current user: public

If you have questions about the server, please let us know.

Query: 1wva_A mol:protein length:322 Arginase 1, from PDB1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320
# Score Template Links and tools%idFirst MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSFTPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPKLast
1 -90.200[E] KOG2965 Arginase  ali follow..  58  19LKKSVHSVAVIGAPFSQGQKRKGVEHGPAAIREAGLMKRLSSLGCHLKDFGDLSFTPVKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSSGNLHGQPVSFLLRELQDKVPQLPGFSWIKPCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDRLGIQKVMERTFDLLIGKRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTGLLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREGGHIVYDQLPTPS 341
2 -70.700[E] COG0010 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family  ali follow..  23  29PVETDAEWVITGVPFDASSGRAGTRFGAEAIRRASVNLAWEHCRFPWD-----VRERLKIVDCGDLVYSFGDNQNFVEELEAHATALLKAGKRCLTFGGDHFITLPLLRAHAKHFGKLAMIHFDAHTDTYENG---SRYDHGTMFYHAPNEG---------------LIDAAHSVQIGIRTEFDRN------LPFTVLSAPQVNEESVAQTVAKIKEVI---GDLPVYLTFDIDCLDPAYAPGTGTPVCGGLSTDRALKILRALKDV-NIVGMDLVEVSPAYDQSDITALAGATLALEMLYMQGAKK............... 305
3 -67.900[E] KOG2964 Arginase family protein  ali follow..  23  58.RSEDFDIAFIGMPFDTGSYRPGARFGPSSLREGSRRINTKYGAVNVPLEINPFKSWAKLVDCGDIPVTTYDILKAMDQLESAYFQLITVLPRVLSLGGDHTIVLPILRALHRVYGPISVIHFDSHLDTWAPGLIGDGDNHGSYFYFASQEG---------------IMSKDANIHAGIRTPSFSDYDDDVDCGFKIIEAREIDDLGIDGIVKKIRDRV---GDNLVYLSIDIDVLDPAFAPATGTPETGGWSSREMRAILRGLQGL-KFVGADLVEVAPAYDVAEITSLAGAQLLFDIVSMMVKYPLVKEADLSRYMPIHK 385
4 -5.640[R] COG4914 Predicted nucleotidyltransferase  ali follow..  2.................................................................CLIEPMRLDKYKTALRKVAKSLNEKGVEFVLIGS---AVLPFVYNIDYDPRDVDLFIINKSTVLDNELFEEIAEENDWDMGTSDHGTIYYELIVEGEAVRVDLLENILDIYIPPELLADLKEVDIDGIKVKSIGLEQLLALKAKIATKE-------------------AEEFINEVARMVLERNIRVDYEKIKKYATAYPEDAEGILKRLRRNGIYIE....................................... 197
5 -5.540[E] KOG2250 Glutamate/leucine/phenylalanine/valine dehydrogenases  ali follow..  13  171......KCAVVDVPF--GGAKAGVKINPKNYTENELEKITRRFTMELAKKGFIPGVDVPAPDMNTGEREMSWIADTYASTIGHYDINAHA---PISQGGISATGRGVFHGIENFINQASYM---------------------------------------SILGMTPGFRDKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGEWNPDGID--PKELEDFKLQHGSEGSILEVDCDILIPAAANGPTTPEADKIFLERNILVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLLSV................ 470
6 -5.430[S] COG3876 Uncharacterized protein conserved in bacteria  ali follow..  15  35......................................................................PKVQTGIDTLLPDYKKQLKGKRIGLITGVNTSLKSSVDILYENPDIKLTALFGPEHAQAGDEVGSYIDEKTGVPVYSLYGKTKKPTPEM---------LKNVDILMFDIQDV-----------GTRFYTYIYTMAYAMEAAKENGIPFMVLDRPNPQ-NHIEGPILEPEYASFVGIPLKHGMTIGELASLFNKIDADLTVVRLPFVLPSPNMPTVESTFVYPATGLIEGTNISEG---RGTTKPFELIGAP. 291
7 -5.320[J] KOG1466 Translation initiation factor 2B, alpha subunit (eIF-2Balpha/GCN3)  ali follow..  12  119...........................KTSISLTAGCDLFIRYVTRTSALEYEDFNSAKSRLLERAEKFGEISCKARRIIAMLSQDFIFDGCTILV--GLSRVVLEILKTAAQNNKLFRVLCTEGRPDGTGVLLSSELSKLDIPVKLLLDSAVAY------------SMDEVDMVFVG---------------------ADGVVESGINMMGTYQIALVAHSMNKPVYVAAESYKFARLYP-------------QKDMAPALRPIEFGVKIPTKVEVERSARDYTPPQYLTLL............................. 341
8 -5.140[H] COG1797 Cobyrinic acid a,c-diamide synthase  ali follow..  11  17...TTVTLGLMAAFVEKGNIVQGFKCGPDYIDPSYHRAVTKRASRNLDSW----------------MVSEDVVNDIFIEGCNGADLSIIEGVMGFYDGKASTSDKGSTADISLLLQAPVLLVVDISGMARSAAAVVKGFQQLNEKVKIAGVILNGAGSERHAEMCSEAIKEAGIPALGY--LKKGDVPSIPERHLGLVPALERGE--HDSLFSQLAAVVSR--------QFDLERIPSVVKIAVAYDAAFHFYYEENFTLLRQA-------GAELVYFSPLRGED..................................... 286
9 -5.070[B] KOG1344 Predicted histone deacetylase  ali follow..  14  112......................................................................RPLRTQTGGTIMAGKLAVERGWAINVGGGFHTLAIKFLFERVEGISRATIIDLDAH--------------QGNGHERDF-------------------MDDKRVYIMDVYNRHPGDRFAKQAIRRKVELEWGTEDDEYLDKVERNIKKSLQELPDVVVYNAGTDILDRRMVRGRRVPISGGYQKRTARIIADSILNL--FGLGLIGPESPSVSAQNSDTPLLPPAV.......................... 346
10 -5.050[J] COG0324 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  13  2....KPTAIFLMGPTASGKTDLAIQLRPVEVISVDSALIYKGMDIGTEELALAPHRLIDILDPSESY----SAMNFRDDALREMADITAQGKIPLLVGGTMLYYKALIEGLSPL---------SADENIRAELEQKAAQQGWAALHTELAKIDPISAARINPSDSQRINRALEVFYITGKSLTEEEKGEALPYDFVQFAIAPQDRHVLHERIEQRFHKMIELG-----FQAEVEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYAYEEMI................................................... 261

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.