current user: public

If you have questions about the server, please let us know.

Query: 5Z4P Entity 4(prereleased), from PDB1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430
# Score Template Links and tools%idFirst MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMMAACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRGLKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADLast
1 -119.000[Z] KOG1376 Alpha tubulin  ali follow..  41  1MREIISIHIGQAGIQVGNSCWELYCLEHGIQPDGMMDTTVGVAHDAFNTFFSETGAGKHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLISGKEDAANNFARGHYTVGKEIVDLCLDRVRKLADNCTGLQGFLVFNAVGGGTGSGLGSLLLERLSVDYGKKSKLGFTIYPSPQVSTAVVEPYNSVLSTHSLLEHTDVAVLLDNEAIYDICRRSLDIERPTYTNLNRLISQIISSLTTSLRFDGAINVDITEFQTNLVPYPRIHFMLSSYAPVISAAKAYHEQLSVPEITNAVFEPASMMAKCDPRHGKYMACCLMYRGDVVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQDLAKVQRAVCMISNNTAVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDYEEVGAEGGD 441
2 -117.000[Z] KOG1375 Beta tubulin  ali follow..  93  1MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPSGNYVGDSDLQLERISVYYNEASSHKYVPRAILVDLEPGTMDSVRSGAFGHLFRPDNFIFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKECENCDCLQGFQLTHSLGGGTGSGMGTLLISKVREEYPDRIMNTFSVVPSPKVSDTVVEPYNATLSIHQLVENTDETYCIDNEALYDICFRTLKLATPTYGDLNHLVSATMSGVTTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTRRGSQQYRALTVPELTQQMFDAKNMMAACDPRHGRYLTVATVFRGRMSMKEVDEQMLAIQSKNSSYFVEWIPNNVKVAVCDIPPRGLKMSSTFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAE 431
3 -116.000[Z] COG5023 Tubulin  ali follow..  76  1MREIIHISTGQCGNQIGAAFWETICGEHGLDFNGTYHGHDDIQKERLNVYFNEASSGKWVPRSINVDLEPGTIDAVRNSAIGNLFRPDNYIFGQSSAGNVWAKGHYTEGAELVDSVMDVIRREAEGCDSLQGFQITHSLGGGTGSGMGTLLISKIREEFPDRMMATFSVLPSPKTSDTVVEPYNATLSVHQLVEHSDETFCIDNEALYDICQRTLKLNQPSYGDLNNLVSSVMSGVTTSLRYPGQLNSDLRKLAVNLVPFPRLHFFMVGYAPLTAIGSQSFRSLTVPELTQQMFDAKNMMAAADPRNGRYLTVAAFFRGKVSVKEVEDEMHKVQSKNSDYFVEWIPNNVQTAVCSVAPQGLDMAATFIANSTSIQELFKRVGDQFSAMFKRKAFLHWYTSEGMDELEFSEAESNMNDLVSEYQQYQEATVE 431
4 -112.000[Z] KOG1374 Gamma tubulin  ali follow..  32  3.SEIITLQLGQCGNQIGFEFWKRLCLEHGISPDGVLEDFATDGQDRKDVFFYQADDNHYIPRAVLIDLEPRVINNIMTSPYSKLYNQENVFLSKHGGAGNNWASGFSQGEKVQEEVFDILDREADGSDSLEGFVLCHSIAGGTGSGMGSYVLERLSERFPKKLIQTYSVFPNQEISDVVVQPYNSILTLKRLTKCADSVVVLDNTALNRIATERLHIQTPTFTQINNLVSTIMSLSTTTLRYPSYMNNNLIGLTASLIPTPQLHFLMTGYTPLMSDCETKTSKTTVLDVMRRLLQPKNMMVSAKQSRQCFVSILNIIQGEVDPSQVHKSLQRIRERKLANFIPWGPASIQVALPRSSPYAHKVSGLMMANHTGISSLFKRALAQYDKLRKRNAFLDNFRRESMFQDDLTEARDTVDCLVQEYEAATQIDYP 445
5 -51.800[Z] KOG2530 Members of tubulin/FtsZ family  ali follow..  17  1MREIVTIQVGEFANFVGSHFWNFQDELLGLASDPESDPIFRNHNLDMDVLYRSGETQQYTPRLVSVNLKGALGTMSSRGTLKSHYHPQSLLWMDSQAFNNYGIGKDVSEASRGEEICDRLRFFVEECDHIQGIKFLVDDSGGFS-AVAADFLENMADEYTNVPVLLYSVRTPMSSKKTVSNKLHDAISFSRLSSFCKLFTPIGPSLTGSKASKFLNLGDEKPYRSSAVYAAALHSSTIPFRMQPTSSDDVNTLVQLLTGRGRQNIVAILDSAMPAPTLAGKQLENTLLTSLQALTPEVTEDVEDNQAVESMCILGALRSEDKEALVSEVKNAVDASYEQATTKGKPLFCNLSVSRCPLVHSIPVATRWRSSSAILPFLETRMGNLEKLGIQWGAMGSDVAWGFGREELQEMRENLSKMVSELNPQFFESSD 560
6 -11.400[D] COG0206 Cell division GTPase  ali follow..  17  13..QIKVIGCGGGGNNAVNRMILEGLKN---------------------------------VEFIAINTDKQALALSQA--------SQKIQIGDKLTKGLGAGANPEIGQKAAEESKDEISQAIKGADMV---FITAGMGGGTGTGAAPVVAEIAKSM-----ILTVGVVTKPFPFEGRKRMLHAESGIKTLKERVDTLVTIPNERLLAIVDKKTTLVE-AFKSADDVLRQGVQGISDLITIPGLVNLDFADVRTVM.............................................................................................................................................................................. 218
7 -5.940[IOT] KOG2088 Predicted lipase/calmodulin-binding heat-shock protein  ali follow..  11  84................................................KKDYDQTEGRVTPYMIYLDHENGDVVLAIRGLNL--VLLDNKLGQTKFDGGYVHNGLLKAAMWVFEEEHVVLRELLEANPSYSLTFVGHSLGAGVVSLLVLFVIQNRVR--ERKRIRCFAIAPPRCMSLHLAVTYADVIN----------SVVLQDDFL--------RTTTALENVFKSIICLPCLLCLTCLKDTFTFEERKLKDARRLYAPGRLYHIVVRKPLRLGRYPPVVRTAVPVDVLSCNATADHAIIWIERESQRALDKIVRQKSIVEDHDEEYRAAIMKAASLNIPMSPSPSYGTFHDTEEGESSAGSGMEGSPSGWSFKGMRRKWDQFIDCHFPVNDNSEHMIFKNQESQALLCGQET................. 445
8 -5.180[R] COG5628 Predicted acetyltransferase  ali follow..  11  1...................................................................................................................MLNKVGTHYKIDWNMGEFFIIARF---QNKGVGRQVAKQIWQMHKRLWEVAVI-----PENKPALNDFKAF..................................................................................................................................................................................................................................................... 63
9 -5.100[S] COG3400 Uncharacterized protein conserved in bacteria  ali follow..  3LKKIALILDGIVAKNFLDLVLRHYSNHNFYI-VKNESLIPKNYPSTFAFHCFDATSSFRLLQVAFLIIQDFKEQRIIHKIIQTHFKRMCVVLSVKRDGEKTLENNEENKDELANKFISRLPNIPSTPREFGGKGEIMEIDVPFGSIFAYRHIGSIRQK-------EYRIVGLYRNDVLLLSTKSLVI------QPRDILLVAGNPEILNAVYLQVKSNVGQF-------KSIYLYIDMRLQNRKAMMRDVYQALFLHKHLKSYKLYIQVLHPTSPKFYHKFLALETESIEVNFFYRKSFIQKLHEDHQKKMGLIVVGRELFLSKKHRKALYKTATP--------------YKTNTSGLSKTSQSVVVLNESLDINEDMSSVIFDVSMQMDLGLLLYDFDPNKRYKNEIVNHYENLANAFN........... 414
10 -4.900[L] COG1484 DNA replication protein  ali follow..  12  96.............................................................................................................KDAFECTKEYVADYEQIKDCRKNSIALL---GQPGSG--THLLTAAANELMRTCYVPVIYFPFVEGFTDLKNDFALLEAKLNRMKQADVLFIDDLEQMYSVLNYRYLNHKPILLSSELTIEGL-------VRVDEALGTKIYEMCSDYL............................................................................................................................................................................. 248

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.