current user: public

If you have questions about the server, please let us know.

Query: 3lhl_A mol:protein length:287 Putative agmatinase, from PDB1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280
# Score Template Links and tools%idFirst MSLNYEESNLIVFGVGFDGTTSNRPGARFASSSMRKEFYGLETYSPFLDLDLEDYNICDYGDLEISVGSTEQVLKEIYQETYKIVRDSKVPFMIGGEHLVTLPAFKAVHEKYNDIYVIHFDAHTDLREEYNNSKNSHATVIKRIWDIVGDNKIFQFGIRSGTKEEFKFATEEKHTYMEIGGIDTFENIVNMLNGKNIYLTIDLDVLDASVFPGTGTPEPGGVNYREFQEIFKIIKNSNINIVGCDIVELSPDYDTTGVSTVIACKILRELCLIISDKIKEGLast
1 -93.000[E] COG0010 Arginase/agmatinase/formimionoglutamate hydrolase, arginase family  ali follow..  27  28.NPVETDAEWVITGVPFDASVSGRAGTRFGAEAIRRASVNLAWEHCRFPWDFERLKIVDCGDLVYSFGDNQNFVEELEAHATALLKAGKRCLTFGGDHFITLPLLRAHAKHFGKLAMIHFDAHTDTYENGSR--YDHGTMFYHAPNLIDAAHSVQIGIRTEFDRNLPFTVLSAPQVNEESVAQTVAKIKEVIGDLPVYLTFDIDCLDPAYAPGTGTPVCGGLSTDRALKILRAL--KDVNIVGMDLVEVSPAYDQSDITALAGATLALEMLYMQGAKK... 305
2 -83.600[E] KOG2964 Arginase family protein  ali follow..  26  55LSKRSEDFDIAFIGMPFDTGTSYRPGARFGPSSLREGSRRINTKYGAVNVPLSWAKLVDCGDIPVTTYDILKAMDQLESAYFQLIAVLPRVLSLGGDHTIVLPILRALHRVYGPISVIHFDSHLDTWDGDEADGINHGSYFYFASQIMSKDANIHAGIRTPSFSDYDDDVDCGFKIIEAREIGIVKKIRDRVGDNLVYLSIDIDVLDPAFAPATGTPETGGWSSREMRAILRGL--QGLKFVGADLVEVAPAYDVAEITSLAGAQLLFDIVSMMVKYPLV. 372
3 -70.100[E] KOG2965 Arginase  ali follow..  21  19..LKKSVHSVAVIGAPFSQG-QKRKGVEHGPAAIREAGLMKRLSSLGCHLKTPVPKDDLYNNLIVNPRSVGLANQELAEVVSRAVSDGYSCVTLGGDHSLAIGTISGHARHCPDLCVVWVDAHADINTPLTTSGNLHGQPVSFLLRCISSASIVYIGLRDVDPPEHFILKNYDIQYFSMRDIDVMERTFDLLRQRPIHLSFDIDAFDPTLAPATGTPVVGGLTYREGMYIAEEIHNTG-LLSALDLVEVNPQLATSEEEAKTTANLAVDVIASSFGQTREG 329
4 -6.440[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  13  45...........................................................................................IVVGGKTSFLHRLVCHTFDSKSHGYVVNLDPAVM------SLPFGANIDIRDTVKYKEVMKQYNLGPNGGILTSLNLFATK---------FDEVVSVIEKRADQLDYVLVD--------TPGQ-------FTWSASGAIITEAFASTFPTVVTYVVDTPRSSSPITFMSLYACSILYKT........... 202
5 -6.270[O] COG0265 Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain  ali follow..  10  142...............................HVVTGMGSIKVLLNDKREYTAKLIGSDVQSDVALLKIDATEELPVVKIGNPKDLKPGEWVAAIGADNSVTAGIVSAKGRSLPN-PFIQTDVAINPGN-------SGGPLFNLKGQV--------VGINSQIYSRSGGFMGISFAIPIDVAMNVAEQLKNTGKVQRGQLGVIIQEVSYGLAQSFGLDKAGGAL---IAKILPGSPAERAGLRAGDIVDGGEIRSSGDLPVMVGAITPGKEVSLGVWRKGE. 382
6 -6.170[C] COG1031 Uncharacterized Fe-S oxidoreductase  ali follow..  13  204......................................................................SRDVQAILKEIESLYRAGCRAFRFGAANILAFGLYSGTREVAPHLEVLHTDN-----SYLVTYEKECRKIVETIVRYNTPGDVFSFGVESFDENVLKKNNVQGSPEEFLKAIAVVNEIGGVRVDGIPKLLPGVNLI-------FGLPGETEETLKKNYSYLKRILDEGYLLRRINIRKLLA.............................. 391
7 -6.050[BQ] COG0123 Deacetylases, including yeast histone deacetylase and acetoin utilization protein  ali follow..  11  89............................................................GVFDRALLAAGGAIRAAQAVLNKECENAFAMIRPPGHHAMAIMVKWLLKQGFERIAILDWDAH-------------HGD-----------------GTQEIFYND----------------------------DRVLFISTH----QMPLYPGTGYPLPPGTGDEGYMMVIDEIIEPVVNEFKPQFIAISAGQDNHFTDPITSLALMMRRAVAMAEKHCDG 283
8 -5.970[O] COG5504 Predicted Zn-dependent protease  ali follow..  11  60...............................................................KLKEKGFYGHIQKEEQYLKNKWQGPDVPIVTERNRRIRLEFGSKSGLAFQDKMFLFLSSDLDFGSALMTHEYHHVCRLGHLKDVTLLDTIIMEGLAEYAVYER-FGRSQTAEWTTWYTPEQLQALYEKKIAPHRDIKRDNRLFPQLLFGKGYQPKMLGYA------------------VGFNIVK-ASKASTADGLSIPAETFLDAML.......... 261
9 -5.880[R] KOG1533 Predicted GTPase  ali follow..  3.........................................................MNLNEKKQLLRVRVYATSEKGENLGSTHWTMYGVLVIGGKSTFCAGLTDIFSQTKRPFLTINLDPANDT-------AYAPDVNITEMITVNDVMDRLGLGPNGALKYCIETLGAN------------CNWLLQKIEAHKKYLIIDC---------------PGQLELYELWKVIRFLEKSGVRLCALHLADSLYCSDPSKFISLSTLATMVTM........... 193
10 -5.580[H] COG2099 Precorrin-6x reductase  ali follow..  26........SILILG-----------GTA-------DARILAGRLAEDSGYRILLSMAGRTLSPVEQPVPMRSGGFGGAAGLADFIRAEGFDILVDATHPYAARISANAVEAARLANIPLVVLSRPVWPRQPGDTWQSVHTVGQAVTALGTTGFLALGRQELLPEAAPQHSYLIRSVDPVEPPLRAPDARYITARGPFVTEDEIRMLEENRIEVVISKNSGGSASYGKIEAARRL--------GLPVIMIEPQQLNDTPANNVTVPDIATALTAIRHQENRG 281

FFAS is supported by the NIH grant R01-GM087218-01
1 4 1 5 6 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Sequence clustering strategies improve remote homology recognitions while reducing search times. Protein Eng. 2002 Aug;15(8):643-9.