current user: public

If you have questions about the server, please let us know.

Query: 5Z0M Entity 2(prereleased), from PDB1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MPEITRRRALTAAAAVAATASAAVTLAAPAASAAGHHEPAAPESFDEVYKGRRIQGRPAGGGAHHHEHGGGYEVFVDGVQLHVMRNADGSWISVVSHXDPVPTPRAAARAAVDELQGAPLLPFPANLELast
1 -8.440[Q] COG2132 Putative multicopper oxidases  ali follow..  14  1MTGWTRRGLLKTAAVAGATGVGLSAIGRLGGLAATSPETNNVLTYGNAGMPPVLRMKKGEPFAARLVNAIDDPTTIHWHGIRLPNKMDGDYAFTPPDYHPHC---NTLEQMGHGLTGVIVVENPNDPK 163
2 -8.140[C] COG2080 Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs  ali follow..  17  21.LSLTRRDLIK-VSAATAAAAVVYPHSTLAASVPAATPAPEIMPLTLKVNGRENLHLIGTKKGCDHGQCGACTVLVNGRRLTLAVMHQGAEITTIEGLGSPDNLHPMQAAFIKH.............. 153
3 -7.980[S] COG3490 Uncharacterized protein conserved in bacteria  ali follow..  17  10...IDRRSFIKAAGIPFLAALAPRSLHALERTDAVFASAFRARDGSYGIRGEIIDRVALPARAH------GMATSHATGRTVAFARRPGTFFMAFD................................ 101
4 -7.660[S] COG4319 Ketosteroid isomerase homolog  ali follow..  16  101.....................................................................DGQKAALWYRLTLGLTRTDRGWKIAHQHESVPFYMDGSFKAAID............... 144
5 -7.390[MP] COG3015 Uncharacterized lipoprotein NlpE involved in copper resistance  ali follow..  13  3......KKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQAAELKPMPQSWRG-------------------------EGIETSLFLEKDGTWVMNERYLGA............................ 78
6 -7.050[C] COG0243 Anaerobic dehydrogenases, typically selenocysteine-containing  ali follow..  12.ASLSRRSLVKTSAIGSLALASSAFTLPFSRIAHAAADLASGNVAEKAVKDDTVYWVESDTTGNDEYGNHQVRACLRGRSKRVGKRGEGKF-ERISWDEALDTIGDNLKRILKDYGNEAVH....... 163
7 -7.030[P] COG2837 Predicted iron-dependent peroxidase  ali follow..  32  9VNEPSRRRLLKVIGALALAGSCPVAHAQKTQSAPGTLSPDARNEKQPFY............................................................................... 57
8 -6.800[M] COG3511 Phospholipase C  ali follow..  29  1...MSRRAFLAKAAGAGAAAVLTDWAAPVIEKAYGAGPCSENRSFDHYF-G............................................................................. 61
9 -6.580[S] KOG4509 Uncharacterized conserved protein  ali follow..  18  180...........................................KYEDSLHDRKIY-------------SNGYIIKI-GRGLHFYKPANPMYSIGLVNYK-----RKCLQTDVDIWRNSS......... 238
10 -6.410[F] COG4290 Guanyl-specific ribonuclease Sa  ali follow..  12  25FGHMLRKFTLSATVLLVLATLWGMHALHVSNPESAPGPQNHPAEARTLVRGIIFGNREKRLPARPYGYYREYTVETPGSH-RIVTGGDPPYYSD-NHYTSFRSFNVSTR................... 173

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.