current user: public

If you have questions about the server, please let us know.

Query: 5Z6B Entity 1(prereleased), from PDB1018

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .
# Score Template Links and tools%idFirst MKKICYVLLSLVCVFLFSGCSAGEEASGKKEDVTLRIAWWGGQPRHDYTTKVIELYEKKNPHVHIEAEFANWDDYWKKLAPMSAAGQLPDVIQMDTAYLAQYGKKNQLEDLTPYTKDGTIDVSSIDENMLSGGKIDNKLYGFTLGVNVLSVIANEDLLKKAGVSINQENWTWEDYEKLAYDLQEKAGVYGSNGMHPPDIFFPYYLRTKGERFYKEDGTGLAYQDDQLFVDYFERQLRLVKAKTSPTPDESAQIKGMEDDFIVKGKSAITWNYSNQYLGFARLTDSPLSLYLPPEQMQEKALTLKPSMLFSIPKSSEHKKEAAKFINFFVNNEEANQLIKGERGVPVSDKVADAIKPKLNEEETNIVEYVETASKNISKADPPEPVGSAEVIKLLKDTSDQILYQKVSPEKAAKTFRKKANEILERNNLast
1 -67.100[G] COG2182 Maltose-binding periplasmic proteins/domains  ali follow..  15  1MKIKTGARILALSALTTMMFSASALAKIEEGKLVI----WINGD--KGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKA----FQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNP-------PKTWEEIPALDKELKAK-GKSALMFNLQEPYFTWPLIAADGGYAFKYENGKDVGVDNAGAKAGLTFLVDLIKNKHMNA----DTDYSIAEAAFNKGETAMTINGPWAWSNIDT-SKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSY---EEELAKDPRIAATMENAQKGE---IMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK...... 396
2 -66.400[G] COG1653 ABC-type sugar transport system, periplasmic component  ali follow..  11  1MFNNSIHKVSICIALTLTFSANAM------AVTEIPFWHSMEGELGKEVDSIADRFNQSQPDYKIVPVYKGYEQSLAAGIAAFRSGKAPAILQVYEVGTATMMASKAIKPVYQVFKDANIDFDESVVAGYYTDSKTGRLLSQPFNSSTPVLYYNKEAFKKAGLDPEQPPKTWQELAADTAKLRAAGSSWQGWIQIENFSAWHGQPIASRNNGFDGTDAV-LEFNKPLQVKHIQLLSDMNKKGDFTYFGRKDE----STSKFYNGDCAITTASSGSLASIRHYAKFNFGVGMMPDAKNAPQNAIIGGASLWVGKDKETYKGVAEFLQYLVKPEIAAEWHQKTGYLPITTAAYELTKQGFYEQNPGADVATRQMLNKPPLPYTKRLGNMPQIRTVVDEELEAVWTAKKTPQAALDNSVKRGDVLLRRFE 435
3 -28.900[R] COG4134 ABC-type uncharacterized transport system, periplasmic component  ali follow..  12  1MMRHCGWLLGLLSLFSLATHASDQEIKNEAKGQTVWFNAWGGDTAINRYLDVSGEMKTHY-AINLKVRLADAADAVKRIQTEAAAGRKTDLLWVNGENFRTLKEANLLQTDWAETLPNWRYVDTQLPVREDFS-VPTEGAESPWGGAQLTFIARRDVTPQP----PQ---TPQALLEFAKANPGTVT-YPRPPDFTGTAFLEQLLIMLTPDPAALNEAPNDATFARVTAPLWQYLDAL-HPYLWREGKDFPPSPARMDALLKAGTFRLSLTFNPAHAQQKIASG------DLPASSY-REGMIGNVHFVTIPANANASAAXKVVANFLLSPDAQLRKADPAVWGDPSVLDPQKLPDGQRE................................................................... 353
4 -24.100[E] COG0687 Spermidine/putrescine-binding periplasmic protein  ali follow..  14  2MKRFGKTLLALTLAGSVAGMAQAADNK------VLHVYNWSD-----IAPDTLEKFTKET-GIKVVYDV--YDSNEVLEAKLLAGKSGYDVVVPSNSFLAKQIKAGVYQKLD---KSKLPNWKNLNKDLMHTLEVPGNEHAIPYMWGTIGIGYNPDKVKAAFGDNAPVD-SWDLVFK--PENIQKLKQCGVSFLDSPTEILPAALHYLGYKPDTDN--------PKELKAAEELFLKIR-------PYVTYFHSSKYISDLANGNICVAIGYSGDIYQAKSRAEEAKNKVTVKYNIPKEGAGS----MVAIPKDAENTEGALAFVNFLMKPEIMAEITDVVQFPNGNAAATPLVSEAIRNDP................................................................. 330
5 -23.800[P] COG1840 ABC-type Fe3+ transport system, periplasmic component  ali follow..  12  16MEEIMRLTIISSLL--LAGTTLLGVPAHAAGDLNL------CAADVVICEQMKGDFEKTH-DIKVNMVRMSSGEAYAKIRAE-ARNPKTDLWW-TGDPHLQAASENLTLEYKSKMLDQ--------QDWAKNQAESAGYKTVGVYAGALGWGYNTDIFKKKGYKEPK---CWADLLA--PELKGEIQIANPNSSGTAYTALASLVQIMGED------------------QAFDYLKKLNGN-----ISQYTKSGSAPVKAAARGETAVGIVFMHDAVAQTA-EGFPVKSV-APCEG-----TGYEIGSMSIVKGARNLENAKTWYDWALQPDVQSRMKDAKS-LPSNKTAE............................................................................ 317
6 -21.600[H] COG4143 ABC-type thiamine transport system, periplasmic component  ali follow..  12  1MLKKYLPLLLLC-----------AAPAFAKPVLTV-YTYDSFAADWGPGPAVKKAFEADC-NCELKVALEDGVSLLNRLRME-GKNSKADVVLLDNNLLEAATQTKLFAKSGVANEAVKVPGGWKND------------TFVPFDYGYFAFVYDKSKLKNP----PK---SLKELVE--SDQKWRVIYQDPRTSTPGLGLLLWMRKVYGD-------------------NAPQAWQKLAAKTV-----TVTKGWSEAYGLFLKGESDLVLSYTTSPAYHIIEEKKDNYAAANFSEG-----HYLQVEVAARTVASKQPELAEKFLKFMVSPAFQNAIPTGNWMYPVADVALPA.......................................................................... 291
7 -21.400[P] COG1613 ABC-type sulfate transport system, periplasmic component  ali follow..  1MSSNSLAGIVKLALVVGSLQLGSIGLALADTTILN----VSYDPTRELYKEFNAAFAEKWQTVTIQTSHGG-----GKQARSVIDGLEADVVTLALE-----------ADIDAIAKESGKIPADWKSRF----------NNSAPYTSTIVFLVRKGN--------PKAIKDWGDLVREDVQVITPNPKTSGGARWNFLAAWAWARAANNGD-----------------AKAQEYVAQLFKHVPVLDTGARGAT----TTFVQRGLGDVLLAWENEAYLSLEELGPDNFDIVTP--SISIKAEPPVALVDGNVDSKGTRKVAEAYLDYLYSDVGQKIAAKHY--RPFKPELA............................................................................ 297
8 -15.700[P] COG4150 ABC-type sulfate transport system, periplasmic component  ali follow..  11  6VKKNARNGLTHIALFSALILSGVTASAT-------ELLNSSYDVSRELFTALNPGFQAQGDKLTIKQSHAG-----SKQALAILQGLKADVVTY-----------NQITDVQILHDRGNLIPADWQARLPNNSSP----------YSTMAFLVRKG---------PKNIRNWDDLVREDVKLVFPNPKTSGNGRYTYLAAWGATQLADGGD-----------------AKTRDWMKRFLKNVEVFDTGGRGAT----TTFVERGLGDVLISFESEVNNIRKEYGSDQYEVIVP--PVDILAEFPVAWVDKNVEKNGTEKAAKAYLNYLYSPPAQQVITRFN---VYDKAAMEAAKSQFPDTK................................................................. 311
9 -12.900[H] COG2998 ABC-type tungstate transport system, permease component  ali follow..  11  5MKKTTFTLAAASLILVSYSASSADDA-------RIRLATTTSTYDSGLLDYLLPKFEQDT-GYKVDVIATGTG----KALKMGENGDVDLVMTHAPKAEASFVEAGFGVLPRKLM------------------------------YNDFVVVGPES--DPAKIA------DEKNIAKVFENIAK--------------------------------SGAVFISRGDDSGTHKKELGIWAQNKIEPNFGGYRSIGQGMGPTLNMASEMQAYTLTDRGTWLAYNNKLALKILF--EGDEQLFNPYQVIIVNPERYPTTQYHAAKVFSDWLVNPKGQQLINEFKVNVANADK.............................................................................. 274
10 -12.800[P] COG0226 ABC-type phosphate transport system, periplasmic component  ali follow..  10NNRIPVSITVLTLAMSLAACGGQQGSDNTATGGNVSLTGAGASFPAPLYASWFTDLNKKYPNLQINYQSVGSGAGVEQFTVDFGASDVA-------------------------MKDEEIQ------------KVQRGVLLLPVTAGGIVLAYNLPGVTELNLPRVV---TWDAPEIKAAN-SQPITVVYRSDGSGTTGVFTKHLAAVSPEWKSKVGEGKGGKGNEGVTAQIK-----TQGAIGYIEYGYAKQNNISYATLENKAGKFVKYNDESASQTLAAIQLPENLRAFVPDPDGDGSYPIVSFSWIMYPDPVKAKAMEAAIEYALTE--GQKISGELGYIPLPQAVVQKTATVADQ................................................................... 374
11 -10.600[N] COG5567 Predicted small periplasmic lipoprotein  ali follow..  14  1MKNVFKTLAVLLTLFSLTGCGLKGPLYFPPADKN--------APPPTKKVDSQTQSTMPDKNDRATGDGPSQVNY................................................................................................................................................................................................................................................................................................................................................................ 67
12 -10.100[R] COG4588 Accessory colonization factor AcfC, contains ABC-type periplasmic domain  ali follow..  12  1MKKIITLFGACALA-----------FSMANADVNL----YGPGGPHTALKDIANKYSEK-TGVKVNVNFGPQA----TWFEKAKKDADILFGASDQSALAIASDFGKDFNVSKIK---------------------------PLYFREAIILTQKG---------PLKIKGLKDLANKKVRIVVPEGA-------------------------KSNTSGTGVWEDMIGRTQDIKTIQNFRNNIVAFVPNSGSA-----KLFAQDQADAWITWI----DWSKSNPDIGTAVAIEKDLV---------RTFNVIAKEGASKETQDFIAYLSSKEAKEIFKKYG...................................................................................... 247
13 -9.730[R] COG5633 Predicted periplasmic lipoprotein  ali follow..  12  1MRKGC-FGLVSLALLLLVGCRSHPEIPVNDEQSGISAEKPVLSTSDIQPSASSTLYNERQEPVTVHYRFY----WYDARGLEMHPLERPRSVTIPAHSAVTLYGSANFLGAHKV......................................................................................................................................................................................................................................................................................................................... 119
14 -9.580[S] COG4808 Uncharacterized protein conserved in bacteria  ali follow..  15  8FNKLFSLVVASVLVFSLAGCGDKEESNLNGTEIAITYVYKGDKTTKEDAAKTLEPLSAKYKNIAVEEKLTYTDTYAQENVT--------DMEKVDFKALQGISG----INVSAEDAKKGITMAQMELVMKAAG...................................................................................................................................................................................................................................................................................................... 152
15 -9.150[MP] COG3015 Uncharacterized lipoprotein NlpE involved in copper resistance  ali follow..  2VKKAIVTAMAVISLFTLMGCNNRAEVDTLSPAQA------------AELKPMPQSWRGVLPGIETSLFLEKDGTW--VMNERYLGAR.................................................................................................................................................................................................................................................................................................................................................... 79

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.