current user: public

If you have questions about the server, please let us know.

Query: 5Y8X Entity 2(prereleased), from PDB1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst TTHFTVTDQWGNVVSYTTTIEQLFGTGILVPGYGLFLNNELTDFDAIPGGANEVQPNKRPLSSMTPTIVFKDEKPVLTVGSPGGTTIIASVFQTILNYFEYGMSLQDAIEEPRIYTNSLTSYRYESGMPEDVRRKLNDFGHKFGSNPVDIGNVQSIFIDRENKTFMGVADSSRNGTAVGVNNKTSAELast
1 -62.600[E] COG0405 Gamma-glutamyltransferase  ali follow..  29  339TAYAAVIDADGNAVSFIQSLYFEFGSAVTAGDTGILLQNRGSFFSLDENHVNTLEPRKRTFHTLMPAMVCKGGKPKILYGTQGGEGQPQTQTAIITRMLDYGMHPQQAISEPRWVWGRTWGLRVEGRFTDKTIQKLKDSGHLVEVVGPLMGQAAAIKVDEE-GFLQGGADPRGDGAAVGI....... 525
2 -60.800[E] KOG2410 Gamma-glutamyltransferase  ali follow..  28  441TSHVSIIDSHGNAVSCTSTVNQILGSMRASPTLGIVWNDQMDDFSYAPSETNFIQPGKRPMSSMSPMIIYNENRVEMVTGASGGSYIISATAQTVIRTLLFNQTVKAAVDAPRFHNQYLPETETEEAMPLALREVLVEQKQNFTVVPRQKSVVQALIS--LEGFVEGNSDFRRKTATYPAG...... 632
3 -6.920[S] COG4019 Uncharacterized protein conserved in archaea  ali follow..  17  39...TVVPNWNAEKVDAINDVLRSFN---LREAEHLQFNTNWADLTRMPAVTKALMA----LDISGADLVIARGR----LGVPGSGSL-------LVIMDSRGRLLSAAMSPPHVIHS----MEVREAVRSEMTHALERIGFK............................................. 155
4 -6.060[E] COG1465 Predicted alternative 3-dehydroquinate synthase  ali follow..  14  236..........GDRVCVDTCSLMSEGEGMLVGSTSFLIHSESLENPYVEPRPFRVNAGPVHAYIRVPG--LRPGDEVLIVDTEGRTR---------------------AAVVGRLKIERRPLMLIRAEYEGVEIQTIVQNAETIHLVREDGEPVSVVDLKPGDKVLAYVETEEGKGRHFGME...... 394
5 -5.650[J] COG1588 RNase P/RNase MRP subunit p29  ali follow..  12  40KRNIIWHELIGLKVRVVNSMHPGF-----VGIEGYVVDETRNMLVIVGDKVWKV-----PKDVCIFEFETEDGAKIKIPGE.......................................................................................................... 110
6 -5.540[R] COG3193 Uncharacterized protein, possibly involved in utilization of glycolate and propanediol  ali follow..  17  30...VAVLDAGGHLVAFQKRFEIAFGKAYGALAVGFGSRWLDKASADRPHFVAGLTSISGGKIVPVPGVRDQAGRLLGAVGITGDT...................................................................................................... 121
7 -5.480[J] COG0242 N-formylmethionyl-tRNA deformylase  ali follow..  11  48..............EIAKRYGLRSGVGLAAPQINISKRMIAVLIPDDGSGKS------YDYMLVNPKIVSHSVQEAYLPTGEGCLSVDDNVAGLVHR.......................................................................................... 124
8 -5.380[F] KOG2387 CTP synthase (UTP-ammonia lyase)  ali follow..  4.............VVVSGGVISGIGKGVLASSTGMLLKTLGLKVTSIKIDP-NIDAGTMSPLEHGECFVLDDGGET----DLGNYERYLGITLSRDHNITTGKIYSHVISRERRGDYLGKTVQIVPHLTNAIQDWIQRVSKIPVDDTGLEPDVCIIELGGTVGDIES.................... 156
9 -5.110[S] COG5591 Uncharacterized conserved protein  ali follow..  15  18.................................................................................................................................DALVQLSNEFTWKISEMEIDDGCYELHVTDENGNVLKVKVDPE-TMKVVAGKVKRYGD 74
10 -5.060[J] COG0072 Phenylalanyl-tRNA synthetase beta subunit  ali follow..  13  108..........DAVVDVTNYVLLELGQPMHAFDKDRIEGGIVVRMAKEGETLVLLDGTEAKLNA-DTLVIADHNKALAMGGIFGGSGVNDETQNVLLECAFFS-PLSITGRARRHGLHTDASHRYERGVDPALQYKAMERATRL............................................ 240

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.