972449 RepID=A0A1W9X5R6_9GAMM  ali  21  46LLGVLKNPMVEYYNKRNEWPPIAKVDG-----KTTGRYTSTITWPNNGSQYFYVEATMKGPGELDNKKLRMTYTPSTKDWDCTVEALEDAA--------------IPNKFLPSYCRSN................. 150
488 1.000e-04UniRef50_I0HY93 Fimbrial protein, type IV pilin, PilE n=40 Tax=Proteobacteria TaxID=1224 RepID=I0HY93_RUBGI  ali  24  47.ASTCRTAITEAVQSSGSLPSADNSWGCESSSS-TSKYVASVETKGSSGKIRVTTQNL---PVTGHVILVPTISGNLVEWACGTSD------------------TAFKKYLPGSCKSDQT............... 145
489 1.000e-04UniRef50_A0A2N6F973 Uncharacterized protein n=1 Tax=Desulfuromonas sp. TaxID=892 RepID=A0A2N6F973_9DELT  ali  17  123VMSAFRVRVMEYYAMNGEYPLSLEDLDLSRADMRDSAYISDLTVGELGSLYALGGAELGEEVI---IRLAPTLGGMSTEWRCHTT.................................................. 206
490 1.000e-04UniRef50_UPI00082495E4 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Hydrogenophaga flava TaxID=65657 RepID=UPI0008  ali  22  44VAQGARLMVATEATTQADLAASATTYNDAAGGGAVSKYVSSVQVDGVTGEVTVEFNPANIGAANSTLVYTPYVETGSVDWGCASDSNAVSGGPD-RNLPALTMGTLPAKYAPSECR................... 177
491 1.000e-04UniRef50_UPI00048EB7F1 hypothetical protein n=1 Tax=Saccharospirillum impatiens TaxID=169438 RepID=UPI00048EB7F1  ali  18  48.VSPLRVSMTEYAMVEGHYPGSLEELGLVEAQMRDSQYFRDLYLAEGGRIKVLVDARLGARA---TMELTPKSGGMSTEWQCRTNVPDTTQI........................................... 137
492 1.000e-04UniRef50_A0A1T5KDN1 Type IV pilus assembly protein PilA n=1 Tax=Pseudoxanthomonas indica TaxID=428993 RepID=A0A1T5KDN1_9GAMM  ali  22  146.AAQLRPAIAAQW-VDGVCP-SNESPGFQAPEAYASPLIESITIGDGSCGLELRPRGIREPIDGKAVWW--SMEPRSQQWTCNSE--------------------IPDRYLPLECRG.................. 240
493 1.000e-04UniRef50_UPI0009E1A1DA prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Halomonas sp. PR-M31 TaxID=1471202 RepID=UPI00  ali  25  51.SGGMRADISERTAINGALPANADVVDVGTVASAAGKYVQVLSW-NGSRIGISFHQGVHS---GDNMWLRPDANNNITSWTC---------------------GGLDSKFLPSSC.................... 141
494 1.000e-04UniRef50_A0A1Y0NA52 Fimbrial protein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y0NA52_9BURK  ali  30  48.ASSAKNTITEAAATLTAMPL----AGSVTIESQTSRYVSGVTYSSDIITATARGDN---NIAGATITLTGVYASGQVTWTCG--------------------GTIQAKYRPASCK................... 135
495 1.000e-04UniRef50_T1CLH6 Pilin (Fragment) n=1 Tax=mine drainage metagenome TaxID=410659 RepID=T1CLH6_9ZZZZ  ali  35  2........................................SVTVTGGVITVAYGGPKANSKIASATLSLSPVQGSGSITWTC------------------KPGSGLSLQYLPASCR................... 60
496 1.000e-04UniRef50_UPI00086D762C pilin n=2 Tax=Neisseria gonorrhoeae TaxID=485 RepID=UPI00086D762C  ali  86  46LAEGQKSAVTEYYLNNGEWPEN................................................................................................................. 67
497 2.000e-04UniRef50_A0A259QY16 Uncharacterized protein n=1 Tax=Xanthomonadales bacterium 14-68-21 TaxID=1970612 RepID=A0A259QY16_9GAMM  ali  22  22VVSGAQTDAVVHRAVHGRWPAPG-DVGVVSP-DADGFYTQHLTLGDGGVRAVLNADGLGLHVEGGRLSFRPVLFGAEDAPTLTYLCGYARPPAGAVAAPAADRTTLPRNLLPPFCR................... 146
498 2.000e-04UniRef50_UPI0009EBA05F pilin n=1 Tax=Xanthomonas sp. Mitacek01 TaxID=1732019 RepID=UPI0009EBA05F  ali  20  50....CRSVVSETVQSKLALPGANAW--GCESASSTSRYVASVSTDTAGGITVL---SQNIQGVTGSITLTPSMT---------ISGAVVAPVAGGEIKRWLCGGSISRKYRPSTCQD.................. 148
499 2.000e-04UniRef50_UPI0009FE8DBF DUF4339 domain-containing protein n=1 Tax=Luteimonas mephitis TaxID=83615 RepID=UPI0009FE8DBF  ali  22  165.APAMQRAVEEFRDAHDRCPGNDDFAPLLRQFSAIEKTTTRFGALASGNCAFEFTLHGNSAIEGKTWVFEAHDDGDLGGWDC-------------------TGGDLPARYRPQHCR................... 261
500 2.000e-04UniRef50_A0A2H6G0Z3 Fimbrial protein n=1 Tax=bacterium BMS3Abin11 TaxID=2005719 RepID=A0A2H6G0Z3_9BACT  ali  25  54........ISEYFQSEGGWPRYRTTAGF---SDVDSKFVNMATISSATGTPTYNTNNGGAVNDAFYIELTGRNATGSIDWDCAGTSTVGTAGAAGTALSVGLK-----RLLPSSCR................... 171
501 2.000e-04UniRef50_A0A1Y0IDT7 Peptidase M48 Ste24p n=9 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y0IDT7_9GAMM  ali  25  308.AQPIKAGVTDYAVENRAWPSSLFDLGYEEESVVNHGKNYEIKIYDEGIIGVEVGDE-------QYLVLEPSFDEGSVSWTCSGQ-------------------NIEEKFVPRMCK................... 398
502 2.000e-04UniRef50_A0A2E3D1E5 Uncharacterized protein n=1 Tax=Pseudomonadales bacterium TaxID=1891229 RepID=A0A2E3D1E5_9GAMM  ali  20  118.AQPARVAIERYLEEHGEFPDADDQVASAGLSGESDSHIRSILLGSQGRIIITFDTQDSNDLTGKTLVLVPAFVGGEVVWD...................................................... 212
503 2.000e-04UniRef50_A0A2N1WLE3 Pilin n=6 Tax=cellular organisms TaxID=131567 RepID=A0A2N1WLE3_9GAMM  ali  27  48.TAGLRADIGVYLSEEGALPNAADSQALDDASELEGKYFAGVTIAA-GVLSVPFTSGVHT---GATMTLEPVLNTAGNQWEC---------------------DGLDPKFLPSACR................... 141
504 2.000e-04UniRef50_A0A2E0HI36 Uncharacterized protein n=1 Tax=Pseudomonadales bacterium TaxID=1891229 RepID=A0A2E0HI36_9GAMM  ali  18  298....LQRDIEDYIVRHQTAPASGSDIGRPGAGEL--QYASW-RLDDRGVITLNFTG--AESLQGQRLTLEPYLEGEALIWDC-------------------TGGTLAAKYRPPECR................... 385
505 2.000e-04UniRef50_UPI00067FDB0B hypothetical protein n=2 Tax=Moraxellaceae TaxID=468 RepID=UPI00067FDB0B  ali  13  2........ISGVFSSSGTSALKNTDYNTRLLGEKRTRYVSNIQIDDNGVITITSTNQIEVGLPTKTLVLTPNINNAILSTAVGSIDWTCASVTSTVKNLVIGLGTLFTKYATAECR................... 115
506 2.000e-04UniRef50_A0A2A2AGV0 Uncharacterized protein n=1 Tax=Comamonadaceae bacterium NML00-0135 TaxID=2029116 RepID=A0A2A2AGV0_9BURK  ali  11  59IAAALRTWIAEYLATQGRLPQSLDELRFDLPYDHV---LQSLEIGPGGAIVMRFLPQLGLDGA---VTLTPNANSGMIRWDCVSADFDFISRAMPGC...................................... 152
507 2.000e-04UniRef50_A0A1Y0ESB1 Prepilin-type cleavage/methylation domain-containing protein n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A1Y0ESB1_9BURK  ali  20  47.ATSPKSLISEAFQSDGLAGVTAAVAEYNAAAEKASKFTTPIVIGAAGDITVMSGTVADAGLPGKTLVFTPNVQGGAIDWSCASTANTTATTRGLVVAA---NGDMPAKYAPSECR................... 175
508 2.000e-04UniRef50_A0A2D9LLZ1 Uncharacterized protein n=2 Tax=Halomonas TaxID=2745 RepID=A0A2D9LLZ1_HALSX  ali  22  55VTAGMRADVAEQYSLNGSMPVTGTIEGLSGAEDPAGRYVQDASYATGTITVTYQADTAIANSSDSNNKLLITTDDPSTGWTCS---------------------GLDSRLLPAGCRGEATTGGGDN......... 164
509 3.000e-04UniRef50_UPI0006846C48 hypothetical protein n=1 Tax=Luteimonas sp. J29 TaxID=935863 RepID=UPI0006846C48  ali  22  77.AASLKPRLEAFVRANGRCPG-AGDPGFAAADMPGGPASRQVRIGDGAHGTVVLRGTPGGPLDGRRLRLEYDP--GPAQWRC--------------------RGEVHDRHLPAHCR................... 172
510 3.000e-04UniRef50_A0A0N0XJH2 Fimbrial protein n=1 Tax=Amantichitinum ursilacus TaxID=857265 RepID=A0A0N0XJH2_9NEIS  ali  28  218......SAIGKYYRQHHEVPPSLAAAGFDAQPPED---VSDLHL-DTANGQLELRFGIGGRLTGTRLLLSPTANAKEVSWRCLSP-------------------DIPRKMLPPECR................... 305
511 3.000e-04UniRef50_Q1QE50 Fimbrial protein pilin n=21 Tax=root TaxID=1 RepID=Q1QE50_PSYCK  ali  31  46LTAGQKTAIAEYAQTNGVYPGTATAPTNGSLTAAGTYADATVAAGTGVITVTMKAGTVNANIAGKTITLTPPALTGSNTTFNFSCTT-------------TGGTKMDQKYLPKSC.................... 148
512 3.000e-04UniRef50_A1WS67 Tfp pilus assembly protein n=10 Tax=Proteobacteria TaxID=1224 RepID=A1WS67_VEREI  ali  19  53..SACRTTITEVIQSAASNAIIGANWGCEISETSSTKYVKSVTTAATGAVVTVTMRNIGDGVDEKTIVLAPCSE--STQATLGECKQPALGGNVATWLCGPGSNGVSIKYLPGSCRTPASGTS............ 179
513 3.000e-04UniRef50_A0A0P7Y3F9 Type IV pilus assembly protein PilA n=16 Tax=Halomonas TaxID=2745 RepID=A0A0P7Y3F9_9GAMM  ali  19  55VTAGVRADIAEQYSLRNAMPSS-AQLGIGDDEDIEGRYVESVDYENSEI-LVTFKDEGESALDGAVMAIGPADDSNPGSWTCTFDSGGQD------------------NWLPAGCRED................. 156
514 3.000e-04UniRef50_A0A2I0CQ02 Uncharacterized protein n=1 Tax=Pseudomonas sp. ZYSR67-Z TaxID=1905276 RepID=A0A2I0CQ02_9PSED  ali  27  224........VSSYYYRQQQLPSSLAEAGFATPLP---DSVQRIELDAESGTLHITL--AGTTLAGQQLLLVAQPADGRLEWQCRSEQ-------------------ISDKYLPGRCR................... 308
515 3.000e-04UniRef50_N8P2Q4 Uncharacterized protein n=5 Tax=Acinetobacter TaxID=469 RepID=N8P2Q4_9GAMM  ali  30  79..................................TSKYVASVLTDTGEITITFKASMVGVAPTENTLVLSPAGSTGIVDWACSSKTQETAKA---MGMIGATLGTIQPKFVPSTCR................... 176
516 4.000e-04UniRef50_A0A2G2KH56 Uncharacterized protein n=2 Tax=Acidithiobacillus sp. TaxID=1872118 RepID=A0A2G2KH56_9PROT  ali  24  46LIAPAKLGVAEYYSTNGEMPPNIEDITGXEAADLEGSYVSGVEWMSXAAIVVVFKSDAHTELAS-TLFLV................................................................. 122
517 4.000e-04UniRef50_A0A1D3G3T5 Fimbrial protein (Pilin) n=78 Tax=Neisseria TaxID=482 RepID=A0A1D3G3T5_NEIGO  ali  74  46LAEGQKSAVTEYYLNNGEWPKDNTSAGVASPPPTS.................................................................................................... 80
518 4.000e-04UniRef50_A0A1W9LBP3 Uncharacterized protein (Fragment) n=1 Tax=Beggiatoa sp. IS2 TaxID=1934247 RepID=A0A1W9LBP3_9GAMM  ali  21  211LLEGLKTPAERYMAVKSEFPFMIEEV----TTKTSGKYTASLMSNPNEFYFEATMNKEDSALVGKVVRLIFHRD--SKTWGCSAAYP----------------NGIPQKYLPSVCQSSAAEITAN.......... 313
519 4.000e-04UniRef50_D0KX79 Fimbrial protein pilin n=9 Tax=Gammaproteobacteria TaxID=1236 RepID=D0KX79_HALNC  ali  34  56LVSGPELALAEWFPNSGN-PGNNTSLGLAAPGSISGSYVQSVAVINGGKIELTYGNKANAAIAGAAKTLSPLTSAGAIRWSCG.................................................... 149
520 5.000e-04UniRef50_A0A1B4XEK6 Fimbrial protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1B4XEK6_9GAMM  ali  20  46LSGAVRTAIDVAFSEGGSIPTTPESLNISASTSYKSKYVSKVAYTANGTITVTLKNTVNGTAKGGTVIYGPTNQGGNLSWT--------------------VTGSVPTKYRPKN..................... 144
521 5.000e-04UniRef50_A0A2E3NSU9 Uncharacterized protein n=1 Tax=Xanthomonadales bacterium TaxID=2006849 RepID=A0A2E3NSU9_9GAMM  ali  21  33LTHRVRAAVEEYVVDKGTFPSDTTDL-ERYDVELSSKYVTSINLAPAAGTAAFRSTNVSQLIAGGTISYFRSPEG---IWSC--------------LGEGNGNTTLDQTLIPKQC.................... 136
522 5.000e-04UniRef50_A0A246J8A3 Uncharacterized protein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A246J8A3_9BURK  ali  25  47.ATQPKAAIQEFYTVKSSIPSSTQ----IPTDNIKSQYVTSVSWDGTKVTATAQGIGTGIDTKTITLTPTVTTGGESLNWACD--------------------TTIDKKFVPASCKAGS................ 140
523 5.000e-04UniRef50_A0A1P8FPW6 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium GR16-43 TaxID=1904640 RepID=A0A1P8FPW6_9PROT  ali  21  212.ANAAKSAVVAYYGVNSKLPTTLDDTTFRKSVSPYAGVVTAV-LEGPTIEIRVTPASDQNILKGGSVVMRSPNAAPRFDWTCR-------------------GDGIADRYLPFSCREP................. 308
524 5.000e-04UniRef50_A0A2W7GF27 Tfp pilus assembly major pilin PilA n=4 Tax=Variovorax TaxID=34072 RepID=A0A2W7GF27_9BURK  ali  18  205..SQARTAVGLFYGRNRRLPRDLAEAGFVATMPATE--LRELQMDARSGVITAVMN--HGVVAGRSLVLVPTVDGGNLSWTCKSQ-------------------TMAARWLPAACR................... 299
525 5.000e-04UniRef50_A0A0J9DRM5 Fimbrial protein n=35 Tax=Proteobacteria TaxID=1224 RepID=A0A0J9DRM5_9RALS  ali  22  55..DAAKSAIAEAYSSNGVFPTSANSSNTGNPPFQNSTYVARMDYSNLANVTVKLQGTNNNNVDGQFIGLTGNQADGSVKWQCATF---GTSVPGAAVASGTGVSKSLYPYLPQACQN.................. 179
526 5.000e-04UniRef50_A0A078BNG2 Fimbrial protein pilin n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A078BNG2_9BURK  ali  25  48.VSGAETTIAEYAQNNGAYPGAATKPTAASLNITGKYGAATVTADTGAIVYTFNATGVNANIAGKTITFTPTTADNTFVWTCTSTIAQKYLGSATTCT..................................... 151
527 5.000e-04UniRef50_A0A1G1F8A7 Uncharacterized protein n=1 Tax=Nitrospirae bacterium GWC2_57_13 TaxID=1801697 RepID=A0A1G1F8A7_9BACT  ali  20  53....YRVPLSTYYALNGEWPTSMEELQQMIPEKAKNTTLSMVRITQGAITV-----DMRKRLSGKTLTIHPAVLAGPVKWVAG-----GRSLSPGWTVVGDDGTTVDEKY......................... 155
528 6.000e-04UniRef50_UPI000369250A hypothetical protein n=1 Tax=Gilvimarinus chinensis TaxID=396005 RepID=UPI000369250A  ali  19  55...........YIAETGKLPSSNQQLGLSSPEAYADTVLKSIQVLDGGI--IRLTYTALSGVDGGIIDYKPEKIGNSVTWNCTTPSFKGIEAWRPDC...................................... 140
529 6.000e-04UniRef50_UPI0009DA514F hypothetical protein n=2 Tax=Dyella TaxID=231454 RepID=UPI0009DA514F  ali  18  326.ARPAQEALAESTSRPSGNPSGNAALGLPAPDSGAGPAIKRLEIAEGGHVLVTLADVHGAVAGHLDLEMHPAAQVGSVGWSCRSSDIPDVQQLAPTCSY.................................... 424
530 7.000e-04UniRef50_A0A2S6G947 Type IV pilus assembly protein PilA n=2 Tax=Marinobacter persicus TaxID=930118 RepID=A0A2S6G947_9ALTE  ali  19  51LISGSKADLYDRVTSNGAWPV--EAAGEIIADKLAVDYTEGNTVDDPATIAITLSNTGNTGLDGDVVTFSFDVSNNGLEVSCDNNSDAD-----------------EDNLLPSVCRDGADA.............. 162
531 7.000e-04UniRef50_C7R9N3 Fimbrial protein PilE (MS11 antigen) n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=C7R9N3_KANKD  ali  15  48.AGACKTSVAEFAAANNALPADATEAGCSG----GSTYVTSIEVTNPGDIQVVINDAEVGDGSAGRIILSPVDSANIYGWECTNSLANSGLAPASC....................................... 147
532 7.000e-04UniRef50_A0A1A6C1J1 Uncharacterized protein n=2 Tax=Acidihalobacter prosperus TaxID=160660 RepID=A0A1A6C1J1_9GAMM  ali  16  311.VEPLKQREYRYILEHRAFPATLDDIG---AADFRSPQIAAIEVGDKGSLIVHLAGRV-PALRDKTVVVSPYISDGRLHWRCTGGSVAKGLRPPAC....................................... 401
533 7.000e-04UniRef50_A0A075K5Z7 Uncharacterized protein n=2 Tax=Dyella japonica TaxID=231455 RepID=A0A075K5Z7_9GAMM  ali  16  39.VAVAKLAVMEAATIKGGFAQVRSNDLQYSARVSGGPYVSRVDIADGGLITLMTRNTGAHPDPVLVFTPLPSRSTGDIIWNCQVFLGDSSLVPASCQNQPIPSYTV............................. 144
534 8.000e-04UniRef50_UPI000CEBD67E prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Acinetobacter indicus TaxID=756892 RepID=UPI00  ali  18  49....AQLAVTEAAISEKDLTAVTASNIGYQFSNNSHKYISNLIIEDHTGIITITTNLPSAA---GTLVFTPSSTTQQIEWSCSS-------------------STINIRYLPLNC.................... 139
535 8.000e-04UniRef50_X0RL99 Type IV pilin PilA n=1 Tax=Psychrobacter sp. JCM 18900 TaxID=1298608 RepID=X0RL99_9GAMM  ali  18  33VSAGLRSEIGVYLWENKRFPNANEVSVTGQANTLEGKYIATSGISVTPDTGVIAINFDAGNIAGKTLILTPQMNS----------------LNNQQVVKWSCNGTVDANKLPLGCRN.................. 137
536 8.000e-04UniRef50_A0A2I7N8J8 Uncharacterized protein n=1 Tax=Neisseriaceae bacterium DSM 100970 TaxID=2052837 RepID=A0A2I7N8J8_9NEIS  ali  28  68......LSVAEYYQTNGVYPATLAQAGINASN--TGNYVTGVSIASNGVITVSLLYGSN---QTGSIVFTPSSN............................................................. 130
537 8.000e-04UniRef50_A0A1E4H493 Uncharacterized protein n=2 Tax=Rhodanobacter TaxID=75309 RepID=A0A1E4H493_9GAMM  ali  20  53...........YRAEHGRWPSAGD--PNILGDARAGSHVENLSLAEGGVITAQRSGAVATGGVRGRLSFRPELMGSAEEPTVSFLCGYATPVSGTVEATAANRTTLPVDYLPPSCR................... 166
538 8.000e-04UniRef50_A0A0J5GCU7 Uncharacterized protein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A0J5GCU7_9NEIS  ali  19  46LADGMKIKVAETQGETGSCTTMNASGTYANIAVSSGTAAAG-----GCVITATFQAPAHTDLVGDTAVIIPTFGSNSTTWLCSLAS-----------------STVDDAYLPKAC.................... 138
539 8.000e-04UniRef50_I4WFY6 Uncharacterized protein n=1 Tax=Rhodanobacter sp. 115 TaxID=1162282 RepID=I4WFY6_9GAMM  ali  31  2..................................................VTYRTLAASRSIRDKVLVLTPQVDQGSITWSCGD-------------------STIPYRELPRSCRQ.................. 49
540 1.000e-03UniRef50_S6ARP6 Type 4 pili major subunit n=16 Tax=Proteobacteria TaxID=1224 RepID=S6ARP6_PSERE  ali  15  45LAASAKTTVAENAMS----ATSPLDAGWSQPAPTTNVDSVAVNPANGEITITYTDAAGGTNGTLNTIIMVPRSS---------SVALQGGVAPGGAVTWTCNTGSLPARFRPANCRQ.................. 148
541 1.000e-03UniRef50_A0A1B8PUZ6 Uncharacterized protein n=5 Tax=Moraxella TaxID=475 RepID=A0A1B8PUZ6_MORLA  ali  16  69.ISHLKMEMQVYLIDRGQLPTSLAELNLPSNWTPSSK-IKSVDLDSNSVITITIDNAQSKGV----LIFTPTIHQDSIDWQCTTPDIADIGRHLPTCVYTGT................................. 165
542 1.000e-03UniRef50_UPI0009B869B1 hypothetical protein n=1 Tax=Burkholderia glumae TaxID=337 RepID=UPI0009B869B1  ali  17  12LAASARLAVAENAA-------SGAAFGSGYGSPPATRNVESITIDDDTGQIRIAYTTRVAPAGSNTLVLVPSAQAGSITWECFAAGKTASSLPAPGAGPMADAATLAGRLAPPECR................... 139
543 1.000e-03UniRef50_A0A1E4NKK7 Uncharacterized protein n=2 Tax=Xanthomonadales TaxID=135614 RepID=A0A1E4NKK7_9GAMM  ali  27  65LAGSATMAINTYYGIHGKLPTSDAQAESVEPRSAPGKYVGSVAVGPEPGVITV--GWASGVLEGKILVLLPKR-AGRLCWKVDTASTTVPADA.......................................... 159
544 1.000e-03UniRef50_A0A1J0KV05 Uncharacterized protein n=2 Tax=Francisella sp. CA97-1460 TaxID=1542390 RepID=A0A1J0KV05_9GAMM  ali  21  54........VAEYYSLYGQLPNSNEDIGITEP--FTSNYIDSVNILESGFIKIHTTIN-----GGETLIFAPS............................................................... 110
545 1.000e-03UniRef50_A0A0U5IFB8 Fimbrial protein n=1 Tax=Thiocapsa sp. KS1 TaxID=610332 RepID=A0A0U5IFB8_9GAMM  ali  28  48LLGPVKLAVAEYHASHGRLPNATNWLTLTDTGAASGSYVKRIWWNN......................................................................................... 102
546 1.000e-03UniRef50_A0A098FVL7 Fimbrial protein EcpC n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A098FVL7_9PSED  ali  20  48.ASSPKSLVSEAFQSDSLAGITAAATEYNARAQAQSKVVNDIQIDTTNGVITVTLESATTDAAGTTLTFTPNVQGGAIDWACASDTNTTATARGLVVGA---AGTLPAKYAPSECR................... 174
547 1.000e-03UniRef50_A0A0S1AUY6 Fimbrial protein n=6 Tax=Xanthomonadaceae TaxID=32033 RepID=A0A0S1AUY6_9GAMM  ali  21  138...PLTQDVARFASAAGHCPV-NGDSGFESPESYAAGDVASARVGGHCGVEARFRVPGKQALDGKHLWLDYDTQTA--TWTCSS--------------------DVADEHLPAQCRG.................. 232
548 1.000e-03UniRef50_A0A0B0HC41 Type IV pilus assembly major pilin protein PilA1 n=4 Tax=Solemya velum gill symbiont TaxID=2340 RepID=A0A0B0HC41_SOVGS  ali  14  50LSGSCKQVISEKFQEGTTTQATPDSWGCGSAGSPRSLYVDQISTSVTGTITIYIDTALVGA--DNQIAIVPQSSSGTTDWECTAPAV----------------GGVVGRYLPASCR................... 150
549 1.000e-03UniRef50_A0A0H2ZFW8 Type IV pilin structural subunit n=32 Tax=Proteobacteria TaxID=1224 RepID=A0A0H2ZFW8_PSEAB  ali  24  45LAASAKTLIGDSSATAGELAASAVWNAQAGNAGATSKYVTSVRIAEATITVTFNATNVGNIPADSTLVFTPYVQNGSIDWGCASESNAVSSGPD-RNMPALTAGTLPARFAPSECR................... 179
550 1.000e-03UniRef50_A0A0S8CXX4 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium SG8_40 TaxID=1703389 RepID=A0A0S8CXX4_9PROT  ali  17  48..STCRTAISETVQSASSLPSGGDWVCESKAGTALTSFVEVLETSDEGAVRAEIRN-INSLVDGQHIILRPWPDLNR-----SGPVQSGDAVALWDCGPAPTNTEDISSMLPGTCRAGAADLGA........... 163
551 1.000e-03UniRef50_UPI000D0768A7 large pilS cassette protein n=1 Tax=Neisseria gonorrhoeae TaxID=485 RepID=UPI000D0768A7  ali  57  6..................................................................................................DAAGNEKIETKHLPSTCRDKSSAVCTKH......... 33
552 1.000e-03UniRef50_A0A1G0CZM6 Uncharacterized protein n=5 Tax=Nitrosomonadales TaxID=32003 RepID=A0A1G0CZM6_9PROT  ali  24  46LMDGLKTPLTELYTSNGGFDVVATTAATQVAGIISGKYVATIVIPANKTSIQANFKNTSNTTGGTPLSVHMMYNPVSGSWSCANSVDVAASAAVGSDVAATGLNPIPTAILPKSC.................... 175
553 1.000e-03UniRef50_A0A246KYK2 Prepilin-type cleavage/methylation domain-containing protein n=9 Tax=cellular organisms TaxID=131567 RepID=A0A246KYK2_9GAMM  ali  27  45LAAGLKTPIAEAFAQDS---DAATSCAPPANAVTKGKYVASVVPDGCGIVATMSTTGVNSKASGKTVTLTFTPGTGA--WSCASNAPSEVKPKA......................................... 136
554 1.000e-03UniRef50_A0A222R6G9 Large pilS cassette protein n=2 Tax=Neisseria gonorrhoeae TaxID=485 RepID=A0A222R6G9_NEIGO  ali  57  6..................................................................................................DAAGNEKIDTKHLPSTCRDKSSAVCTKH......... 33
555 1.000e-03UniRef50_UPI000364CB57 zinc-ribbon domain-containing protein n=1 Tax=Succinimonas amylolytica TaxID=83769 RepID=UPI000364CB57  ali  26  263.ADGVRRAVELCYLENGSLDRCSTGKGLANPEDYSTKYIARIEVKKGVITATAIQ---ANGLRGSTIIYVPEPHGKTLNW....................................................... 345
556 0.002UniRef50_UPI0009910A2F hypothetical protein n=1 Tax=Chromatiaceae bacterium 2141T.STBD.0c.01a TaxID=1978339 RepID=UPI0009910A2F  ali  13  623..EQAKLLVETFYADNARFPSADEVVELNPGSLNSDRYRISI-VPDDGRVVIEYDDFALY--EGRSVIFVPQIEGDMIGWRCESD.................................................. 702
557 0.002UniRef50_UPI00098D571A hypothetical protein n=1 Tax=Wohlfahrtiimonas populi TaxID=1940240 RepID=UPI00098D571A  ali  20  53LSVGVKLASIDFYEKEQRFPNDNKEAGLVEPNKIQGARVNAIEILPEGKIIIH.................................................................................. 105
558 0.002UniRef50_A0A1H9JI78 Type IV pilus assembly protein PilA n=2 Tax=Azotobacter beijerinckii TaxID=170623 RepID=A0A1H9JI78_9GAMM  ali  15  97.VDSCKSAVSEFIQANAAFPADADAAGCNSTVSTKYMAAGMAVDVATGTITSGAVQNVATGADTFHIILQPTTDAA------RTTAMSAASDTIMGWSCGTDAAATDFKYFPASCRQT................. 207
559 0.002UniRef50_A0A2G6D867 Uncharacterized protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2G6D867_9PROT  ali  22  48.AAAGKTAIWQYYIDHGKMPATQAILAANAPGGSTGAYTKT---SDTEGKITVTLSGINGNVNGETIAFNYIDNGGALKFTCDA------------------ATAIDDQYLPKLCKNNS................ 157
560 0.002UniRef50_A0A1D3IPM9 Fimbrial protein n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A1D3IPM9_NEIGO  ali  62  46LAEGQKSAVTEYYLNNGKWPADNGAAGKDTTN....................................................................................................... 77
561 0.002UniRef50_O85827 Type IV pilin n=5 Tax=Proteobacteria TaxID=1224 RepID=O85827_EIKCO  ali  23  45LTSGLRDDIASIVADTNAFPTAAMVAPNGAASSLDGKYVQGVTVADTGVITVLFDQGV---ISGSNMQLIPMFNNANIQWQCG--------------------GTLNSRYLPSSCQS.................. 149
562 0.002UniRef50_UPI0009E1B1AA hypothetical protein n=5 Tax=Neisseria gonorrhoeae TaxID=485 RepID=UPI0009E1B1AA  ali  65  13LAEGKKSAVAEYYPNHGKWPEDNTSAGVASPPPTS.................................................................................................... 47
563 0.002UniRef50_UPI000D6AB916 hypothetical protein n=1 Tax=Gammaproteobacteria bacterium ESL0073 TaxID=2070539 RepID=UPI000D6AB916  ali  20  47.....KSQMSAYYAENQTC--SQHAISNVDRILTKIHYVEDVVATDKCQIILTFKKDISPDISRQQIILTMIPGPSTHKWTCESTTRRKD-------------------LLPRECR................... 137
564 0.002UniRef50_A0A1F9D7Y0 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_16_47_11 TaxID=1797838 RepID=A0A1F9D7Y0_9DELT  ali  32  47.MASIKSAVWAYHHDTESWPNCTTITEVQNSLGVAVNRISGVTIVNGFITVTIRN--VDPIVDGKTLILMPPSGDGSTGWT...................................................... 128
565 0.002UniRef50_A0A1A9M5F5 Prepilin-type N-terminal cleavage/methylation domain-containing protein n=15 Tax=cellular organisms TaxID=131567 RepID=A0A1A9M5F5  ali  30  45LASGLKTPIAEAYSQDN---TDANSCVKPAGTISTGKYVASLEVAGCTITATMKAAGVNEKVNGKAVALAYNKTTGAFT........................................................ 124
566 0.003UniRef50_A0A1E4US71 Pilin (Bacterial filament) subfamily n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E4US71_9PSED  ali  15  47.ASSIKIGVADLFANRGIAGVAAYSAEIEDDPNLQTDKIEAIAVDAATGAISITREGVPQLATENVLVYTPYIGGEAI------ADDNSTGSIVWRCNPNVSETTILAKYLPAECRD.................. 165
567 0.003UniRef50_A0A0H2LRI1 Fimbrial protein n=13 Tax=Burkholderiales TaxID=80840 RepID=A0A0H2LRI1_VARPD  ali  26  308.AAPVREALGNYYKQKEEIPDSLAAAG--APETLPGG--SELTLDPDTMVVEAVLPKVKG-----TLRMEPSATDDGIAWNC------------------VAGDDLPEKALPATCRK.................. 396
568 0.003UniRef50_A0A259RJ75 Uncharacterized protein n=1 Tax=Halothiobacillus sp. 14-55-98 TaxID=1970380 RepID=A0A259RJ75_9GAMM  ali  21  50VANSIKTAVADTYQSNGAFSVNSINVKLPVTTAMATIDVQNTT---GVITIKYDGSAAPSQIKDMTLTLTPNVKGAPMEWACASTTSTTANAAGLVSSPG----TLLAKYAP....................... 162
569 0.003UniRef50_C5CJM2 Fimbrial protein pilin n=4 Tax=Betaproteobacteria TaxID=28216 RepID=C5CJM2_VARPS  ali  22  52LADGVKKNIELSFPQDNTCPANASAADIGIKTDINGKYILSVTTGGCTVKSTFRGTGVNPKLVSKTITYALVYSVNGSKWTCETDVDASIRPKTCGAT..................................... 158
570 0.003UniRef50_A0A257CIA5 Pilin n=1 Tax=Burkholderiales bacterium PBB6 TaxID=2015568 RepID=A0A257CIA5_9BURK  ali  32  47.VDGTRVTVSEYGQTNGIYPGASTNPS-AASLAITGKYTAAVAADTGVITVTMVAGTVNAAVAGKTVTFTPPT-----------------LAATGTAFNFACSSTAAQKYLPKTC.................... 144
571 0.004UniRef50_A0A257H4Q4 Pilin n=1 Tax=Burkholderiales bacterium PBB4 TaxID=2015566 RepID=A0A257H4Q4_9BURK  ali  19  9.ASSCRTSITEVFQTGTSLPTTADGFGCESSVS-TSKYVAQISVITVTSQGINNRLSGSTYTTGGTVRLAPCSTAASTFASC---APPAAGGVVNSWLCGAGATNVDPKFLPGSCR................... 133
572 0.004UniRef50_A0A1E4NLW1 Uncharacterized protein n=2 Tax=Xanthomonadales TaxID=135614 RepID=A0A1E4NLW1_9GAMM  ali  20  51....AKIGVANAILSNPTPPSSNAEARLAAPNQLGSQEIDSILVSAGGVINVYLSQAVG--VGNGIVQLVPKVVTDGVQYTCYSPNIPDIATAAPECTY.................................... 148
573 0.004UniRef50_A0A1H8NUD8 Type IV pilus assembly protein PilA n=1 Tax=Halomonas aquamarina TaxID=77097 RepID=A0A1H8NUD8_9GAMM  ali  24  55VTAGVRADVAEQHSLTGSMPQTG-DFDDATNLGITGRYVRNVAYSGGGGVITVTFNDDSALGNGKTMKI--STSNPQSGWVC----------------AVGDNDPIEENHLPAGCKD.................. 155
574 0.004UniRef50_A0A0F6TR93 Fimbrial protein n=29 Tax=root TaxID=1 RepID=A0A0F6TR93_9GAMM  ali  23  48.MAACKTSVSETYSSNGNNLGSIDTAASGCNTT-ATQYMSQLAVSS--GVITVTATNIGTGVDNGTLSLTPTTNGIVTDWTCSS-------------------SNIGTQYVPSNCR................... 143
575 0.004UniRef50_Q03166 PilE protein (Fragment) n=1 Tax=Neisseria gonorrhoeae TaxID=485 RepID=Q03166_NEIGO  ali  74  1......SAVTEYYLNNGKW-RRQGAAGVASSSSIKGKYVKEVKVEN......................................................................................... 39
576 0.004UniRef50_F2B957 Type IV pilin structural subunit (Fragment) n=15 Tax=Proteobacteria TaxID=1224 RepID=F2B957_9NEIS  ali  23  59LAEDLKNEIAIYGRTNSSELESTSWNKRSASKGALTKYVDSVLADNGVITVSYNAAQIGVAPNQNTLVITPMVNTNAVDWACSSDTHATADKSGMTAAK---SGTLSNKYAPSICR................... 192
577 0.004UniRef50_Q21J05 Fimbrial protein pilin n=1 Tax=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) TaxID=203122 RepID=Q21J05_SACD2  ali  16  269.....QVAVEETAVSSNFVPNSNLDAGINL--KATSPHLNSIKVVEGGEIELLFNPFTANQ-ESHSITLTPQFNTRSASWDCR-------------------GGSLPNMYRPVACRKN................. 364
578 0.005UniRef50_A0A1A6XP70 Uncharacterized protein n=4 Tax=Stenotrophomonas TaxID=40323 RepID=A0A1A6XP70_STEMA  ali  18  45LTAPFKIAVEENIVDHGRL--DARACADVRPLDVATGNVAALQCEGDGVLSIRTTEAAG----GVSLDLVPSVNGGLLVWICRVKAGS-------------------RRHVPAVCR................... 136
579 0.005UniRef50_A0A2W4VU11 Uncharacterized protein n=1 Tax=Xanthomonadaceae bacterium TaxID=1926873 RepID=A0A2W4VU11_9GAMM  ali  29  133...AAKVAVEEFRANTDRCPRDAAEVGLTVPSTLDGLEVGTLTDGRCVVTLTVGMLGTEDSARGGQLLFTREDNG---TWSCS-------------------GDGIPGNLLPSHCR................... 225
580 0.005UniRef50_UPI00038276F9 prepilin-type N-terminal cleavage/methylation domain-containing protein n=1 Tax=Fangia hongkongensis TaxID=270495 RepID=UPI000  ali  18  48VIGAVEQKIADYRQQNGTFDGANNTSLDIDSQSTVSDVISSLTIENGIITIALLSKYSDDSNDANPRWLEPTVIENAVVWLCASTSG................................................ 135

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.