current user: public

If you have questions about the server, please let us know.

Query: 5YXK Entity 1(prereleased), from PDB1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst SMLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLALast
1 -15.200[R] KOG3515 Predicted transmembrane protein of the immunoglobulin family of cell adhesion molecules  ali follow..  19  366VSENIVVNPGEDAMLSCTVE---GKPLTEEHVKWERVGYDM----------------TVKTSTTFANGTSYLHIKDAKREDVGNFRCVADNRVDNPTN----RDILLIV.. 451
2 -14.400[T] KOG4194 Membrane glycoprotein LIG-1  ali follow..  15  717DLSPMLIKKRDALKIDCSCDLISSRQ----RMVWKRQQQVIL-----------------LKKAKFSDNDQILTLTQTTFSDSGEYSCELWVDDTILMRKITMVKV...... 801
3 -8.850[T] KOG3611 Semaphorins  ali follow..  19  550PLQKVSLAPNSRYYLSCPMESR------HATYSWRHKENVEQ-----------------SCEPGHQSPNCILFIENLTAQQYGHYFCEAQEGSYFREAQHWQLLPE..... 632
4 -7.570[GC] KOG1192 UDP-glucuronosyl and UDP-glucosyl transferase  ali follow..  14  48RIKVVHAVRGADVILPC-VSPEDGVEIDSTKFDWQRMFVPLSSMHFDASESISDRIRRFTSKDE-IGDRYELVLKDVDANSTGHYRCINRHGRNVISNMYFLEVSNTK... 201
5 -6.550[N] COG5492 Bacterial surface proteins containing Ig-like domains  ali follow..  171EPTNATVKVGATTAVTFTVKPD---NVTDKSLRIATSDPTTATVTQAENI------------KGVKAGTVKIIGM----TTDGNFT----------------AIADITVQA 249
6 -5.690[K] KOG2906 RNA polymerase III subunit C11  ali follow..  11....LRYEGGGNSRFFCSTCPYVAYIQRQVEIKKKQLLVKKSIEAVVTKDDIPTAAETEAPCPRCGHDKAYFKSMQIRSADEPEYRC........................ 96
7 -5.550[K] COG2093 DNA-directed RNA polymerase, subunit E``  ali follow..  23....................................................RDLSEEWFDLVIIIDVENSEIAKKIGAKVPGKYAVRVR..................... 60
8 -5.410[S] COG5513 Predicted secreted protein  ali follow..  14  181NGTTISLEKGETFYLRLEENPTTG-------YSWELNLSQGLSLVSDDYYPPEAEESE---------GAGGVHLWEIKADSEGKQQATAIYKRSWENETGTEDKFILNVE. 278
9 -5.370[O] KOG1730 Thioredoxin-like protein  ali follow..  63RSKFVESDADEELLFNIPFTGNVKLKGIIIMGEDDDSHPSEMRLYKNIPQDTEREPDQTFSLNRDLTGELEYATKISRFSNVYHLSIHISKNFGADTTKVFYIGL...... 171
10 -5.270[Q] COG3485 Protocatechuate 3,4-dioxygenase beta subunit  ali follow..  15  60.........GERITIKGRVIDGMGAPLRDALVIWQADAA----LYNSPNESRGKADPHFRGWGRCPSNM-----------ETGEFETIKPGRVPFRDGRLMAPHVTLWIVA 150

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.